2HZMA

Structure of the mediator head subcomplex med18/20
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
205
Chain Sequence
GKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II mediator complex subunit 20
publication title Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 51
structure length 205
sequence length 209
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08612 Med20 TATA-binding related factor (TRF) of subunit 20 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.140.20 Mainly Beta Single Sheet q64v53_bacfr protein fold q64v53_bacfr protein fold 2hzmA02
3.30.310.180 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2hzmA01
2HZMA 2HZSA
chains in the Genus database with same CATH superfamily
3DPTA 1VKLA 3CWAA 1VTLE 3N89A 1WQAA 3PDKA 3I0WA 1R4XA 1XSZA 4OQAC 3D4VA 3OC3C 2Y8LA 3IH7A 4IL8A 1TBAB 2YA3A 1KYFA 2HL8A 4EJZA 4EAIA 1KFIA 3OSEA 2JOIA 1JDYA 3TE5A 2D0AA 1YQRA 1NVPA 1PCJX 3PMGA 1YTFA 2H5AX 4PY5A 2NOLA 1MP9A 1M3QA 1YQMA 3TDHA 1QN9A 5AN4A 4BJUA 2R5XA 2V9JA 1QNCA 1YTBA 3I3WA 1QTPA 1K35A 1PCMX 2RA8A 1P5DX 1Q9UA 3OSMA 4RODB 4WZSD 3CWSA 2IV8A 2DKCA 4C7PA 3EAYA 2FGTA 3NA5A 2QLVA 3UW2A 1B9KA 1C4GA 1MPGA 2CR9A 4MRQA 3SNSA 5IYCP 1QNEA 1N3AA 1QN3A 1M3HA 5IYDP 1YQKA 1TGHA 3F10A 2NVMA 1JFIC 1KO9A 4I8OA 1HU0A 1QN4A 2D0BA 3CWTA 1KY7A 4B0AA 2I5WA 3H1ZA 2NOEA 1NH2A 2HZSA 1QN6A 2QREA 4HJHA 5IYBP 2OOYA 1C47A 3F0ZA 2FKMX 2OOXA 3T4NA 5JMVD 2QR1A 4WXAA 2JHNA 4EJYA 3C04A 1P5GX 5BMNA 1LWYA 2G30A 3KTUA 1VOKA 2V92A 1NGMA 1PZDA 2NOIA 1QTSA 1DIZA 5KL0A 4WX8A 1UT4A 5F9CA 1N39A 1LWVA 1KFQA 3D7QA 2QRCA 2F7LA 1T6AA 2Z8UA 3BKQX 1N3CA 3CW7A 2DKAA 1EBMA 1QN8A 1KYDA 3OCIA 3OGDA 1LXTA 1UT7A 3ENOC 3KRMA 1AISA 4ROCB 2HKPA 1QNBA 1YQLA 1QN5A 3HS9A 2MZ8A 2V8QA 3OH9A 3RSMA 5BMPA 1J3MA 2QRDA 2JPIA 2NOFA 3OSTA 4D7RA 4EAKA 2FKFA 1LWWA 1TBPA 4D7QA 1VTOA 3DPUA 1M5Q1 3EIKA 1UL7A 2IV9A 2VJ0A 3OLPA 4EAGA 1VOLB 2NOHA 2JHJA 2NWVA 2O3OA 2ZFDB 1RM1A 2HZMA 5JN5A 2YH5A 4OQBC 4QG5A 2MJ7A 3CVTA 1KYUA 1CDWA 4OPXC 3ASMA 2EOCA 2EHBD 2FUVA 2Z0FA 1W80A 4Q11A 4EAJA 2NOZA 5HSHA 2H4LX 1EUVA 1FN7A 2NLVA 1E42A 3ENCA 4EALA 2HL9A 3RPJA 3CVSA 2XHIA 1K2YX 2PWWA 2Y8QA 5EPCA 1PVSA 1TUOA 4TPSA 1V5SA 3OH6A 3I0XA 1D3UA 1WJWA 3CWUA 3ULXA 1QNAA 4ROEB 3VN5A 3HS8A 1QN7A 2NOBA 1C9BB 4CFFA 1PCZA 2LAEA 4DULA 2D0CA 2DKDA 4DQYC 1KY6A
chains in the Genus database with same CATH topology
3DPTA 1VTLE 3N89A 3I0WA 1R4XA 3OC3C 3IH7A 1TBAB 1KYFA 4EJZA 2JOIA 2D0AA 1YQRA 1NVPA 1YTFA 4PY5A 2NOLA 1MP9A 1M3QA 1YQMA 1QN9A 5AN4A 1QNCA 1YTBA 1QTPA 4WZSD 3OSMA 4RODB 2IV8A 2FGTA 1B9KA 5IYCP 3SNSA 1QN3A 1QNEA 1N3AA 1M3HA 5IYDP 1YQKA 1TGHA 3F10A 1JFIC 1KO9A 4I8OA 1HU0A 1QN4A 2D0BA 1KY7A 4B0AA 2I5WA 3H1ZA 2NOEA 1NH2A 2HZSA 1QN6A 5IYBP 3F0ZA 4EJYA 1LWYA 2G30A 3KTUA 1VOKA 1NGMA 1PZDA 2NOIA 1QTSA 1UT4A 1N39A 1LWVA 2Z8UA 1N3CA 1EBMA 1QN8A 1KYDA 3OCIA 1UT7A 3KRMA 1AISA 4ROCB 1QNBA 1YQLA 1QN5A 3HS9A 2MZ8A 2NOFA 3OSTA 1LWWA 1TBPA 1VTOA 3EIKA 3DPUA 2IV9A 2VJ0A 1VOLB 2NOHA 2O3OA 1RM1A 2HZMA 2YH5A 2MJ7A 1KYUA 1CDWA 3ASMA 2NOZA 4Q11A 1W80A 1FN7A 1E42A 3RPJA 2XHIA 4TPSA 3I0XA 1D3UA 3ULXA 1QNAA 4ROEB 3VN5A 3HS8A 1QN7A 2NOBA 1C9BB 1PCZA 2LAEA 4DULA 2D0CA 1KY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZM A;  2HZS A; 
#chains in the Genus database with same CATH topology
 3DPT A;  1VKL A;  3CWA A;  1VTL E;  3N89 A;  1WQA A;  3PDK A;  3I0W A;  1R4X A;  1XSZ A;  4OQA C;  3D4V A;  3OC3 C;  2Y8L A;  3IH7 A;  4IL8 A;  1TBA B;  2YA3 A;  1KYF A;  2HL8 A;  4EJZ A;  4EAI A;  1KFI A;  3OSE A;  2JOI A;  1JDY A;  3TE5 A;  2D0A A;  1YQR A;  1NVP A;  1PCJ X;  3PMG A;  1YTF A;  2H5A X;  4PY5 A;  2NOL A;  1MP9 A;  1M3Q A;  1YQM A;  3TDH A;  1QN9 A;  5AN4 A;  4BJU A;  2R5X A;  2V9J A;  1QNC A;  1YTB A;  3I3W A;  1QTP A;  1K35 A;  1PCM X;  2RA8 A;  1P5D X;  1Q9U A;  3OSM A;  4ROD B;  4WZS D;  3CWS A;  2IV8 A;  2DKC A;  4C7P A;  3EAY A;  2FGT A;  3NA5 A;  2QLV A;  3UW2 A;  1B9K A;  1C4G A;  1MPG A;  2CR9 A;  4MRQ A;  3SNS A;  5IYC P;  1QNE A;  1N3A A;  1QN3 A;  1M3H A;  5IYD P;  1YQK A;  1TGH A;  3F10 A;  2NVM A;  1JFI C;  1KO9 A;  4I8O A;  1HU0 A;  1QN4 A;  2D0B A;  3CWT A;  1KY7 A;  4B0A A;  2I5W A;  3H1Z A;  2NOE A;  1NH2 A;  2HZS A;  1QN6 A;  2QRE A;  4HJH A;  5IYB P;  2OOY A;  1C47 A;  3F0Z A;  2FKM X;  2OOX A;  3T4N A;  5JMV D;  2QR1 A;  4WXA A;  2JHN A;  4EJY A;  3C04 A;  1P5G X;  5BMN A;  1LWY A;  2G30 A;  3KTU A;  1VOK A;  2V92 A;  1NGM A;  1PZD A;  2NOI A;  1QTS A;  1DIZ A;  5KL0 A;  4WX8 A;  1UT4 A;  5F9C A;  1N39 A;  1LWV A;  1KFQ A;  3D7Q A;  2QRC A;  2F7L A;  1T6A A;  2Z8U A;  3BKQ X;  1N3C A;  3CW7 A;  2DKA A;  1EBM A;  1QN8 A;  1KYD A;  3OCI A;  3OGD A;  1LXT A;  1UT7 A;  3ENO C;  3KRM A;  1AIS A;  4ROC B;  2HKP A;  1QNB A;  1YQL A;  1QN5 A;  3HS9 A;  2MZ8 A;  2V8Q A;  3OH9 A;  3RSM A;  5BMP A;  1J3M A;  2QRD A;  2JPI A;  2NOF A;  3OST A;  4D7R A;  4EAK A;  2FKF A;  1LWW A;  1TBP A;  4D7Q A;  1VTO A;  3DPU A;  1M5Q 1;  3EIK A;  1UL7 A;  2IV9 A;  2VJ0 A;  3OLP A;  4EAG A;  1VOL B;  2NOH A;  2JHJ A;  2NWV A;  2O3O A;  2ZFD B;  1RM1 A;  2HZM A;  5JN5 A;  2YH5 A;  4OQB C;  4QG5 A;  2MJ7 A;  3CVT A;  1KYU A;  1CDW A;  4OPX C;  3ASM A;  2EOC A;  2EHB D;  2FUV A;  2Z0F A;  1W80 A;  4Q11 A;  4EAJ A;  2NOZ A;  5HSH A;  2H4L X;  1EUV A;  1FN7 A;  2NLV A;  1E42 A;  3ENC A;  4EAL A;  2HL9 A;  3RPJ A;  3CVS A;  2XHI A;  1K2Y X;  2PWW A;  2Y8Q A;  5EPC A;  1PVS A;  1TUO A;  4TPS A;  1V5S A;  3OH6 A;  3I0X A;  1D3U A;  1WJW A;  3CWU A;  3ULX A;  1QNA A;  4ROE B;  3VN5 A;  3HS8 A;  1QN7 A;  2NOB A;  1C9B B;  4CFF A;  1PCZ A;  2LAE A;  4DUL A;  2D0C A;  2DKD A;  4DQY C;  1KY6 A; 
#chains in the Genus database with same CATH homology
 3DPT A;  1VTL E;  3N89 A;  3I0W A;  1R4X A;  3OC3 C;  3IH7 A;  1TBA B;  1KYF A;  4EJZ A;  2JOI A;  2D0A A;  1YQR A;  1NVP A;  1YTF A;  4PY5 A;  2NOL A;  1MP9 A;  1M3Q A;  1YQM A;  1QN9 A;  5AN4 A;  1QNC A;  1YTB A;  1QTP A;  4WZS D;  3OSM A;  4ROD B;  2IV8 A;  2FGT A;  1B9K A;  5IYC P;  3SNS A;  1QN3 A;  1QNE A;  1N3A A;  1M3H A;  5IYD P;  1YQK A;  1TGH A;  3F10 A;  1JFI C;  1KO9 A;  4I8O A;  1HU0 A;  1QN4 A;  2D0B A;  1KY7 A;  4B0A A;  2I5W A;  3H1Z A;  2NOE A;  1NH2 A;  2HZS A;  1QN6 A;  5IYB P;  3F0Z A;  4EJY A;  1LWY A;  2G30 A;  3KTU A;  1VOK A;  1NGM A;  1PZD A;  2NOI A;  1QTS A;  1UT4 A;  1N39 A;  1LWV A;  2Z8U A;  1N3C A;  1EBM A;  1QN8 A;  1KYD A;  3OCI A;  1UT7 A;  3KRM A;  1AIS A;  4ROC B;  1QNB A;  1YQL A;  1QN5 A;  3HS9 A;  2MZ8 A;  2NOF A;  3OST A;  1LWW A;  1TBP A;  1VTO A;  3EIK A;  3DPU A;  2IV9 A;  2VJ0 A;  1VOL B;  2NOH A;  2O3O A;  1RM1 A;  2HZM A;  2YH5 A;  2MJ7 A;  1KYU A;  1CDW A;  3ASM A;  2NOZ A;  4Q11 A;  1W80 A;  1FN7 A;  1E42 A;  3RPJ A;  2XHI A;  4TPS A;  3I0X A;  1D3U A;  3ULX A;  1QNA A;  4ROE B;  3VN5 A;  3HS8 A;  1QN7 A;  2NOB A;  1C9B B;  1PCZ A;  2LAE A;  4DUL A;  2D0C A;  1KY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...