2HZMA

Structure of the mediator head subcomplex med18/20
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
205
Chain Sequence
GKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II mediator complex subunit 20
publication title Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 205
sequence length 209
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08612 Med20 TATA-binding related factor (TRF) of subunit 20 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.140.20 Mainly Beta Single Sheet q64v53_bacfr protein fold q64v53_bacfr protein fold 2hzmA02
3.30.310.180 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2hzmA01
2HZMA 2HZSA
chains in the Genus database with same CATH superfamily
1M5Q1 3EIKA 1YTFA 1J3MA 1R4XA 1WQAA 3I3WA 4CFFA 1YQRA 3IH7A 1QN9A 1QNEA 2NOFA 3I0WA 2G30A 4WX8A 1E42A 1TUOA 1VOLB 1HU0A 3CVTA 2NOLA 2HL9A 4EAJA 4EJYA 1B9KA 1KYDA 1C4GA 2EHBD 2JPIA 3OCIA 3TDHA 3OH6A 1C9BB 2V8QA 1LXTA 3CW7A 2F7LA 2JOIA 2NWVA 3BKQX 1KFQA 2QLVA 3F0ZA 2LAEA 2Z8UA 3DPTA 1N39A 2D0AA 2NLVA 1CDWA 1QNAA 2I5WA 2NVMA 4B0AA 2H5AX 3EAYA 3KRMA 5KL0A 3OSTA 4BJUA 2R5XA 4D7QA 1M3QA 2HKPA 2YH5A 2OOXA 3UW2A 3N89A 3DPUA 4TPSA 1P5GX 4I8OA 1N3AA 2NOBA 4OPXC 4MRQA 1TGHA 3ENOC 2YA3A 2D0BA 1K35A 2NOEA 2QREA 1QTSA 1QN3A 3HS8A 2VJ0A 3RSMA 2FUVA 2JHNA 3D4VA 2EOCA 1K2YX 1QN5A 1VTOA 2NOHA 1QN6A 3HS9A 3CWAA 5JN5A 1QTPA 1AISA 1KYFA 1KYUA 1XSZA 2V9JA 2XHIA 2HZSA 2FKMX 1M3HA 1PCZA 3RPJA 4D7RA 2Y8QA 3ULXA 3KTUA 1QNBA 2PWWA 3CWTA 1YQKA 2IV9A 4C7PA 2MZ8A 5F9CA 3TE5A 1T6AA 4EAIA 3SNSA 1KY7A 3OGDA 2V92A 4WXAA 1QN8A 5IYDP 5AN4A 1VKLA 2MJ7A 3CWUA 2NOZA 4WZSD 2JHJA 1LWYA 2DKDA 1KY6A 2QRDA 1V5SA 1YTBA 1LWVA 1NH2A 3I0XA 1PCMX 1PZDA 3H1ZA 3CWSA 2QR1A 4ROEB 1MP9A 5JMVD 1PCJX 3C04A 1DIZA 1TBAB 1QN4A 1UT7A 2RA8A 1JFIC 2QRCA 2ZFDB 1WJWA 2FKFA 2IV8A 3ASMA 1MPGA 2Z0FA 4HJHA 1N3CA 4DULA 3F10A 4OQBC 1VTLE 1PVSA 2D0CA 2DKCA 1NGMA 4DQYC 1EBMA 5IYCP 3D7QA 1QNCA 3OSMA 2NOIA 1TBPA 1FN7A 1QN7A 4QG5A 1LWWA 1VOKA 3VN5A 4RODB 1EUVA 4EAKA 1W80A 5BMPA 3ENCA 4EJZA 2Y8LA 1NVPA 2H4LX 4Q11A 1YQLA 4IL8A 1P5DX 2FGTA 5IYBP 4EALA 2OOYA 3CVSA 1UT4A 1KO9A 1KFIA 4PY5A 3PMGA 3OH9A 1RM1A 5HSHA 1D3UA 1YQMA 2HZMA 2DKAA 1UL7A 2HL8A 4EAGA 3PDKA 3T4NA 2O3OA 5EPCA 4ROCB 3OLPA 1C47A 3OSEA 3NA5A 2CR9A 1JDYA 1Q9UA 4OQAC 3OC3C 5BMNA
chains in the Genus database with same CATH topology
3EIKA 1YTFA 1R4XA 1QNEA 1YQRA 3IH7A 1QN9A 2NOFA 3I0WA 2G30A 1VOLB 1E42A 2NOLA 1HU0A 4EJYA 1B9KA 1KYDA 3OCIA 1C9BB 2JOIA 3F0ZA 2LAEA 2Z8UA 3DPTA 1N39A 2D0AA 1CDWA 1QNAA 2I5WA 4B0AA 3KRMA 3OSTA 1M3QA 2YH5A 3N89A 3DPUA 4TPSA 4I8OA 2NOBA 1N3AA 1TGHA 2D0BA 2NOEA 1QTSA 1QN3A 3HS8A 2VJ0A 1QN5A 1VTOA 2NOHA 1QN6A 3HS9A 1QTPA 1AISA 1KYFA 1KYUA 2XHIA 2HZSA 1M3HA 1PCZA 3RPJA 3KTUA 3ULXA 1QNBA 1YQKA 2IV9A 2MZ8A 3SNSA 1KY7A 1QN8A 5IYDP 5AN4A 2MJ7A 2NOZA 4WZSD 1LWYA 1KY6A 1YTBA 1LWVA 1NH2A 3I0XA 1PZDA 3H1ZA 4ROEB 1MP9A 1TBAB 1QN4A 1UT7A 1JFIC 2IV8A 3ASMA 1N3CA 4DULA 3F10A 1VTLE 2D0CA 1NGMA 1EBMA 5IYCP 1QNCA 3OSMA 2NOIA 1TBPA 1FN7A 1QN7A 1LWWA 1VOKA 3VN5A 4RODB 1W80A 4EJZA 1NVPA 4Q11A 1YQLA 5IYBP 2FGTA 1UT4A 1KO9A 4PY5A 1RM1A 1D3UA 2HZMA 2O3OA 4ROCB 1YQMA 3OC3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZM A;  2HZS A; 
#chains in the Genus database with same CATH topology
 1M5Q 1;  3EIK A;  1YTF A;  1J3M A;  1R4X A;  1WQA A;  3I3W A;  4CFF A;  1YQR A;  3IH7 A;  1QN9 A;  1QNE A;  2NOF A;  3I0W A;  2G30 A;  4WX8 A;  1E42 A;  1TUO A;  1VOL B;  1HU0 A;  3CVT A;  2NOL A;  2HL9 A;  4EAJ A;  4EJY A;  1B9K A;  1KYD A;  1C4G A;  2EHB D;  2JPI A;  3OCI A;  3TDH A;  3OH6 A;  1C9B B;  2V8Q A;  1LXT A;  3CW7 A;  2F7L A;  2JOI A;  2NWV A;  3BKQ X;  1KFQ A;  2QLV A;  3F0Z A;  2LAE A;  2Z8U A;  3DPT A;  1N39 A;  2D0A A;  2NLV A;  1CDW A;  1QNA A;  2I5W A;  2NVM A;  4B0A A;  2H5A X;  3EAY A;  3KRM A;  5KL0 A;  3OST A;  4BJU A;  2R5X A;  4D7Q A;  1M3Q A;  2HKP A;  2YH5 A;  2OOX A;  3UW2 A;  3N89 A;  3DPU A;  4TPS A;  1P5G X;  4I8O A;  1N3A A;  2NOB A;  4OPX C;  4MRQ A;  1TGH A;  3ENO C;  2YA3 A;  2D0B A;  1K35 A;  2NOE A;  2QRE A;  1QTS A;  1QN3 A;  3HS8 A;  2VJ0 A;  3RSM A;  2FUV A;  2JHN A;  3D4V A;  2EOC A;  1K2Y X;  1QN5 A;  1VTO A;  2NOH A;  1QN6 A;  3HS9 A;  3CWA A;  5JN5 A;  1QTP A;  1AIS A;  1KYF A;  1KYU A;  1XSZ A;  2V9J A;  2XHI A;  2HZS A;  2FKM X;  1M3H A;  1PCZ A;  3RPJ A;  4D7R A;  2Y8Q A;  3ULX A;  3KTU A;  1QNB A;  2PWW A;  3CWT A;  1YQK A;  2IV9 A;  4C7P A;  2MZ8 A;  5F9C A;  3TE5 A;  1T6A A;  4EAI A;  3SNS A;  1KY7 A;  3OGD A;  2V92 A;  4WXA A;  1QN8 A;  5IYD P;  5AN4 A;  1VKL A;  2MJ7 A;  3CWU A;  2NOZ A;  4WZS D;  2JHJ A;  1LWY A;  2DKD A;  1KY6 A;  2QRD A;  1V5S A;  1YTB A;  1LWV A;  1NH2 A;  3I0X A;  1PCM X;  1PZD A;  3H1Z A;  3CWS A;  2QR1 A;  4ROE B;  1MP9 A;  5JMV D;  1PCJ X;  3C04 A;  1DIZ A;  1TBA B;  1QN4 A;  1UT7 A;  2RA8 A;  1JFI C;  2QRC A;  2ZFD B;  1WJW A;  2FKF A;  2IV8 A;  3ASM A;  1MPG A;  2Z0F A;  4HJH A;  1N3C A;  4DUL A;  3F10 A;  4OQB C;  1VTL E;  1PVS A;  2D0C A;  2DKC A;  1NGM A;  4DQY C;  1EBM A;  5IYC P;  3D7Q A;  1QNC A;  3OSM A;  2NOI A;  1TBP A;  1FN7 A;  1QN7 A;  4QG5 A;  1LWW A;  1VOK A;  3VN5 A;  4ROD B;  1EUV A;  4EAK A;  1W80 A;  5BMP A;  3ENC A;  4EJZ A;  2Y8L A;  1NVP A;  2H4L X;  4Q11 A;  1YQL A;  4IL8 A;  1P5D X;  2FGT A;  5IYB P;  4EAL A;  2OOY A;  3CVS A;  1UT4 A;  1KO9 A;  1KFI A;  4PY5 A;  3PMG A;  3OH9 A;  1RM1 A;  5HSH A;  1D3U A;  1YQM A;  2HZM A;  2DKA A;  1UL7 A;  2HL8 A;  4EAG A;  3PDK A;  3T4N A;  2O3O A;  5EPC A;  4ROC B;  3OLP A;  1C47 A;  3OSE A;  3NA5 A;  2CR9 A;  1JDY A;  1Q9U A;  4OQA C;  3OC3 C;  5BMN A; 
#chains in the Genus database with same CATH homology
 3EIK A;  1YTF A;  1R4X A;  1QNE A;  1YQR A;  3IH7 A;  1QN9 A;  2NOF A;  3I0W A;  2G30 A;  1VOL B;  1E42 A;  2NOL A;  1HU0 A;  4EJY A;  1B9K A;  1KYD A;  3OCI A;  1C9B B;  2JOI A;  3F0Z A;  2LAE A;  2Z8U A;  3DPT A;  1N39 A;  2D0A A;  1CDW A;  1QNA A;  2I5W A;  4B0A A;  3KRM A;  3OST A;  1M3Q A;  2YH5 A;  3N89 A;  3DPU A;  4TPS A;  4I8O A;  2NOB A;  1N3A A;  1TGH A;  2D0B A;  2NOE A;  1QTS A;  1QN3 A;  3HS8 A;  2VJ0 A;  1QN5 A;  1VTO A;  2NOH A;  1QN6 A;  3HS9 A;  1QTP A;  1AIS A;  1KYF A;  1KYU A;  2XHI A;  2HZS A;  1M3H A;  1PCZ A;  3RPJ A;  3KTU A;  3ULX A;  1QNB A;  1YQK A;  2IV9 A;  2MZ8 A;  3SNS A;  1KY7 A;  1QN8 A;  5IYD P;  5AN4 A;  2MJ7 A;  2NOZ A;  4WZS D;  1LWY A;  1KY6 A;  1YTB A;  1LWV A;  1NH2 A;  3I0X A;  1PZD A;  3H1Z A;  4ROE B;  1MP9 A;  1TBA B;  1QN4 A;  1UT7 A;  1JFI C;  2IV8 A;  3ASM A;  1N3C A;  4DUL A;  3F10 A;  1VTL E;  2D0C A;  1NGM A;  1EBM A;  5IYC P;  1QNC A;  3OSM A;  2NOI A;  1TBP A;  1FN7 A;  1QN7 A;  1LWW A;  1VOK A;  3VN5 A;  4ROD B;  1W80 A;  4EJZ A;  1NVP A;  4Q11 A;  1YQL A;  5IYB P;  2FGT A;  1UT4 A;  1KO9 A;  4PY5 A;  1RM1 A;  1D3U A;  2HZM A;  2O3O A;  4ROC B;  1YQM A;  3OC3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...