2HZMA

Structure of the mediator head subcomplex med18/20
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
205
Chain Sequence
GKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II mediator complex subunit 20
publication title Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 51
structure length 205
sequence length 209
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08612 Med20 TATA-binding related factor (TRF) of subunit 20 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.140.20 Mainly Beta Single Sheet q64v53_bacfr protein fold q64v53_bacfr protein fold 2hzmA02
3.30.310.180 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2hzmA01
2HZMA 2HZSA
chains in the Genus database with same CATH superfamily
4D7QA 1YTBA 1MPGA 3OSEA 4I8OA 3D4VA 1YQMA 1YQLA 3OSTA 2HKPA 1NGMA 3C04A 2QLVA 3OSMA 2HL9A 1KO9A 2V8QA 2CR9A 2VJ0A 2Y8QA 3OC3C 2IV9A 1QTPA 1NH2A 3D7QA 1YTFA 1PCJX 5IYDP 3VN5A 2NOIA 2JHJA 1EBMA 2NOFA 2NVMA 4BJUA 1KYDA 2F7LA 4EALA 2JPIA 5HSHA 4OQAC 1M3HA 2FKMX 3SNSA 5JN5A 1QN8A 1J3MA 3IH7A 3CWUA 2QREA 2H5AX 4EAJA 2Z8UA 1HU0A 3UW2A 2NOEA 1T6AA 2Y8LA 1KFQA 4EJYA 2MZ8A 3ENOC 1E42A 1N3CA 2R5XA 3TDHA 2FGTA 3CVTA 1WQAA 1PVSA 3CVSA 1CDWA 3CWSA 2NOZA 1QNEA 1P5GX 2H4LX 1R4XA 1QN3A 1P5DX 1LWYA 1C4GA 1KY7A 3KRMA 2NLVA 4DULA 3CWTA 2OOXA 2DKAA 2D0AA 4CFFA 1VOKA 3I3WA 5IYCP 3ENCA 1UT7A 4MRQA 1QN7A 2QRDA 1LXTA 1VTOA 1K2YX 3ASMA 1QN9A 3RPJA 3OCIA 5KL0A 3H1ZA 1N3AA 1D3UA 1QN4A 1MP9A 1VKLA 3HS9A 4DQYC 2JHNA 4EAGA 1JDYA 1LWVA 3HS8A 4IL8A 1UL7A 5IYBP 4QG5A 1B9KA 1PZDA 1XSZA 2QRCA 4RODB 3PMGA 2YA3A 3CWAA 1KFIA 1QTSA 2LAEA 1LWWA 5JMVD 1TBAB 2XHIA 2NOBA 1AISA 1C9BB 2JOIA 1YQRA 2DKDA 1KYFA 4WZSD 2I5WA 4WXAA 3DPTA 2NOLA 5EPCA 5AN4A 1NVPA 1K35A 1TBPA 1UT4A 4Q11A 5BMPA 1FN7A 1QN6A 2IV8A 2V9JA 1QNBA 1Q9UA 3F10A 3BKQX 1EUVA 2FUVA 3RSMA 2FKFA 3PDKA 2Z0FA 3TE5A 1W80A 1TUOA 3OH6A 3I0WA 2RA8A 3EAYA 4D7RA 3DPUA 5BMNA 1N39A 1QN5A 1QNAA 2DKCA 1RM1A 1JFIC 4OQBC 1M5Q1 4OPXC 3OLPA 3T4NA 2G30A 3KTUA 1KYUA 1QNCA 1C47A 4B0AA 4ROCB 1DIZA 2ZFDB 1V5SA 1PCMX 2PWWA 3ULXA 5F9CA 4EAKA 2NWVA 1PCZA 2HZMA 2QR1A 3N89A 1KY6A 2D0CA 3OGDA 3NA5A 1TGHA 2EHBD 1YQKA 2YH5A 2EOCA 3I0XA 4HJHA 1VOLB 2HL8A 4WX8A 4PY5A 2OOYA 3EIKA 3F0ZA 1M3QA 2D0BA 2NOHA 2MJ7A 4TPSA 1WJWA 4EAIA 2HZSA 2O3OA 4C7PA 3CW7A 1VTLE 4EJZA 2V92A 3OH9A 4ROEB
chains in the Genus database with same CATH topology
1YTBA 1YQLA 4I8OA 1YQMA 3OSTA 1NGMA 3OSMA 1KO9A 2VJ0A 3OC3C 1NH2A 2IV9A 1QTPA 1YTFA 5IYDP 3VN5A 2NOIA 1EBMA 2NOFA 1KYDA 1M3HA 3SNSA 1QN8A 3IH7A 2Z8UA 1HU0A 2NOEA 4EJYA 2MZ8A 1E42A 1N3CA 2FGTA 2NOZA 1CDWA 1QNEA 1R4XA 1QN3A 1LWYA 1KY7A 3KRMA 4DULA 2D0AA 1VOKA 5IYCP 1UT7A 1QN7A 1VTOA 3ASMA 1QN9A 3RPJA 3OCIA 1D3UA 3H1ZA 1N3AA 1QN4A 1MP9A 3HS9A 1LWVA 3HS8A 5IYBP 1B9KA 1PZDA 4RODB 1QTSA 2LAEA 1LWWA 2XHIA 1TBAB 2NOBA 1AISA 1C9BB 2JOIA 1YQRA 1KYFA 4WZSD 2I5WA 3DPTA 2NOLA 5AN4A 1NVPA 1TBPA 1FN7A 1UT4A 4Q11A 1QN6A 2IV8A 1QNBA 3F10A 1W80A 3I0WA 3DPUA 1N39A 1QNAA 1QN5A 1RM1A 1JFIC 2G30A 3KTUA 1KYUA 1QNCA 4B0AA 4ROCB 3ULXA 1PCZA 2HZMA 3N89A 1KY6A 2D0CA 1TGHA 1YQKA 2YH5A 3I0XA 1VOLB 4PY5A 3F0ZA 3EIKA 2NOHA 1M3QA 2D0BA 2MJ7A 4TPSA 2HZSA 2O3OA 1VTLE 4EJZA 4ROEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZM A;  2HZS A; 
#chains in the Genus database with same CATH topology
 4D7Q A;  1YTB A;  1MPG A;  3OSE A;  4I8O A;  3D4V A;  1YQM A;  1YQL A;  3OST A;  2HKP A;  1NGM A;  3C04 A;  2QLV A;  3OSM A;  2HL9 A;  1KO9 A;  2V8Q A;  2CR9 A;  2VJ0 A;  2Y8Q A;  3OC3 C;  2IV9 A;  1QTP A;  1NH2 A;  3D7Q A;  1YTF A;  1PCJ X;  5IYD P;  3VN5 A;  2NOI A;  2JHJ A;  1EBM A;  2NOF A;  2NVM A;  4BJU A;  1KYD A;  2F7L A;  4EAL A;  2JPI A;  5HSH A;  4OQA C;  1M3H A;  2FKM X;  3SNS A;  5JN5 A;  1QN8 A;  1J3M A;  3IH7 A;  3CWU A;  2QRE A;  2H5A X;  4EAJ A;  2Z8U A;  1HU0 A;  3UW2 A;  2NOE A;  1T6A A;  2Y8L A;  1KFQ A;  4EJY A;  2MZ8 A;  3ENO C;  1E42 A;  1N3C A;  2R5X A;  3TDH A;  2FGT A;  3CVT A;  1WQA A;  1PVS A;  3CVS A;  1CDW A;  3CWS A;  2NOZ A;  1QNE A;  1P5G X;  2H4L X;  1R4X A;  1QN3 A;  1P5D X;  1LWY A;  1C4G A;  1KY7 A;  3KRM A;  2NLV A;  4DUL A;  3CWT A;  2OOX A;  2DKA A;  2D0A A;  4CFF A;  1VOK A;  3I3W A;  5IYC P;  3ENC A;  1UT7 A;  4MRQ A;  1QN7 A;  2QRD A;  1LXT A;  1VTO A;  1K2Y X;  3ASM A;  1QN9 A;  3RPJ A;  3OCI A;  5KL0 A;  3H1Z A;  1N3A A;  1D3U A;  1QN4 A;  1MP9 A;  1VKL A;  3HS9 A;  4DQY C;  2JHN A;  4EAG A;  1JDY A;  1LWV A;  3HS8 A;  4IL8 A;  1UL7 A;  5IYB P;  4QG5 A;  1B9K A;  1PZD A;  1XSZ A;  2QRC A;  4ROD B;  3PMG A;  2YA3 A;  3CWA A;  1KFI A;  1QTS A;  2LAE A;  1LWW A;  5JMV D;  1TBA B;  2XHI A;  2NOB A;  1AIS A;  1C9B B;  2JOI A;  1YQR A;  2DKD A;  1KYF A;  4WZS D;  2I5W A;  4WXA A;  3DPT A;  2NOL A;  5EPC A;  5AN4 A;  1NVP A;  1K35 A;  1TBP A;  1UT4 A;  4Q11 A;  5BMP A;  1FN7 A;  1QN6 A;  2IV8 A;  2V9J A;  1QNB A;  1Q9U A;  3F10 A;  3BKQ X;  1EUV A;  2FUV A;  3RSM A;  2FKF A;  3PDK A;  2Z0F A;  3TE5 A;  1W80 A;  1TUO A;  3OH6 A;  3I0W A;  2RA8 A;  3EAY A;  4D7R A;  3DPU A;  5BMN A;  1N39 A;  1QN5 A;  1QNA A;  2DKC A;  1RM1 A;  1JFI C;  4OQB C;  1M5Q 1;  4OPX C;  3OLP A;  3T4N A;  2G30 A;  3KTU A;  1KYU A;  1QNC A;  1C47 A;  4B0A A;  4ROC B;  1DIZ A;  2ZFD B;  1V5S A;  1PCM X;  2PWW A;  3ULX A;  5F9C A;  4EAK A;  2NWV A;  1PCZ A;  2HZM A;  2QR1 A;  3N89 A;  1KY6 A;  2D0C A;  3OGD A;  3NA5 A;  1TGH A;  2EHB D;  1YQK A;  2YH5 A;  2EOC A;  3I0X A;  4HJH A;  1VOL B;  2HL8 A;  4WX8 A;  4PY5 A;  2OOY A;  3EIK A;  3F0Z A;  1M3Q A;  2D0B A;  2NOH A;  2MJ7 A;  4TPS A;  1WJW A;  4EAI A;  2HZS A;  2O3O A;  4C7P A;  3CW7 A;  1VTL E;  4EJZ A;  2V92 A;  3OH9 A;  4ROE B; 
#chains in the Genus database with same CATH homology
 1YTB A;  1YQL A;  4I8O A;  1YQM A;  3OST A;  1NGM A;  3OSM A;  1KO9 A;  2VJ0 A;  3OC3 C;  1NH2 A;  2IV9 A;  1QTP A;  1YTF A;  5IYD P;  3VN5 A;  2NOI A;  1EBM A;  2NOF A;  1KYD A;  1M3H A;  3SNS A;  1QN8 A;  3IH7 A;  2Z8U A;  1HU0 A;  2NOE A;  4EJY A;  2MZ8 A;  1E42 A;  1N3C A;  2FGT A;  2NOZ A;  1CDW A;  1QNE A;  1R4X A;  1QN3 A;  1LWY A;  1KY7 A;  3KRM A;  4DUL A;  2D0A A;  1VOK A;  5IYC P;  1UT7 A;  1QN7 A;  1VTO A;  3ASM A;  1QN9 A;  3RPJ A;  3OCI A;  1D3U A;  3H1Z A;  1N3A A;  1QN4 A;  1MP9 A;  3HS9 A;  1LWV A;  3HS8 A;  5IYB P;  1B9K A;  1PZD A;  4ROD B;  1QTS A;  2LAE A;  1LWW A;  2XHI A;  1TBA B;  2NOB A;  1AIS A;  1C9B B;  2JOI A;  1YQR A;  1KYF A;  4WZS D;  2I5W A;  3DPT A;  2NOL A;  5AN4 A;  1NVP A;  1TBP A;  1FN7 A;  1UT4 A;  4Q11 A;  1QN6 A;  2IV8 A;  1QNB A;  3F10 A;  1W80 A;  3I0W A;  3DPU A;  1N39 A;  1QNA A;  1QN5 A;  1RM1 A;  1JFI C;  2G30 A;  3KTU A;  1KYU A;  1QNC A;  4B0A A;  4ROC B;  3ULX A;  1PCZ A;  2HZM A;  3N89 A;  1KY6 A;  2D0C A;  1TGH A;  1YQK A;  2YH5 A;  3I0X A;  1VOL B;  4PY5 A;  3F0Z A;  3EIK A;  2NOH A;  1M3Q A;  2D0B A;  2MJ7 A;  4TPS A;  2HZS A;  2O3O A;  1VTL E;  4EJZ A;  4ROE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...