3HS9A

Intersectin 1-peptide-ap2 beta ear complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 complex subunit beta-1
publication title Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 52
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hs9A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3hs9A02
1B9KA 3ASMA 3HS8A 4B0AA 1YTBA 1PZDA 3HS9A 2MJ7A 1TBAB 2VJ0A 3EIKA 1D3UA 1QNBA 1YTFA 1VTOA 5IYCP 1QN7A 1QN9A 4PY5A 5IYBP 1AISA 1RM1A 2IV9A 3H1ZA 1NH2A 4RODB 1NVPA 4WZSD 1QNEA 2D0BA 1PCZA 5IYDP 1TGHA 1QNCA 1W80A 1JFIC 2G30A 1E42A 3OCIA 1MP9A 1KYDA 2D0AA 4ROEB 1QN4A 1KY7A 1CDWA 1QN6A 1QNAA 1QN3A 3OC3C 1QTSA 2D0CA 1KYUA 4ROCB 1C9BB 1TBPA 1KYFA 1QN8A 1NGMA 2IV8A 1KY6A 1R4XA 1VTLE 3VN5A 1VOKA 1QN5A 1VOLB 1QTPA 2Z8UA
chains in the Genus database with same CATH superfamily
3SY6A 1AQKL 1FFPA 4KH2A 1ZHNA 3F0ZA 4QRPA 3VWKC 4DOHB 4WHYG 2AK4B 3ARQA 1FCCA 1IQDA 4P2AA 3F8UB 4K3DL 4H1LB 4JQVA 4BK5C 1E9PA 3HS0A 1ZSDB 5AAMA 2JI3A 1NC2D 2Y9RT 3O45B 5HDRA 1KYAA 2OSLB 5B39B 5C0DB 3FTZA 4NNYB 2IBZX 4H0HB 3AMLA 4O2EA 2XVBA 2QSTA 3GBML 2L0DA 3ENCA 2Q2EB 5ICYA 1JV5B 2AV1A 3S88H 3CC5A 2HT3C 1E9OA 3V5KB 3TLRA 4G71B 2G2RA 2HVKB 5INCB 3FFCA 3UROR 5I8CA 4XOAA 3RKDD 5LXVA 4FTVE 3W39B 3FT3B 4UI2A 2OZ4L 4OF6A 1L9NA 3AREB 2XZAL 4Y2OB 3OGDA 4PJCA 1AZNA 3NH7H 1FFOB 2ED7A 3MRFA 5DI8B 3C5JB 3FB5B 3B5TA 1NMBH 4UOQA 4ELDA 2OL3H 2B1OA 1YUKB 1A65A 2WBKA 3GGWA 1F1GA 1XGRB 3GSNA 1QUNB 1WBXA 2R56L 4YL4A 1TXKA 4A7QA 1L9OA 1T66D 6CGTA 4Y5XA 3KPLA 1G5AA 4KKCC 1UB5A 3T77A 2ATPA 1KB5H 2FL5B 2X4TA 1XMEB 4D94A 1XR9B 1IEHA 3IKCA 4JDZA 6FABH 3M7OA 1K8DA 1WS7A 1QNBA 4ORGB 5ITFB 1AOHA 2BRRL 5D1QA 2EUZA 1A9EB 5J1AB 3N43B 3X14A 3FZUC 2YIHA 3MOBL 4LSQL 3GMMB 3IMBA 1ANUA 5C0RL 3FRPG 4K73A 3O3AB 4HULB 4BZ1H 1DQML 4X8JB 3IJ9A 2XTJB 4EO5A 4R7NB 3CH1B 5DD6A 3B7UX 2J21A 4XZUA 2B9AA 4IDJH 4KI5D 4YSPA 4FFZH 3LZRA 5I5IA 4GRMB 4U1MB 3HG2A 2XBZA 2IBZY 1Z9SA 2F08A 1Q9KB 1GGIH 5T5FH 1VEPA 4M6OH 4G5ZH 2XWEA 5F96H 2WKLA 3BAIA 1SYSA 4J3OC 4HWNA 3MA9H 3LHPL 5LQBL 3MJ7B 1G9NL 4AMWA 1SY6H 3FUDA 1UVQA 2GJ6D 2NYYD 3GSOB 3VD1A 2V7HA 3QRGL 1LGVA 4NS0A 3RWIA 1DR9A 1YDPB 4EJZA 4D9RD 2XG5B 4ABWA 2DF3A 4O02B 3ZW3A 5IWLA 2J4WH 1XIWB 1F1AA 3F7QA 3CFCL 4OLZH 1L5GB 4ELKB 1JK8B 5IYCP 1LO0L 2BSTA 5J7CC 1CFNA 1OARH 3T3PB 1KXHA 1CDGA 2UY6A 1BZOA 1TT6A 1YEGH 4I4WB 2R8SL 2WXPA 3BZFA 4EDWH 3TNNB 2NNCA 1EDQA 2GSGA 1MELA 3OXSB 2HJFB 2FKFA 4PCTA 1KGCE 2QELA 3WO4C 4M7LT 3LEVL 3RUGE 2VLKD 4XNZC 4QKXB 4L4VD 1IM3D 1IFGA 1HS6A 2QADC 2XV0A 4NZDA 1XEUA 4D0BB 1CFTB 4NO2A 1KIQA 4DEPB 5L2KE 4GQPH 3P3UA 3WLWD 1W0WA 1AIZA 1GOGA 1JHTB 4OFPA 3ZUCA 1MCPH 1M2OA 2ADIB 1JWUB 2V8LA 1K4DA 4RZKA 5BZWB 5KANG 4LSPL 5IJKC 4CSTA 2BSBA 1PZAA 1DHKA 4OAWA 4U7SA 4XGZB 3AXLA 4Y5YC 1WICA 4K71B 5EZLA 3EF4A 4N0YH 3SE9H 5LJYH 5CJQH 3TDHA 2DQTL 2PCFB 5ECGA 3V10A 1GGCL 1OTUD 2GHZA 3IGFA 2G4GA 5EDSA 1QFHA 3E9UA 5DK3A 3ATEA 4HZ1A 4UIKH 3MXWL 4FEIA 5E7FA 1SDAB 3IE4A 5F1KC 3T2NH 3WUWG 4TOYH 2FQGA 3OAUH 2NY0D 1HQ4A 3UJIH 4XPBH 1MHHB 3HLAA 4M5TA 3QJOA 3CLWA 5F9DC 4MD5A 2E4FA 1LO5B 2BDNH 2BCKA 5AL0A 3Q2CA 4KX7A 4AQEB 4IMKA 2AJVH 4POUB 2BHZA 3EKCA 4QRUB 4CVZB 4LQ1A 4FXTA 3OQRA 3GNMH 4HFUH 4KO9A 1KCRH 3MFFA 3D3VA 1E42A 5HI5D 4M93B 1DO5A 1JN6B 3C5SA 2E4TA 3OLGA 3WKPA 1J8KA 4R84A 4E9YA 5DYFA 4OD3L 2JJSC 4WFGD 1JNLH 3QHTC 3EYSL 1U30A 3JZYA 5FO8B 3UPRA 4A7TA 1B0GB 1KJ2B 4OI7A 2CKNA 5HGGS 3FSOA 3LEYH 4LLVA 3HG1A 5ALBH 4FXGC 3UTTD 4GP5B 3WHXB 4NQED 4UF7C 3HUJF 4PRHD 4WI0B 2ITFA 2CJUL 2GJ6B 3VQMA 2YA3A 2HT2D 3I02A 3N85H 4X6CB 1S9YA 3LKRA 2G75B 3EGXA 4N22A 4F7PB 3CG8A 3U9UA 2XV2A 5E6UB 4JJHA 4HUMB 3CVHH 4KGLA 1QHOA 1AD0B 5KJ7E 2R2HB 4MB1A 4BFKA 3DSNA 1XB3A 2KQNA 5HDBB 3KLHC 2B1HL 1U8IB 3B9EA 3WIFB 2VXVL 4MVBC 3FCSB 1NINA 3GMRA 1JPEA 4AL8H 4WY7H 3ZTNL 1HH6A 2BVOB 3L4YA 1MFCH 3L7FB 3EOAA 3FUNA 2OA9A 4BZ2A 3ZUNC 1CXHA 4PW9A 2QVKA 4YE4H 1BD2D 2ZZUT 1UEMA 1E5CA 1RU9L 1B0IA 5D7IE 3BWZA 4V11A 1TSRA 2DY2A 2WUCL 4AX3A 3P9WB 2R2EB 2ADGA 1YEFL 2RGSA 1MW0A 1TZAA 3MLWL 2CLZB 2JCWA 3MRRA 4OFDA 3DECA 5LG1A 4KO7A 4PYGA 3L3IB 1DLHA 3STLA 5KSUB 5FCSH 2FH8A 3QO0B 4XXCA 3HN8A 2V2WB 1SVBA 3D8MA 1SHMA 5CLTA 5JLZB 4P2OA 3AQYA 2ZUQC 1MPAH 4KJQD 4I5BA 4PJ8C 3QYCA 5T3XE 1PLCA 1H0DA 3T4YA 1QA9B 4QGTA 1CC3A 5SV4A 5CBAA 2VDOB 1UZGA 2BVUA 3KXFB 1RUPH 1IM9D 1CE6A 1TZGH 3ARSA 4PJ5E 5E00B 5SX5H 4HG4J 1MH5B 2AMUA 3PFQA 3ELAT 1QATA 3EFFA 4KU1A 1XF3B 4YPGB 3IDNB 4Z7UF 3A67H 3FMGH 4UNVA 1GKOA 1NDTA 3GXFA 3HIZA 4RGMC 3UAJD 5I1HL 3TESA 1BOYA 3X3FH 5DZNA 2MNWA 3F6JA 5KYWB 3PV7A 3KYMB 5ISZB 1N5YL 1IGJB 1M7DA 5BPPA 1J3MA 3FT1A 1NMCC 3VXPB 3AJ7A 1SHXA 3WS3B 1HHGA 5DJAB 1XB6A 2O6PA 1AHWA 4WI3A 4OIBA 2W38A 4MBRA 1MWAA 2FEEL 2H6OA 3GSRA 3ULVD 3IGAA 1AACA 5DRXA 4ZTPL 3X17A 3VACA 3I85A 3IAQA 5DVMA 4BQCA 1UM5H 5FYKE 1BQ5A 3RVWD 5JW5B 1XV8A 4AZ8A 4WHCA 4UQBA 5C0JA 4LCCB 2D0GA 1H8LA 4ZMPA 5D7LE 1U95A 3U4BL 3TBYA 3PGDB 3W11C 5HHME 5BV7L 3I3BA 2IMNA 2AKRA 4NHUA 5IJDC 1PY0A 4KVNL 1JV2B 5B1CA 1QN8A 1MFNA 3OKMA 1VACA 4Z7QB 5BS0D 4GIPD 3I3EA 2NY1B 1ZK9A 2IG2H 3A0OA 3NP4A 4IRZL 5CWSB 3MOAL 3GM8A 1RP8A 1U2CA 2Y7LA 1FLRL 4F15C 2FX8L 4XCCH 2DJSA 4G70B 2WZPD 1AO7D 2D0HA 2MPAL 1SOQA 3F01A 4DP4X 3K6OA 1DCEA 1F0LA 2R0KL 2XWXA 4JGMA 5H37A 2E7HA 2GC7C 4XXWC 3QORB 1NM9A 4CNIB 3L17A 4JFSA 1RAMA 5DHEA 1HXMB 4UYPA 3WKQA 2ZOUA 1WWWX 1Q1PA 2WXIA 1KT2A 4GAAA 3B9VA 3G5VA 3L3OC 4WNJA 1MDAA 4NNXA 5EU5A 3HC4H 4WFHE 5D7JB 1FPTL 4JL1A 2R4SH 2ZWSA 4LLDB 3QQ4A 1RIUL 3PHQA 4J4PC 4EXPX 3TYGH 1B9ZA 4B95C 3VXMA 2IOIA 5LN4A 1HINL 5K59E 1MCDA 1UWEL 4E9RA 3ZHDA 4EIBA 4U1NB 1UOKA 2WQXA 1W72B 3RL1B 2IH9A 3CN1A 1OLLA 3K4DA 4PRAA 4IEFA 5FV1L 3EYOA 1OWWA 4O4YH 2FUVA 1LNUB 2JK5B 2QPUA 1H3GA 4W4NA 5K9OB 5F9OH 5F7LB 1O6VA 1VOKA 4UV4L 3UYRL 1GJIA 2H0FA 2HZMA 4R2GD 5LGKA 4B0AA 4MMYA 4YVNA 7FABH 4Q56A 1DBBL 1RUKL 3DXAD 4WTWA 5T3XL 4GUCA 2Z31C 4A63A 3CAFA 4FQLL 4WI9A 2X89A 2Z35B 3UZEA 1UXSB 5MENA 5SWSA 3TO4D 4NNPH 1I3GH 1OLZA 5F9AC 5DZ9A 1VGEH 1XCWA 4I2XE 1J9RA 2BNQA 4ABUA 3DVGB 1N3CA 4RMWA 2AABH 5IOPA 4K23H 1M05A 1UUNA 4N9GB 5AB2A 2ADFH 4WUUE 3VCLA 3TF4A 1DIZA 1T2XA 3QB7C 3X1GA 2WCPA 2VDPB 5IF0B 3RDTB 1P4BH 3S4SA 2PNDA 4QUOA 2EE2A 1R1CA 4KI5F 4RFEA 2FJFB 2OQJB 3U4AA 4N6RB 2VLME 1H5BA 3MGOA 2PLTA 3VRLF 5A2IH 3W1ZA 3UW2A 1EEZB 2HFEA 2WIMA 3NA9H 4JRYA 2A4ZA 2Z8SA 1SN0A 3FOMA 4E41E 1CGWA 2XN9E 4QHNA 3TBVB 1JXFA 3LMJH 3WE1A 3MLYL 5IT2L 1S7TB 1XH0A 2K45A 4F91B 4X80H 1PD0A 1W0VA 2DI9A 1IT9H 4Y2DA 2JHJA 2J1ZA 4H8PA 3U4KA 5CCHE 4DGYH 2JWYA 4QYOA 5K33A 5FYKL 3FB8A 4E9VA 4Z8FH 4KK9C 1N6QL 1A7OL 2VUKA 2AV7B 15C8L 1NKRA 1ZJAA 5HGHB 5I8OH 2QQQA 1AS6A 2EZ0C 4FLSA 4W6YB 5TDPB 4UV7H 1N4XL 1PZUB 3MBED 2CDEA 4PJ9D 4JO1H 1BEYL 4XPGL 3D1MC 4OT1H 4LFHD 1FYTB 3JWNE 3BJ91 1C12A 2PYEA 3MZTA 1XF5A 5DMIL 3D87B 1YSOA 4ZS7L 5KAQG 1QTSA 2YPKB 1T0MB 3QIWD 4X99B 3VFNB 1HT6A 5IVZA 1OPOA 1Z3GH 4R5TA 4AUYA 2A2QT 1CICA 2YMXH 4AOFA 1MKFA 3VE0A 2W88A 1IC7L 5HP5A 2NOHA 1EX0A 1ILSA 3H9HB 4PH8A 1QX1A 1U3ZA 4JFQB 4NDMA 4MJ2A 5FYJL 2VSCA 4P2QB 3SDYL 4B3VA 4GMSH 4CN6A 2C1OB 4LCIH 4KZEL 2YLKA 4NGHH 1JAEA 4HU8A 3DURA 5CKAA 1EEUA 4AKQA 4JHBA 1EGJA 3IAGC 1MEXL 4GIOA 4EDXA 2IPKB 4PRPA 5FUCC 4XNQB 5BW7C 2DQJL 4YS4A 5DEFB 2ROYA 5AKRA 5IMOA 4JCMA 4UWQB 3D9AH 4GG8B 3WY1A 4OV6F 4KX9A 2C3GA 4XP1H 5AUMB 4Q6IC 3HVDA 4TTGA 1DEEA 4O51B 4GSUA 2NT0A 4K7FB 5DTFB 2R1WB 1QRNB 1ACCA 2A4EA 3QUXC 2ATAA 4D0DB 1JZ2A 3DX4A 3EADA 4GJTB 4MA3B 3QEQD 3MN8A 2I26N 1AGFB 12E8H 1YQ2A 5GGRB 5JPMA 1F2QA 5F3BA 5H2BA 2D3VA 4F58L 3IPFA 5TDNB 5ITBL 4ZMOA 1YN6B 1YEJL 3TO4B 1ZS8A 2B77A 3BKML 1HEJC 1OTTC 5I8EA 4Q11A 2FUTA 2CBPA 3QG6B 3MBXL 4PJHB 1H19A 2CU9A 1KG0B 2WAQA 5A6LA 3HEIB 3GHPA 4YDVA 3KYOA 3Q3GB 3S5LB 5E1HB 5KJRH 4XP6L 1C7TA 3UBXI 4MHHG 5J56B 3MRLA 4UZGA 5ERWB 1PCMX 4APQC 3NIFF 3NCMA 3TV8A 1FSKC 4QHMA 3FJTA 3RWEA 2VLJA 3EO1A 3OHXC 2AJXL 3SDXA 4HJ0C 5ILTL 5GGTL 4YR6B 4MB5A 2MQCA 1LWWA 4Z7QF 1NIDA 1I7UB 3RNKA 3A6OA 1F86A 1HU8A 2B2XH 4HCGA 3KH4A 4OSUH 1INEH 3O4LE 3V4UH 2E7DA 5CD3B 5E24E 3I50L 4N0CD 3FO1A 1ET5A 1JPSL 2AK4A 1RIHL 1KTRL 3ROOB 4GKOA 4YSTA 5I1LB 3HPLB 4WW2F 5LWYL 1ZSDA 2EINB 3O45A 3Q01A 3LRHA 4KK8C 2OSLA 5B39A 5C0DA 2D0FA 4Z3HA 4NNYA 3WO4B 1UT4A 2N7SA 3GRWH 1IBYA 3BWUC 4XNZB 1FG2B 3KWXA 5DZAA 2MSPA 2QADB 3BVWA 3O6FC 4S2SB 4TQIA 3D06A 3PQYE 3VYPA 1JV5A 2D7PA 2Y23A 2C8NA 4XMLH 2YQ3A 4JDVB 4V1DD 3V5KA 1M7IB 3BZDA 2UX7A 2OP4L 5INCA 5DSCB 4NRYB 3W39A 3FT3A 3SQOH 3FQNB 2BY2A 3VFWB 4C47A 3AREA 3JWNG 4Y2OA 3TE5A 4OCRL 1IKNA 1WUZA 1FFOA 2W9EL 5DI8A 3C5JA 3FB5A 1J0KA 2W94A 2IBGA 5HYJD 1XGRA 2DM4A 1QUNA 1BG1A 2ZG3A 4XPFL 3CDCA 4ELMB 1CZ8H 4RMUA 4P5MB 3S98A 1Z9PA 2FWUA 3VN5A 1I8LA 2FL5A 2V9RA 2WK2A 4PG2C 1XR9A 4ZW7A 2DZEA 2JNZA 4CKVX 2LAAA 2A73B 3AMKA 5G2NA 1EZVX 1ZVSA 4ORGA 1OVZA 4W70A 3AACA 1OP5H 3T8MA 1A9EA 1AXTL 3GDBA 5J1AA 5C0BE 4AXWB 4DPCX 1NCWL 4YSAA 3IJ8A 4ZMQA 3B43A 4Y9FA 3O3AA 1U8OB 3TWCL 4HH8A 1WQVT 4X8JA 4IKIA 4Z7AA 3OMNB 2EH7L 3TZVC 3WXWH 4JO5A 5F3HB 3APCA 4R7NA 4R7XA 3CH1A 3P0VL 4PIBA 5C3TA 5HHOE 4TPRL 1XD0A 1ZIBA 4GRMA 4U1MA 4GSDL 1EJOL 3KR3H 1F97A 4FQCL 4I0PC 2VDQL 4HOMA 1YEHH 5ANHA 4LLYB 2NCEA 3D51A 3N0PB 4OCYH 5TE4L 4M6MH 1F02I 2VZ3A 2ZP8A 3ULVF 3BKCH 4AEEA 5JA9A 2PMZA 1ND0B 3PXLA 1CCZA 3ETBF 3MJ7A 4HIJB 4FXGB 2G3NA 2EVIA 1U3NA 1S2EA 4ODBD 2XACC 1TSHA 2EXWC 3GSOA 1LLAA 2DQIH 3F2LA 2IQ9H 1DUYA 5EPMB 4Z77B 1DQLH 4XWOD 2VL4A 4XB3A 2X3BA 3S96B 5EF3A 5D93B 1Z9MA 2XG5A 3CQPA 1KELL 5FHAH 4O02A 4LVNB 3I6KB 5I18L 2VABB 3S4SG 1XIWA 1LO4H 1L5GA 2LTQC 1X44A 2EEXA 2F5AL 4ELKA 1JK8A 4P5TC 2CHWA 2EIEA 2WPGA 1P84K 3EJYD 3KBHE 4YBLC 2BFVH 4F3FB 2FNWA 3QJTB 3OAZK 5JZ7D 4I4WA 2D3JA 1PLGL 2MEJB 1EZVY 3TNNA 2HTKD 4P46D 3OXSA 3GMNB 1RULH 4Z7VE 2XPYA 3U9PL 4L1BA 2M8XA 3ZLQC 4OLWL 1T7WA 1IBBA 1BGXL 5AEAA 4Z3FA 5TDOA 4LLAA 4LOUC 4D0BA 1C5DA 2XZCH 1CFTA 5AOZA 4HXAL 4ALAL 1KMGA 1HCZA 4O58L 1EZSA 2V6HA 3DBXB 1SBSH 4TSAH 3VW3H 4GLRI 2AQ1A 5EUKB 1JHTA 5I1DB 2J3SA 4Y2NA 2ADIA 1NM4A 3BKJL 1JWUA 4IGBC 4LDOB 3NFPB 3SZKC 5BZWA 4FG0A 2R59A 1PL3A 4I88A 4IMLB 5JQHC 5D1ZC 4XGZA 2JFCA 2NR6C 4R90H 4KXBA 1IAII 4ONGH 2PR4H 1CFMA 1MSPA 3NP3A 4ONFL 1F00I 1YEEL 2ZUQB 1RFDL 1AJ7H 4PJ8B 1A6VH 3QEHB 3QJHB 1SXZA 1LWJA 2ZKHL 5IREA 3BSZA 1ICTA 3UGEA 4BSVA 2EDQA 2VZVA 1WTLA 3FH7A 4KAQL 5KBMA 3QHZH 2AXGB 3RGBA 1HQRB 1MHHA 2VZOA 4Z95H 2YD6A 1LO5A 3OLIA 3PDOB 4AQEA 1UJTA 3T2LA 2ED8A 4JG1L 2HFGL 4N1HB 2KPNA 3UTPD 4M7KL 4QRUA 2H2SC 2DKCA 1NSNL 2BP8B 1OP9A 1CFVL 4KH9A 3MLPA 1IJNA 2YPVH 4RGMB 4M8VA 4QCIB 3L4XA 5DLML 1H3UA 1F3JB 1JN6A 4G11A 3GSWB 1OV8A 2WLIA 5AWNH 4TVPL 3VVVA 4YDKH 4H8HA 3MRKB 4XHJD 3WSQH 4NQDB 3P30H 1LYQA 4PD4J 2YGPA 1FFTB 4HCRA 3QUMH 1D5IL 1OCZB 1U3HD 4QGYA 1NMCB 4PBVC 3QHFH 5FO8A 3JBG7 2ZUUA 4XBGB 4EE2A 2EYRB 2X9XA 3NQKA 1KJ2A 2WLMA 2VMDA 4GBXD 1X4ZA 3VGAB 2C1PB 4G7QB 4BRVA 3MAWA 4H25B 3LKQA 2H41A 4UMSA 3T9WA 2BFGA 2PWGA 4JQIA 1ZVHA 5ECJE 2AZUA 4DZBB 3WHXA 2XWRA 5IBLC 4OFYD 5GXBB 4DEUA 4JKPL 2GJ6A 2YD1A 5IQNA 3TA3C 2YPLB 3NCYS 4QHPA 4X6CA 5DF0A 5IVNA 2J1KA 3BD5A 2G75A 1QFUH 2VJ8A 4F7PA 2QLYA 3MRGB 3BUTA 2DS4A 4KTDL 2FJUB 3MA7B 4H2CA 2TRYA 2YRZA 4YWGL 4LHQB 1D2PA 4F15B 4NJ9L 2NY2D 3ILPB 4W9FC 1OCRB 1AD0A 4FNTA 2R2HA 4QOKB 5CEZD 1U8IA 3DGDA 3WIFA 4UM8B 3FCSA 3MNMA 4U6HA 4EAGA 5KYXB 1J8HD 1XEDA 2GB2A 2F0CA 3DLQR 3O2VH 4AYDC 2BVOA 5BMNA 1PX8A 5HD8C 4HXBL 3L7FA 3AWGA 4LAQH 5DHVH 5J9PB 4MNQE 4G9FD 4IRJD 3WAJA 3KYKL 3QAZC 1IL1B 3L3OB 2I5YH 3RBGA 2MOVA 3CMOH 3E0GA 2VLKA 1HAWA 4ZNEE 4HQQH 1T22B 2WY3B 1LK3H 2R2EA 2Q10A 2O1AA 5BZZA 1I3UA 1VFMA 2DIBA 3DO4A 1HE8A 2CLZA 2FH6A 3HA0A 4OCLC 5DZJA 2KUTA 1CWVA 1JE6A 2HFFB 3LH8A 4DPBX 5IESH 3L3IA 3KWVA 5KSUA 3QO0A 4GAGH 4H1LG 2P49B 2PP8A 1K5NB 2V2WA 2CPUA 2ZD0A 3QZBA 5C0IB 3ATFA 4ELMF 5JLZA 1LQSR 1ZKAA 4LBAA 1T89A 4XP9L 3ZDYB 5EN3A 2X9YA 5B39G 1SLVA 1QA9A 5AVVB 2E46A 4W9HC 4AJ0A 3KXFA 5CR1A 5E00A 1YMMD 1MH5A 1DL7H 1DLFH 3QCUL 2R4RH 4UQ2B 2EEAA 4QNPF 4PB0H 1N0XL 3H0TB 1XF3A 4YUEL 2KS0A 2B3RA 2G60H 3IDNA 4YPGA 4W93A 5JQIB 3ZTDC 4EKJA 2XNAB 3FU8A 4AVKA 2EUVA 2IIJA 1HNGA 2WLNA 4N2NA 1XH1A 3ULUD 2GC4C 1KLGB 2Y3AA 3KYMA 4HC1A 4GKZB 1F6FB 5ISZA 4PRID 5HI4C 1DVXA 2X7LA 3DX7B 3P3SA 4FXLA 1IGJA 5KBDA 2ZAGA 1P2CB 2V2XB 3K2IA 5GRJL 3WTYA 1N3AA 3QWNA 1F4HA 1Z9OA 1YEIH 3LNGA 4JFED 1YPZB 3QO1B 3VXPA 1OAKL 3WS3A 5CGMA 2ETWA 3H54A 5DJAA 1WGVA 2Y6TE 4HK3N 4BSWB 1QSVA 1NGQL 5I9QC 3D25A 1NLDH 3MUUA 1QKZH 4G6AC 5FUOH 2NVMA 1CDJA 1RY7B 1NH2A 1Y7VA 4QPEA 5DURD 1NVPA 5JW5A 1NAML 1HHKB 4OKDA 5JIHA 5TFSH 3T65B 1ASOA 3HKFA 2H2PD 4LCCA 5KSBE 1R5VB 1DQQB 4Z7OB 1P5DX 2YUXA 4GIAA 1DJYA 2D3LA 3PGDA 5G55A 1R3IL 3DX1A 4ZD3H 2XV6B 3IVKB 3IJHB 2C3WA 1JV2A 2VRQA 5DMYA 2V8QA 4H44C 4YQXH 4XN1A 3HC3L 4MJ6B 1T6WA 3O8XD 4ODWB 5CWSA 5BO1H 4PJBF 3APFA 3P4NB 4Z5RB 3IPEA 3IE9A 4FI6A 3KPRD 4UDUB 2AQQA 3A22A 5CJ8A 2Y6SD 3QPQD 2IO5A 4XC1H 5I8KH 1NCBH 1A6UH 2NY2B 2FWSA 1JUFB 2F8IA 1R5IB 1IV8A 3PWNB 4NKMB 2AXWA 1DANT 4Y16C 3WHE1 4BQBA 5KJ4A 4CNIA 3V0EA 1CLYH 4A7SA 4MCMA 1HXMA 1R3JB 3BPLC 3S3JA 5E94B 2VSKB 3VFTB 1E0OB 3B3BA 4KGJA 3MCKB 1M6OB 4HK3J 5E2TL 4IRJB 4B7IA 1FBIL 5D7JA 4NZFA 4LLDA 5TPWH 1WZAA 2EIKB 4R4FH 4BXVA 1I9IL 1ZLUK 5AW2B 4YHYC 2AJ3B 1AKJB 4HKJB 3VDCA 1VFOA 2ZCHH 4U1NA 1FNFA 2H5AX 3NSCA 2I7SA 4WWPA 3CIAA 1W72A 3RL1A 2ZOWA 2E8ZA 1JGVH 4E68A 4LL4A 3UO8B 2HVJB 4WI8A 1LNUA 2JK5A 4ISVB 2F8VA 4M48L 5K9OA 2HWZL 3QI9C 4Q6IB 4HUWB 5E56A 2NUTB 5IROC 3QFJE 2FQFA 2HTLD 3T3ME 5FYJU 4F5CE 5EBMA 4K8RH 1OOWA 4I77L 2YK1H 4RGNC 4DH2A 2H3XC 5TE7L 2FEDC 4JFFE 2OTPA 3CPLB 1M3QA 2Z35A 1AIFB 1UXSA 1AZBA 2GHWB 3B2UC 1BVKA 5KVDE 2R5XA 4ZMXA 3KGTA 2RCSL 4P07A 1NOAA 1WE5A 4N9GA 2PW2B 2QQLL 3II2A 2IBBA 2WKGA 2C9UA 3HB3D 4G1MB 1CURA 3NCEB 3RDTA 5IF0A 5HDLA 1A9VA 1I9JL 3MXVH 1JCKA 3QH3B 2FJFA 2HCZX 2OQJA 4KTEL 4PRIB 3SKUD 5K93A 1M5Q1 1JBJA 3T0VA 3B6SB 5DZOA 2NLJB 1SNRA 3X11A 4OF7A 3SPIA 1OB0A 1O75A 4NXKA 1ZAGA 4JPWH 4PJ6A 3TBVA 2JKRM 4K5NA 4APQB 4PGZA 2CNZA 1FSKB 4QY8B 1S7TA 5IMMB 3WNKA 5IYDP 5DURB 4L8BB 1BHGA 3OHXB 2VW7A 3JVGC 4R97B 4UANA 5CGYC 2DDQL 4OV5B 3BZ5A 3DX8B 4D9LH 4AGNA 2G2PA 4MMXB 2FT7A 1YCSA 3GLDA 1XSKA 2AV7A 5DWPA 5HGHA 1NCDL 3QNFA 1XH3B 4WI7A 1OTUC 3VM5A 5TDPA 2EDOA 4LSUH 7CGTA 1J10A 3NSDA 5GGRY 1WBZA 1KBGL 3QYNA 3KPRB 2EEFA 5TE6L 4LCVA 1YYMH 1CFSB 1UACL 4JZJC 4MHHI 5KOVC 1FYTA 4BK5A 2O5YL 2W9LA 3V7MA 3QR2A 4IRSC 5E8EB 3P73A 1RUQH 1T1YB 2YPKA 5HI5C 1T0MA 4X99A 3VFNA 1VKXB 1ZY9A 1LO2H 2Z0UA 4I87A 4J8QA 4B9PA 1EXGA 4QI3A 4X42A 3O6FB 3GXTA 4KZ0A 1JXJA 4H13C 1MIML 1JI2A 5JHLL 4HJSA 4JEGB 3H9HA 4MMZC 3V0WL 3T0XA 3MC0A 1RIVH 4JFQA 1AXIB 3CSPA 1BVLA 3T2QA 3U82B 4P2QA 2OOYA 3T1FB 2BZCA 2B1AH 2C1OA 4XMVA 3QE5A 4C55A 1EPFA 4M1CC 2IPKA 4XNQA 3ZE0F 5IVOA 2JKNA 2FUQA 5DUPH 4BQ8A 5DEFA 1AR2A 1BQHB 3SEPA 4TULL 4DGWC 2UVEA 3S34L 5TQ2H 2L7JA 2K7QA 2K6YA 4BSJA 4Z7IA 5AUMA 4JVUA 4K8RC 3ULXA 2IFFH 4BK8A 4O51A 4Y4KC 4K7FA 2XI9A 3BUPA 5DTFA 4OIFA 2R1WA 4QJ4B 1QRNA 5DD5H 4D0DA 1WFUA 4MA3A 2KBGA 5ALCL 4UT6H 1OE1A 1AGFA 1YHPA 4XBEL 3MLZH 1TYEB 5GGRA 1EBAA 2ZX6A 4DCQB 1F6LL 3LNHA 1U36A 3MUY1 4YH6A 2FKMX 1OK8A 3F7PC 3PHOB 5TDNA 5F1NB 3VSVA 3FQ1A 1YN6A 4RISH 2YQ2A 3TO4A 4JFPB 3UTSB 4XX1G 5M94B 1N2RA 2BOBB 2K7PA 5FLUA 3QG6A 3UADA 2QSCL 1RK0B 4PJHA 2GUOB 2P8MA 4ANVA 1KG0A 3LQAH 3HI5L 4FQ1L 4KZDL 1E6JL 3ECQA 4FJ6A 4PJAE 4JX0A 5KVDL 4K7PH 5DQDH 4YSEA 3MACH 1F4WH 4KKRA 3Q3GA 4LCWE 3S35L 4WFFE 3S5LA 3MV8B 3BLKA 1BSIA 3BVDB 2AEQH 1E43A 2YRBA 3MLUL 4J6RL 4KRLB 4NO5A 5E99L 1R24B 5ERWA 3C09C 3CHPA 1UEYA 1QLRB 4XI5C 4CU6A 1ETA1 4FNRA 5KZCD 2R0LL 3NZHH 4Z7OF 2ZT9C 1S78C 5CLXA 3VXUB 2ITCB 4UB0L 4YR6A 1P7BA 4LBEB 1D7FA 4K3JH 4F33B 3DOSB 1I7UA 2WTPA 2XQBL 1U91B 3BE1L 3NACH 2Z4TA 4D8PB 4K3EL 5EOQH 4DFHA 1VTLE 4QAMB 1JGDB 4E9TA 1N68A 4BFJA 2ENSA 1FAIH 5CD3A 3KPSB 1TMCB 2LTQB 3WDHA 4KNSA 3D39B 2CKBH 4YBLB 5CZXC 2X6CA 3ROOA 2W9DL 3DTDA 2VDNH 4N90D 5I1LA 3HPLA 4PIRF 4BUQA 1EZUA 5EEXA 2A9CA 5JIQA 2VO8A 1LEIB 5C0CB 2D7TH 1I53A 3F7VB 3LRLA 3UAJC 1FG2A 2B59A 3F85A 4S2SA 3A24A 3OKOB 2YOCA 3PP3H 2ZYSA 3NJKA 2QVMA 4JDVA 3O2DA 3V4PH 1M7IA 2C3XA 4PVLA 2ITDB 2WKOA 5DSCA 4NRYA 2JJTC 2J6EL 3FQNA 4HT1H 3VFWA 3ESNA 4IGBB 1OAZL 3WNIA 1RMFL 3BGFC 3BFWA 1HSAB 5C0GB 5IJKA 1Z5HA 2WCSA 1P4IH 2N01B 1HEZB 3LB6C 4Z7NB 1AANA 3FUKA 5D1ZB 4PWJA 4DGIH 1TLMA 1ZDSA 1GC1L 2F8OA 3OKEB 2V7NB 4ELMA 3RSMA 1AHMA 2H32H 4P5MA 2APTA 2NZIA 1F13A 4MJ4A 4A39A 1NBZB 3IFLH 3SGEI 2J56A 4HWBH 1JRHH 2A73A 3DKHA 3NG5A 2LFGA 2CRMA 3RFZB 3SBPA 3VFVB 4BZ1A 2GSIA 2A6DB 2VM9A 3QEQA 1VENA 1F4YH 5ES4B 3GFUA 1U8OA 1BQLL 1G6RL 3ZKQD 1FHNA 1TMQA 5KVGE 3LQAC 4K15A 4YVUA 4FFZA 5DVNA 3VYOA 3ULUF 1ML0A 5F3HA 1TTBA 4ERSL 4ORZC 5KW9H 4NKIH 2VW6A 1TFHA 2WINB 1THCA 2JJSA 2Y24A 5F7EL 3DI3B 4ES9A 4LLYA 5AB0A 1VZHA 4F24A 3ASOB 4GO8A 5CP3H 4F93B 2IAND 2QPSA 4QWWC 4MDJA 2GY7B 3W9EB 5AG9A 1ND0A 4HIJA 3UPCA 4CVWA 4FXGA 1FJ1B 4L4TD 5JOPD 1YAZA 1JNNH 3ZYZA 3VD9A 7TAAA 1D5ZB 1JHLL 1WZLA 1L9MA 5B1JC 1IZJA 1WPCA 1MZYA 1DANU 5EPMA 3ZHKA 4F1SA 3ZMEA 4Z77A 1RUMH 1RJYB 5I1GL 3H3PL 3S96A 1YC7A 5D70L 2BIOA 4YHOH 4WNQB 3I6KA 2VABA 4PJ7E 1BV8A 3N91A 1LXMA 2IGTA 3HE6D 1Q1JL 5DMKB 4G6JL 2HSIA 4R2GC 3TCTA 1S3KH 3ARXA 1Q9OA 4F3FA 3WYRA 2EO9A 2F53D 3CLEL 1RZQA 2CBMA 3FC8A 3CZGA 3EYUL 2MNJB 1NCJA 3KE0A 2AJUH 2P5PA 3QAZB 1KCLA 4R4ND 4EZMA 2K3TA 5E95B 4JFTA 3DBXA 5EUKA 4PJEE 1RJLB 1RZGB 4BKTC 3DMMD 3G6DH 2VR4A 4YHZL 5I1DA 3N3EA 4U6VL 1A7RL 1BZ7B 3NFPA 1F45A 2WBWB 2OCFD 2Q6WB 1JZ3A 2R1XB 3CW7A 1SDDB 3G5ZB 4IMLA 4DN3H 1BAFL 3QCVL 2XIIA 1UWYA 3B7SA 4FQXD 2IFGA 5BUPA 3LH2H 4KKLC 1YNKH 3VFOB 3OSTA 4B9CA 4NO0B 2YUWA 2EDDA 4PJ8A 3RGVD 4HPYH 3QEHA 3QJHA 2EUWA 3KJ4B 5MP6L 1S7WB 3KPMB 4HJJH 4HMEA 4Q6YA 4XAKD 4MRQA 4F7KA 1GTFA 1HQRA 5FOBA 4LCUB 3K6NA 4QLRA 2CIKB 3HG4A 2XLLA 3JYCA 1KEML 3SQBB 3PDOA 3MZGB 3SGJC 4Q74A 2QRDA 2AJYL 3BWSA 5B1BB 4A7VA 2CUHA 5I1EH 4JNXA 3EDEA 1X7SA 1AY1L 2YBRB 1J5CA 2APBA 2BP8A 1XF2B 4FL4C 1IIKA 4BFIB 2H26B 1T0PB 2ROXA 2FWOB 3ALXA 4QCIA 1F3JA 3GSWA 4QXTB 2VR7A 3FQ4A 2VC2B 2O4EA 4NQDA 5EU3B 1MJUH 2WJ7A 1A6TB 1OT1A 3EYFB 2BCMA 4QXVA 2VDLL 2PO6D 3BUBA 3QUKB 1Q9WB 2P5WD 1MRFL 5I9QB 4YEEA 4XBGA 1ZVNA 2EYRA 4HUVB 4RSVA 2LVEA 5BVPH 3GBEA 3SPCA 3RY6A 4CSPA 4H25A 4LL9A 1E8XA 4WWKC 4IS6A 1F41A 4GSXA 4EUPG 1EFXB 4DZBA 4AQOA 5K9JH 2Y8QA 4ZUUA 3I9AA 2PUQT 4EAJA 5F88B 2B4CC 3D08A 1P4LB 2YPLA 1P5VA 4HPOL 4JK0D 2L3BA 3IU4H 5I19H 1A6PA 3V6BR 2NDFA 3MRGA 2HPOA 2YEZA 1Q0XH 2WLYA 4L4JA 3QZWB 3MA7A 4OR1A 1X5YA 4EI5D 1YQKA 1WFOA 3DX0A 4FLRA 5DMGD 4NKDB 3ILPA 1HTYA 3A4EA 5SX5K 1KWGA 4QOKA 4TUUA 3HE6B 1OANA 4UM8A 1KPUB 4BFRA 1SMAA 1X5FA 3S5LG 1MCSA 5KYXA 1JNHA 4X4MA 4Y8AA 4X8GA 4OJAA 4QTHA 4XOCA 4RGOH 5IB3A 4L0PB 2X4QB 4NM4L 4J3OG 5GJSL 2LLGA 4MQXD 4DEWA 1R0AL 3BPLB 3RWCB 1LJMA 1PCXA 5J9PA 4AL8C 2LGNA 3UCQA 4J3UA 4MJJA 3ECVA 1KTLB 1IL1A 3L3OA 3T6XA 3QPXH 5CHNB 4ZPTB 4R96B 1QFWH 1T22A 3QDMD 3N44F 5C9JB 4FABL 4YFLF 4XVSH 4ZW3A 2FLBT 5FYJD 4OJEH 4KROD 3U0WL 5L6YH 1A8JH 4WQOA 3QZNA 5DGRA 3SPHA 3ZT7A 1BEXA 4DQOH 5AENA 2MFNA 1BZQK 2D4FA 3CX5J 3X1NA 3MV9B 3GXUB 2HFFA 4ADJA 1I9RL 3KLQA 4Z7NF 3VQLA 3SOTA 1YY8B 4C58B 4J1UA 3CCHA 3N1PC 2JKIS 3C5ZC 3I0WA 4N8CL 1K5NA 1NEZB 2I85A 4NQQA 4LNVA 1XGQB 2F54D 4XN4A 5C0IA 5CCKL 1YUHB 5CEXB 1YG9A 1U6AH 4IOSA 2ZNXA 2Q8AL 2NY4C 3QI9B 2YR3A 1KOAA 2J8OA 5G5DB 4YX2H 4XCEB 4PB9L 2EECA 2QMJA 3H9YA 3WNMA 4DP0X 1TZOA 1R46A 3EIKA 2WYTA 1YQVL 2D2CC 1D7BA 4UQ2A 1UUSA 1B4TA 3MRJB 3T4NA 4RGNB 4B60A 4HHWA 1GS7A 3H0TA 1SYVB 1WZ1H 3OKYA 4TQEL 1OP3H 5D1XD 2XNAA 4KDTC 2X4RB 1HL8A 1C5BL 3VTMA 4LPTA 5E9DD 1KLGA 1O7SA 4ENEC 3EZ8A 4GKZA 3DX7A 4WCYL 1P2CA 2V2XA 3EO9H 2NQ3A 2CMRL 3PXHA 3QO1A 5C09E 3RY4A 1EH9A 4MJID 1U3HA 3Q1SL 3F12B 1RJZB 2I60H 3Q0HA 3WJJC 4GXUN 4BSWA 3EJCA 3RWGB 1KXQA 2CPCA 1BM3H 1PPIA 2PO6B 4HZAA 1NFKA 4WI2A 3BDXA 3D4VA 1MI5D 2VXUH 4G6KH 3T6ZA 4G1EB 1HHKA 3MUHL 3VDAA 4Q7DA 2GITA 3T65A 4XP5L 1KTCA 1DQQA 1R5VA 4GO6B 4QMEA 4ODVH 1PG7H 4M6OL 4KXAA 4E9LA 3IJHA 3FTXA 4DULA 5HJ3A 4P2RE 4YXLL 2VMCA 1JHKL 4MJ6A 4NQCB 3OZ9H 4ODWA 1MDTA 2Z8UA 3P4NA 4Z5RA 2NOBA 5FGRA 4EI5B 1SY6L 3K80A 2Y07L 1E65A 2JIXD 3LN4B 4GNKB 4J3VA 3FH8A 1GS6X 2VQTA 4KQ0A 3PWNA 4NKMA 3DPDA 2EDXA 2BSEA 4WWNA 3O6LL 3BXNB 3D7PA 1PNCA 4K94L 3GSNL 4YJZL 5HPMB 1R3JA 5MHSD 4MX7B 3W57A 1V27A 4IRSB 2HUHA 2HMID 3SOBH 2YN3A 1PLBA 3OMAB 2J88L 4O5LH 4S0HA 3ZN6A 5IKCB 1C7SA 1M6OA 1S8DB 2VLRB 3MCKA 4G9FA 4IRJA 4AGLA 1FZKB 4GXFA 2R51A 4MMZB 4TTDD 3W0WB 5EZOH 3FSAA 4Y4FC 2VN3A 2AJ3A 3I6GB 3K3QA 1OF2A 1AKJA 2NUPB 4HKJA 3UTOA 2FGWH 1LILA 1O9VA 3IGUA 2R2CA 3OXRB 3STBA 5F9CA 3HC0B 3KGRA 4HMDA 5DO8A 5HSFA 5EA0H 4IHBA 5BW7A 5D2LB 5M95B 1ZPUA 2B9BA 2HVJA 5DC0A 4YHLL 1FRGL 2ICES 1X9QA 2X41A 4ISVA 4MWFB 3SE8H 1T7YA 2F54B 3N5AA 1SXAA 3POCA 2Z8WC 2E6JA 1X5XA 5D7HA 3ASNB 2W65B 4HUWA 2NUTA 4GQ9L 4Y4KB 4Z18A 2ZWLT 4JPQA 5EOCH 3VXNB 1ZTMA 5JORB 1W0YT 1SEQH 3ZDYE 2WXJA 4UM9B 1QQDB 3W38A 1NCTA 1VFAA 2IDSA 2O26U 4ZFQA 5DZPA 3O9WC 3G04B 3C08L 2XV3A 4TOYL 3TBWB 2MZ8A 3FTUA 4LB8A 5EU6E 1XAKA 2E9IA 2PW2A 3L9RB 4UQAA 4G7YH 3VVWA 4G1MA 3NJIA 5C07E 3TWYA 3J07A 3LNFA 1BDYA 4FNSA 4PRIA 1E8ZA 3QH3A 4LPCA 2HZHA 4JO4H 5DUML 2D0AA 1KSRA 3B6SA 4P4KC 4MJIB 2NLJA 4WXAA 5GISL 1S7UB 3WD5L 1E4HA 2ZKXA 3B4NA 3A6BH 1Y18B 3B3IB 5C0AD 3C09B 3IJSB 4XNDA 4MCNA 4C4KT 5HJDA 4QY8A 2DEWX 5IMMA 3S8FB 4L8BA 3OHXA 1FNSL 3CDZB 4MS8D 4OV5A 3AB0C 3DX8A 2H3KA 2TSBA 4XO5A 1A3RL 1W2KT 3ARGD 4OTXL 1VEOA 5DEJA 1ESOA 1TQBC 1WZMA 3BN9C 4MMXA 2FAUA 4FQ2H 4PLKC 4ZSOB 3KH3A 2KDYA 1K72A 2VDRB 3UAFA 2B39A 4JFWA 2BSSB 1XH3A 2DL2A 3L48A 4FC3E 5AFAA 5JO5B 4HS8H 1X5GA 2CQVA 3O8XA 3ULAB 4GG6E 3ML9A 3IDUA 3RI5F 4DVRL 1XL6A 2WVTA 2PXYD 3KPRA 2XX1A 1OM9A 4QXUH 2ICWB 1CFSA 1X5MA 1NCOA 2DEYX 2ZX5A 1SQ2N 4X6EB 1B4RA 4FYTA 3H9SE 3QDGE 3GMQB 3NCXA 1BAWA 1U8KB 5T1DL 3GK8L 4HHGA 1T1YA 3RE0A 5KTEH 1VKXA 2ZCZA 3GHEH 2EDLA 3BN3B 3LS5L 2ERJC 4HW6A 2A5UA 1KCUH 2AQSA 3O6FA 1A3ZA 2EILB 5DU7A 5GJTL 1QN3A 3C6LD 1EHAA 1HKLL 4LARL 4WI6A 2GABA 3M1OA 4JPSA 1A1OA 3NJFA 3NTCH 4JHAL 4KJPD 4NQSB 5GRUL 4D7QA 3T1FA 3DK2A 5EC2B 1Z1WA 1E8YA 1NANH 4IBTA 4U31A 1Z5YD 3FU5A 3RVXD 2YO3A 1E7VA 1QPKA 3UEZA 4PJFF 4M7LH 1J8RA 1OY3B 1VSCA 1ZT1B 3SGKC 2OR8A 1EA9C 4KHXL 1BQHA 1XXFC 2VN5A 1U8CB 2BS71 4JFDE 4HA1A 5SX4H 1TJIL 4Y8DC 4PG2A 4L3ED 1IC1A 5FUCE 5JXED 3VGHA 1IGIH 2Y0SA 5JHMA 1PU0A 3DROB 2OBGA 1YY9D 1OM3L 4DK5A 4UTBH 3B2PA 3TVMC 1FZMB 2NZ9C 4DCQA 1JPTL 2IF7A 4HD5A 5E51A 1AQKH 2P1YA 3PHOA 5F1NA 5J13C 3JXAA 4E9WA 4JFPA 4XT1C 3QJFB 2BOBA 3VB9A 5EZIL 5B4MC 3R1GL 3RX9A 3QQDB 2GW5A 4K3DH 1RK0A 2GUOA 4M1GL 1MCFA 3DJRA 5JW4N 4RSYA 4R8WL 1N18A 4PRNB 3BI9X 3MV8A 2PPAA 1G4MA 3NIGE 2NPLX 4PVMA 1R24A 5C08D 2PN5A 2O61B 1CVRA 4RMRA 2WSDA 1QLRA 5IGXL 3GBMH 1OL0A 4U6TA 3C75A 4JO3L 4JGNA 4FKHA 2VH5L 2ITCA 1TQCC 4L3AA 1DJWA 4LBEA 2OZ4H 4BZ2L 4F33A 3V0VB 3DOSA 4Y4HD 1CD1B 2XZAH 1U91A 2N59A 3ARYA 3EXLA 3ARGB 2CKBB 1JGDA 4Y1AE 3N40P 4U1HB 2W5PA 3KPSA 2R56H 3L9EA 4JRFA 1LP9B 4EZKA 4BZYA 3D39A 5IQ9B 2VR3A 3NVQA 1D6EB 2WP3O 1RZIA 3WDJA 4N6QA 2D7MA 5BRPA 3NSXA 4AG4L 5IB2A 4N2AA 2HL9A 1TQWA 4P04A 4KITB 1MCOL 2DMGA 1EUTA 2NXYD 4RAUA 3L4ZA 3X13B 4TF4A 3QXAB 4AW7A 5C0CA 4F2EA 2BRRH 1LEIA 3EBGA 1HYSC 3QEUB 3V4PB 3F7VA 4PS4L 3MOBH 4LSQH 4TQ8A 4ZOAA 4ODXB 5C0RH 3OKOA 3TT3L 1DQMH 2P43B 2WBJB 4PJGB 5CMAB 2WQWA 4MSWB 2W0KA 3C6LB 2ITDA 4TYUA 2Y4SA 3FCGA 4IGBA 5LVEA 2EKSB 4FI7A 1N5AB 4C7PA 1HSAA 4LEEA 4UNIA 5C0GA 2ZYRA 2ZPKL 3AM8A 3EDKA 3IJYA 4N8UA 1G1YA 1HEZA 2LVCA 5D1ZA 4MZRA 1QSFD 2H32B 2NR6A 4L3CB 2TAAA 1UGNA 1RH8A 2DWTA 2R0ZL 3WEBA 3OKEA 2V7NA 2H2PC 4FFVC 4A7GF 1A4JB 1J9TA 1T20A 3LHPH 3C60D 5LQBH 1G9NH 5C6WH 5EU4B 1DSFL 1NBZA 2X88A 4XNXL 4HIXL 1DVFC 3QRGH 1ILUA 4DUVA 4PG9A 3RFZA 1G9EA 3CN4A 3VFVA 3CXHJ 3HI1B 2A6DA 1U42A 2CH8A 3WOVA 4CVXB 3K5SA 2Y6SC 4FL4B 2ZCLL 4QRRD 2WXKA 1UXMA 3HBGA 5GS2H 4HIQA 4I48B 3CFCH 4TUKL 4NQTA 2EXYD 1LO0H 4RMBA 1C5CL 3KBEA 1N3NA 5E6ID 4MRCA 4ZUSB 3VD4A 1T80A 2R8SH 5GS1C 1TVHB 3UTSE 4F8TA 3BYTA 1YNTB 1EANA 1A1MB 4I9WD 4Q9BA 4YLCA 4KKAC 3E8UL 1HIML 1F3RB 1UCBL 2LT9A 4NUPA 2J43A 1EMTL 3W9EA 1M3JA 4CC4C 3LEVH 4ZUVB 4B9GA 5A7EA 1XX9C 1FJ1A 2Q20A 1TGHA 2MKWA 3V6OC 4WI4A 3A4FA 2L7UA 3GLAA 1D5ZA 3SCMD 5JTWA 4GAYB 4FD0A 1ODAA 5D8JL 1RJYA 4Z7WB 4LSPH 4P23C 3TONA 5EBWA 3V9FA 4WNQA 3VXUE 5AVTB 1K2YX 2DQTH 3BD3A 5DMKA 5JIPA 1GGCH 1G9ML 1KCVL 1NGYA 5FGSA 4D7RA 3MXWH 1NGXB 2ESVD 5FECB 2DLHA 3AUWB 4PRBB 3UOAB 4P4RB 1VCBC 3FQUB 3LZNA 3NCCB 4ZO6A 4JPIB 3AQDA 3OKNB 5I75C 4G7SB 4HEMA 4TUJB 3HB3C 1ZGLB 3EYQC 2RFXB 3P4OB 4HMCA 4PREB 1RJLA 1RZGA 3WFCL 3QJZA 1CD9B 1CU4L 4OVVA 1BZ7A 1DN2A 1TZIB 1R9FA 1C8PA 3N40F 2IWFA 5AW7B 2R1XA 3BP6B 1IEAB 1SDDA 1TVBB 4OD3H 3G5ZA 4EAEA 3EYSH 4DO5A 1F1DA 3C6EA 3C5ZB 4YDMA 5L7XL 3BGMB 3QUYC 4FRWA 5GIRB 2PCYA 1QSFB 1NFDF 4HJTA 3VFOA 4KO6A 4NO0A 5CFHA 3RIAK 2NY4B 3LQMA 4LSDA 5GZOC 1J18A 1S7WA 3KPMA 1ZXQA 4I3GA 2Q7YB 2DMHA 5GS0L 4OZGF 5EUOF 5CN3A 4M1DH 3AWFA 3N6YA 3QUGA 2NCMA 4LCUA 4U1LB 3QULB 2CIKA 4YSOA 5C0ND 2CJUH 2K4AA 3SQBA 3T0BA 4X6BB 4RAHA 5C7ZA 3HUJE 4AV0A 2NTFB 4L9LC 2YBRA 1XF2A 1BVOA 4LHUB 2H26A 3LJ3A 2FWOA 2GTWB 4NWTL 4QXTA 3RI5K 4GEIA 1FNLA 2CUIA 5EU3A 2VXVH 1A6TA 2H4EA 1EO5A 2DMKA 3EYFA 4F7EA 3FCTB 3ZTNH 4C8XA 3VMPA 4PJDE 3QUKA 1Q9WA 2MCPL 2BH0A 3GTVA 1S9XB 4X98B 4HUVA 2HFTA 2DTML 4FN0A 2Z64C 5J6HB 5HHVL 4JANB 1G84A 1I1AD 4YHPB 4B9FA 1RU9H 2VN4A 3QIUC 1N9PA 4XHQA 1EFXA 4C56D 2WUCH 4L4TA 4WJKB 5EFIB 4BCYA 4FZ8L 1OEZW 3ZZ1A 3VXRE 5F88A 3PHAA 1YEFH 4NP4L 4U0QB 1U33A 3MLWH 2VDML 2FGZA 1JS4A 1KBBA 2J8UF 3NJXA 5C8JB 4ZUWA 3TEWA 2VIRB 3QZWA 3G5YB 5AG8A 5FUZL 4ODHL 4NKDA 1RSFA 3I6LE 2V5SA 4OZHF 3KLKA 5ACLA 3HE6A 4CU8A 2YAMA 4MJ5A 3BDBA 4NPYB 1KPUA 3WIAA 4QO1B 3RPBA 3OWEA 5FC9A 2WGNB 5AZEL 2IAMC 5IVXF 4HBCL 4ZPVB 5JOFA 5FO7A 1DE4B 4EBQL 4GRLD 2OCJA 2X4QA 5C70A 1DDTA 1PKQB 2BPBA 3RWCA 4KC3B 1CF8L 2BNRB 5IHBA 2ZKMX 2R69L 1NCCL 4PI2A 3MX0B 4ZPTA 1QEWB 5CHNA 4OJDH 3Q44A 5T1MB 2NSMA 4LVOC 4LU5L 4PJGF 4R96A 1S46A 2JJUA 5D71L 4AIZA 3VA6A 1HZLA 5I1HH 3ESPA 1BQKA 4Z7UE 2CO2A 3EJTA 5AN4A 2G3MA 4KV5F 1BFSA 3MTXA 4Y4FB 3OSKA 1N5YH 3DMMA 3MV9A 1QACA 4L37B 4YDLB 3PV6B 4FLOA 4XNBA 4S0TD 5E70A 2FATL 3D52A 2HA1A 1NEZA 5CEXA 1XGQA 4JAMB 2WWMD 4PGDB 4ZTPH 1MHPL 3WXVL 2CO6B 4WO4D 5FWQA 3QI9A 5G5DA 1GCYA 2X70B 5IROA 3DX6B 4XCEA 3VO0A 2UX6A 2ZYHA 4UTAA 3U4BH 1S7VB 3F58L 5BV7H 2HX9A 2JB6B 2Y22A 1J1XL 1NGWB 3K5RA 4KVNH 1EHXA 2BP0B 3MRJA 3GEWB 1B6UA 1OGAD 3O6ML 2XQ0A 1SYVA 3DGGB 3O9WB 5CKGA 3MRCB 4IRZH 3MOAH 2A6JB 5IBUB 1BP3B 3ZR6A 2X4RA 1FLRH 5CU5A 2FX8H 2DKMA 2MPAH 2ZXWB 2J1YA 4QRQA 4JUSA 4OCWL 1F18A 2YAEA 4N86A 2W0FA 1AC0A 3TASA 1JF1A 2R0KH 1A4BA 1JFQL 2A9DA 1DQKA 2CJSA 1YNTF 3RTLA 2P42B 4PAZA 4YZFF 4A2EA 4BFGA 2PTUA 3F12A 1RJZA 3CN3A 4P4KB 4PHZA 1A7QL 1SLXA 3RWGA 2PO6A 2YSTA 3OQ3B 1NBVL 1M53A 2VN7A 5BZDB 4G1EA 3ZL4L 1WK0A 2JB5L 1FPTH 1GMIA 1KCSL 3ZK0A 3HRZB 4AGOA 2FZ3B 1KUMA 3JT2A 3JVGA 4JB9L 3WGUB 4AQ1C 1I7RB 5BRZB 3WY4A 2GJJA 5T1LB 1HINH 1TQBB 4H7VA 1M4KA 1MFVA 1WAAA 1ZV5A 4NQCA 2DICA 3LVTA 2DAVA 4EI5A 3ME0B 4WUKL 3VI4E 3BZ4B 2QQNH 3LN4A 3DUHA 4OJCA 5ANMB 3PAYA 4DKFL 1MAKA 1FUNA 4FKEA 1DEDA 4UV4H 3UYRH 3BXNA 1HX0A 3MQIA 4WNSA 5HPMA 1VIWA 4MX7A 4IRSA 4GRLB 3RJOA 4UINL 1DBBH 1RUKH 3DRQB 3DK0A 5F89A 3TFKD 5T3XH 3GO1L 3QP3A 2BSRB 5IKCA 1OAUL 3EHBD 4HV8B 3UJJL 1S8DA 2VLRA 4HEPA 5G4NA 2WAHA 3ARFD 3WIHA 1JZ7A 1FZKA 3VXSE 4P9ML 3FQTB 1H15B 4NCDA 3S3PA 2CUAA 3AG2B 4MMZA 2UZXB 3W0WA 4YBQC 3CDYA 3RYMA 3S2AA 1HK6A 2VYRE 2DWDB 3I6GA 4PJXB 2NUPA 3K71B 3LPFA 3OXRA 5JNYB 1OSYA 2EYSA 2XYCA 3SE4C 1ZJBA 1W8NA 4KI5E 5D2LA 3MV7B 4GI8A 2P80A 3VU2A 5MEQB 5PAZA 3O4OC 4FYQA 2F54A 4NM8L 1FN7A 3QG7L 5BV7C 5IT2H 2F19L 3MLYH 4XMUA 3S7GA 2W65A 3OBAA 1QN5A 4Y4KA 4L8DA 5EC1B 3NT0A 3OG6B 5DZLA 1G9HA 5CR8A 4CC0A 3VXNA 5JORA 4DUWA 1YO4A 1BJMA 4K7PX 5FYKH 1KPRB 3MCYA 4UM9A 1QQDA 4AMXA 3TVMB 1T5WB 4IK6A 1A7OH 3BAKA 3BLPX 15C8H 3LEXB 4FFYA 4ODTL 1N6QH 3G6JB 5DJZB 1OGAB 3G04A 3TBWA 1QPPA 4D9RE 4FNPA 1SFHA 1N4XH 4JM2D 3LZOA 1R3LB 3HZVA 1WISA 1RZPA 3L9RA 3MGTB 3PU7A 4DP6X 3N06B 1BEYH 3ZZSA 4JY6B 4XPGH 5E9DA 4NPJA 2IV8A 4OLEA 1YQMA 2CUMA 3F3HA 1I3RB 4P48A 5AAWC 1WC7B 2JHNA 4NBYB 1HVXA 2QDWA 5DMIH 4ZS7H 4HOWA 4MJIA 4RBPH 1G0YR 1S7UA 3PWPB 3QS3A 1Y18A 3B3IA 3ZGHA 4B0MB 2H9GA 2QKIC 2AJSL 4JRXD 4KKPA 4N2GA 3Q5OA 1IC7H 4L4VE 2GYSA 5DS1A 1TQCB 5FYJH 3V9EA 5D6CB 3H2WA 3SDYH 1OZTG 3TH3T 2A3TA 5GHWL 2IMMA 3KW7A 4H20L 2QT6A 5IB1B 2BSSA 1MEXH 4FHKA 3DARA 5JO5A 1SM3L 3UP1A 2CK0L 1VJSA 4GQRA 1BX2B 2DQJH 3A6CL 1FNGB 2NRDA 2X4OB 2P52A 4KUZL 2WWKT 3IAPA 2ICWA 4CJ0A 2W60B 4X6EA 4Z3EA 1KLFB 4K7PY 3GMQA 1U8KA 1NGZB 1R47A 4GMTH 4R7DB 4UQ3B 1S5IL 3KL3A 1IGTB 4YDIL 1JGUL 3NDZE 2ZYIA 4KX8A 3BSZL 4GRWB 4F58H 2XY2A 1GYCA 1SUHA 1YN7B 5FM4A 2JKXA 1JD9A 1YEJH 5ITBH 3BKMH 2BXYA 2Z92A 4UILL 4WV1B 2JJTA 3QZWG 5I74C 3MBXH 4G8GD 5FAAA 5EC2A 4ZMZA 5EEVA 5K9QI 5FK9B 1MCIA 1QWUA 1TJMA 3NIDF 4Y9CA 2OX5B 1OSEA 3K4ZA 1AR1D 4W9CC 3QUHA 3ZE2F 4JO8A 4XP6H 1ZT1A 5E9AA 4X8CA 4HHAB 5SWZD 1U8CA 2NX5D 1H8SA 4JE0A 3WENA 1GYAA 4IBQA 3NN8B 1SJHB 3B7YA 1NDMB 2AJXH 3NIFE 3IWVA 5F6HJ 2ZX8A 3UTTE 4AMKL 1L7IL 2CO7B 3DROA 2CA4A 5GGTH 4NQEE 4JDEB 3I0XA 2F68X 4PRHE 1FZMA 1H6UA 3CHOA 4KKZA 5I66B 1PTZA 4JQIL 4WU7B 3I50H 3ISYA 4PGBB 1AMXA 3CZLA 2F5BL 3QJFA 3GBNL 1RIHH 3QQDA 1NEZG 4UQ9A 3ABZA 5KN5B 4ATTA 3QUZC 3IYLW 1YVLA 3FQXB 4NC2B 3WMPA 5GS1B 5LWYH 1LQBC 1A5FL 4UT9A 3VAEA 4PRNA 4OZFA 3HFML 4OZIB 1J1PL 1EZLA 1MVYA 1T3FB 1L7TL 3U0PB 2O61A 5FOJA 4ZXBD 1KO9A 3GKZA 2F7RA 4OF5A 2WM0A 3CV5A 5TGBB 3UG4A 1BD2E 2OP4H 5I2IB 4Y2LA 3K1KC 5B1JA 5D2NE 3V0VA 3UBXB 1CD1A 3SDDD 1WD9A 2EIJB 3E6FB 3MPCA 3MREB 4QHKJ 4M00A 2W9EH 3ARGA 4P23B 2CKBA 5F8RC 2J8UA 4U1HA 1A6WL 3ARUA 1AYOA 3OLEA 4POZC 1PVSA 3Q9QA 3GXIA 4XPFH 5IQ9A 1JMZA 4ZSOE 1D6EA 2JCCB 3W81A 1HESA 4PLNC 2G0LA 4OD2B 5DQJB 4A55A 3ZDXB 3LXBA 3RWHB 1M2VB 2IALB 1K35A 1CXFA 3N89A 5BO1L 2VZTA 1CL7L 1HI6A 2XZQH 3WY3A 2WZ0A 1OF0A 4PP1C 3QXAA 4RMTA 3LIZA 4AKOA 1AXTH 5I8KL 3QEUA 3V4PA 1JMXA 4Q97A 1NCWH 3ABKB 3O3BB 4NIYE 2O6EA 5I75B 2QLVB 3PUUA 3TWCH 2E9WA 2VDOL 4ZODA 2ICEC 4PJGA 2WBJA 2Z93B 5CMAA 4MSWA 4PJXF 2EH7H 3CQFA 3C6LA 2J73A 5E5UB 2EKSA 4Y19D 1N5AA 3P0VH 5DFAA 4OM1L 2CJTA 2YA1A 4MTMA 1UCTA 4TPRH 2AQ2A 1FORL 3O3UN 3V8OA 2ICCA 3OAYK 2NY6C 3FK3A 5DA0B 4EF3A 3QNYB 4GSDH 4WTZG 1BIHA 1J86A 1EJOH 1XTLA 4FQCH 4YGAB 4IU2B 4JMNA 2VDQH 4L3CA 3EOBB 4CADB 1OIOA 1KY7A 2B3IA 3QUYB 5TE4H 4R4FL 4HC1L 3ZSTA 4X0KB 1A4JA 1MCWM 2UXTA 1HHHB 4AGQA 5EU4A 2GBVA 2WJ5A 5EEUA 4XN2A 4HEPG 4L3EA 1UM6L 5B7MA 3L1OL 1V8HA 3HI1A 5KSAD 4JFVA 3B56A 3RILA 4F8NA 5C3LD 4CVXA 3DPBB 1KELH 2ZCKL 4L9LB 1BW8A 2C9SA 5I18H 5BS0E 4I48A 5AW8B 3E3QC 3UTQB 2F5AH 4AVHA 2IH3B 4NIKB 4UBDD 5EO0B 2IDFA 2RMNA 4JZNB 1TEGA 2GBTA 4NN7C 1AO7E 2RBLA 4NP9A 1MCBA 4ZUSA 5K69A 1PLGH 5EO9B 5GQBA 2R9HD 4QRPD 4N2DA 1JXGA 1TVHA 4R7VA 2XFXB 1YNTA 1A1MA 1RSYA 1WJ3A 1V7NL 2NOEA 4X6FB 3NUKA 3U9PH 2ZG2A 4OLWH 4ZUVA 5B3JF 1BGXH 4EVNB 2FECI 5EG6C 4J3SA 1DVSA 3U7YL 3N55A 2Y7QB 1TEYA 3QIUB 4HXAH 4ZRGA 1MFEL 4N87A 4O58H 4LVHB 4NI3A 4TKWA 3KW8A 3N0AA 4YAQB 1BLNB 2EIZB 3BKJH 2GG1A 1RZ7L 3BAEL 4W1TA 5IHUL 4FTVB 1OALA 4NSKB 4Z7WA 5LCVA 2A6KB 3BAWA 2C5DC 5F6IB 2OYMA 1L0XA 5D55A 3FFCD 5DRWB 3EH3B 4NFCA 4PVNA 4IBLT 3U46B 1FF5A 5HHNB 4ONFH 4Q4IA 1YEEH 5AZ2L 3C87A 3IXAB 3THML 3UBHA 5FECA 1NGXA 2ZKHH 4QHUB 4AYFB 3TX4A 1W72L 2IAMB 4PRBA 1BPLB 1LP9E 4P4RA 4CGUB 3FQUA 3IFNL 1E3FA 2OMTB 2QZQA 4V33A 4MAYC 4ZMTA 4JPIA 2DIAA 2DQFB 4N1EA 1M42A 2WXRA 3OKNA 5DVKA 4JG1H 2HFGH 4TUJA 1NSNH 3L08A 3DXAE 4LVOB 2XIDA 1CFVH 4NWUL 3FPXA 1ZGLA 1UA6L 2FCBA 2RFXA 5F6HI 2X3CA 3P4OA 5DLMH 4PREA 1LMKA 3FRUB 5AYUL 3RZCC 4TVPH 3VNYA 5KYYB 1I1RA 5F7KC 2QFRA 5AZUA 3ARPA 1ZOXA 4GUQA 4YSQA 4EZJA 5CLWA 1D5IH 3BP6A 1IEAA 1TVBA 4DTGL 4NJAL 4GI9A 1CGTA 1PZ5B 3C5ZA 3BGMA 3BQVA 1VA9A 4X6DF 5GIRA 1Q9UA 1QSFA 4ZO9A 1NZRA 2PCXA 1DBML 5D7KE 2VDPL 4YK4C 2VISA 2PR9A 3AQZA 2CE6A 4GFTB 5BOPA 2Q7YA 2YC1B 3QXVA 2ZX7A 2ZXBA 1PD6A 4U1LA 3OGCA 4JKPH 3QULA 4AE1A 2IGLA 2CR6A 1GGTA 5DDHB 3ULVL 5HSHA 2NTFA 2RIKA 4W4OC 2ZOOA 4KTDH 2HKFL 1AMYA 4FG6D 4GKNB 4LHUA 4YWGH 1NC4B 1FH5L 2GTWA 3KJ6L 4XMXA 3CVIL 4JM2F 1GJWA 3JT0A 2BWIA 5E5RB 4HWZA 2FB4L 4I18C 1PG7X 5E2WL 2EIDA 2PWDA 2YXMA 1WT5C 1D2OA 4UAHA 3FCTA 1B3JA 1KXVA 1FVDB 1UJ3B 3OV6A 5K39B 3FYIB 1ORQB 4HXBH 3EJJX 4ALAC 3GI9L 3AROA 2DD8L 2EXTA 4DK3A 1S9XA 4X98A 4R5XA 1NUFA 3KYKH 3R8BB 5J6HA 1M9SA 1DQJB 1Z6JT 4JANA 4YHPA 2XN2A 3GEFA 3BX7C 4KJPC 5B1AB 4PY8J 3SJVE 3C9NA 1C16B 2WIIB 5L2KB 1UKQA 4AQ1B 5EFIA 3OCIA 4N68A 4NUJB 2WHVA 5FDYA 3V4VB 2A4CA 3FQWA 3L4VA 2NNFA 4GB9A 1W8EA 5FM5O 1P5UC 3LNDA 3RVXC 2WANA 3COOA 1XCXA 5FEBA 2IAAC 5C8JA 4N9OB 2VIRA 3TEYA 1QNAA 3NSYA 1Y6NR 3H8NA 2JCCF 1BREA 3JV4B 2DTSA 1HWHB 4GFXA 4W9DC 5FGCE 3RAJL 2QVTA 3TL5A 1HC1A 2K6WA 3LQZB 4NPYA 4XP9H 2DH2A 4JHUA 1E2ZA 3ZIYA 1YY9C 5F7YC 1JXDA 4ZPVA 1OP3K 1WAPA 2X38A 4PJ5D 4D0CA 2HAZA 2KHAA 4JVWA 1O5DT 1A7PL 3KPOB 1PKQA 2BNRA 3QCUH 4G8IB 3JV0A 4EN2A 3Q06A 1N0XH 3MX0A 4YUEH 1NJ9B 1QEWA 5T1MA 2A9AA 2YRPA 3QW9A 1CBVH 2X1WL 4NHCL 3Q6FA 3QJXA 4Y4FA 5D5MF 4AEIH 3MUZ1 1SVZA 4DPRA 5GRJH 1AGDB 4L37A 3PV6A 1UT1A 1OAKH 3FW6A 1KIPB 2H0JA 2NW2B 2AAAA 4ZW6A 2WNKA 4TNGA 1NGQH 4CW1B 4JBSA 1IGML 4JAMA 3O4OB 3EBIA 4PGDA 4KVPA 2WC7A 2CO6A 1DVYA 1T6BX 3DVFA 5BV7B 1NAMH 3CDGB 2UY7B 1CYGA 1R17A 2CJ3A 2X70A 4OJYA 1YEWA 1XCQB 1JYNA 1S7VA 1ONQB 2JB6A 3KYAA 3M07A 1R3IH 3SDCD 1NGWA 2BP0A 3HG1D 3KVQA 4U3HA 1TYJA 3HC3H 2O30A 3DGGA 3O9WA 3MRCA 3KPQB 3AS0A 3KWWB 3DPTA 1Z9NA 2GK2A 2A6JA 2DJUA 5IR1B 1CFBA 3RBSA 1BLIA 3KPTA 3QGVA 3VD0A 4PJBE 2J72A 3FU0A 2NXZC 2Y06L 4LEOB 4HUNB 3AZUA 3KBPA 1I7TB 4FFTA 2L04A 1D9KC 3MGAA 3H7LA 4FNQA 4P4KA 3M45A 1FA4A 4Q8BA 1EWHA 4BFEA 2AVFA 4FXKC 5I0DA 2OCCB 1OCWL 1RUAL 4WX8A 3OB0H 5BZDA 4S1DC 5E2TH 3AGVA 2QKIB 3VD2A 4HDIB 4P59H 3HRZA 4ZUTB 3TCXA 2FZ3A 2WB1A 5D7IB 5BRZA 4FA8A 4XN7A 1I7RA 2BY1A 4WWID 5M7QA 1I9IH 2KL6A 4H2AA 3MSPA 2R29A 3C2AL 4V1DE 5B22A 1M7XA 5T1LA 3ZE1F 3IETA 5DS2A 3CFIC 2X10A 1F6AB 2XWCA 1CVSC 5CD5C 1PZBA 1KTJA 3VGBA 2D8KA 3O2DL 4CMMB 2DM7A 2OSYA 3ME0A 3BZ4A 5HYJE 3W37A 3DO7B 5KSVB 4G3YL 4HOZA 3ZDZF 4M48H 5ANMA 1DFBL 1ZSHA 2HWZH 3FSZA 3Q8AA 4U6XB 1CGXA 1MCCA 2JVUA 4IIQC 3SKOB 5HY9B 2VUOA 3WEXB 2RR3A 3FYEB 2BZ7A 2SEBB 2HKAA 3K7UA 3QIBD 4P2OD 4PJ5B 4GRLA 3DRQA 4I77H 4LP8A 3ZRFC 3CH8A 2BSRA 4HV8A 5TE7H 4CGTA 1G4RA 3FQTA 1MCWW 1H15A 4XX5A 2H6PB 4JN2B 2UZXA 5E6IC 5AVYB 2RCSH 1E90A 2DWDA 2QQLH 2VB5A 4GXVL 4PJXA 5I74B 3TFBA 5D7EA 4Q52A 4MNGE 3I75B 3CFMA 5JNYA 1I9JH 2EABA 4KTEH 3E1F1 2AJZB 5E8NB 4DQAA 3GXMA 3WTXA 5J5EA 1DQIA 2XY1A 3WTSA 3MV7A 3UABA 3BVNB 4TS6A 3SGKA 5MEQA 4M8UA 5T5NG 3A4DA 4Q0XL 1HZKA 4LAJH 4PHXA 5EC1A 3TN0C 1KF9B 2DDQH 4J5VA 1XSOA 5D7LB 4N0FB 5HHMB 1KPRA 1PZ2A 1T5WA 5DJ0B 5A2KH 2NLVA 3DUUB 1J8SA 1NCDH 4IOIB 5DJZA 1OGAA 4PY8I 4QRFA 1R3LA 1KBGH 3MGTA 5TE6H 1KTKE 4LPVA 5F93C 3Q6GL 3K2KA 1GAFL 1UACH 2WQ8A 4PY7B 4Y1SA 3QUZB 4MAUL 2O5YH 2R0WL 3HJ0A 4AIEA 1I3RA 3FO2B 5DVOA 3AGWA 3ZXAC 5CILL 3GIVB 3PWPA 4YHML 2YJLA 1FFRA 5LBSA 3RUGF 2R27A 5I73C 4ODUB 1IO4C 2R23B 4L23A 4TQPA 3HE7C 3PAVA 2VERN 4OGAD 1MIMH 4YFDB 3UG3A 5JHLH 3L3HB 3V0WH 4P05A 5C7XL 2NTSP 5MEPB 3S37X 3OH6A 5D6CA 1QABA 3AFLA 2LV4A 4LHUG 1MVUB 3WY2A 2NNAB 2EDTA 3UO1L 3ES6B 2NOLA 1V7ML 1KEGL 3HAEH 1D5XB 4HG4K 1DJZA 5A3IC 1BX2A 1FNGA 1LK2B 4PJCF 1NICA 1F90L 4TULH 3S34H 2X4OA 3D4CA 1BZ9B 2C4FT 1ZIAA 3EO0B 4M62L 4LIQL 2D03L 1I31A 1KLFA 2X6AA 4ESKA 3QEGL 2Y69B 2FJHB 3CVDA 4M03A 1NGZA 1D5BB 4R7DA 3TEUA 3ZJAA 2HLFD 2D9CA 5BJTB 3EOYG 4UQ3A 3C04A 3QIBB 1TUPA 2XTSA 4XBEH 1IGTA 1V3MA 4PFEA 3VFGL 3CFTA 4UQDA 3WIIL 3BSGA 2FRGP 5LHDA 1NKGA 4N1CA 4AV5A 4NB7A 2QQKL 2ICEB 3UTPE 2Z1PA 4H40A 3O3EB 1BVZA 2YD7A 5C97A 4WV1A 4I2XB 2CDGB 2QSCH 2X89D 2HP4A 1CT8B 1KN4L 4WUUB 1DVQA 4FQ1H 3CHQA 3HI5H 5FK9A 5SWSD 5JYLA 1E6JH 5KVDH 4KZDH 1SEBB 2OX5A 2BNQD 4NN5C 3S35H 2X28A 3WV0A 1I1AC 2X2HA 3MLUH 4J6RH 3ELQA 4HHAA 3U1SL 2GKIA 3D85D 5E99H 3U9WA 2XKUA 4E41B 2XN9B 5LDSA 3D0VB 3NGBC 5B3NA 2R0LH 3NN8A 5GS0D 1SJHA 5AB9A 4KQ3L 2ZIDA 1NDMA 4TLTA 1WF5A 4UB0H 3BRFA 2CO7A 2ZKWA 1WLHA 1G7HB 2ALWA 2GJZB 2X2JA 3F7YB 3NFNB 2XQBH 2ZE0A 3BE1H 3FULA 4JDEA 2AP2A 3F62A 5IW6B 4K3EH 5I66A 2JJVA 3STZB 4AVJA 2DBLL 4K5PA 3II1A 3QXDB 3HMXA 4WU7A 4MXQC 3UBFA 1QBBA 2PTTB 4YOKA 4PGBA 4AJVA 2Y2TA 1LE5B 3PUCA 4M7JL 4NCC1 1JZ8A 3Q2WA 4NN7B 1CG9B 1OZUA 2W9DH 3G6JE 3UIYA 1UD3A 3V55A 3BDYL 5KN5A 4HCIA 3FQXA 5GS1A 1SF5A 2F8XC 1PYWB 3GS7A 1J8HE 4OZIA 4MXVF 1WVZA 2EO7A 2AS5M 3BZEB 3LTVA 4CC4A 1T3FA 2OMUB 3ATAA 3U0PA 3GUTB 1U21A 2RA1A 5D7IF 2Y3NA 1IVTA 2DQCL 2HH0L 5TGBA 3HZMB 2WQUA 3V6OA 4ZMLA 4X7SH 1G87A 5I2IA 4BIKA 4YXKL 4D9QD 2J6EH 4QRSB 4BQ6A 3D2UB 3I3DA 3UBXA 1JNJA 1OAZH 4QKTA 1RMFH 2V5RA 3GRGA 1CICD 3E6FA 4U33A 4KWUA 1TEFA 2YSSB 1QP1A 3MREA 4P23A 4XCNA 2E27L 3KPNB 4JW3A 2C9QA 2OV0A 3NMEA 1DTUA 2XICA 4URKA 4X5XB 1H3TA 2DYPB 5HHPB 1S7XA 2A74C 2XG4B 1PFOA 1GC1H 3ARTA 1KN2L 1YQRA 3V0FA 2JCCA 3CMGA 5I76B 2OMVB 4ZMAT 4OD2A 5DQJA 3BPNC 1J88A 3RWHA 1WV7T 4PRPD 3J7HA 1M2VA 2IALA 3OZ9L 4ZFFB 1X6NA 2BLFA 1KBKA 4NBXB 1FL6B 3QQNA 1EFQA 2Q8BL 3PY9A 4MAYB 1V5SA 1OSPL 1TR7A 3O3BA 1CBVL 1YMME 4J12A 3DYPA 2YD9A 2QLVA 1CLOL 3RVVD 1BQLH 1G6RH 1GGYA 2P28B 2Z93A 3BQUC 3FU3A 3L1GA 1I82A 1PJWA 3GXNA 3RZCB 3ZVVA 4ONOA 2IDCA 4ERSH 1KGWA 4XN8A 4EI6A 1UB6B 2CXKA 3OKKB 3QNYA 3NPSC 5F7EH 4Y1TA 5DWUL 4IU2A 1BXUA 3CK0L 1JFIC 3EOBA 4CADA 5KS9E 3FNKA 3PJLA 4JFEE 1S6NA 4GKLA 3QUYA 1TKWB 3G08B 1TO5A 3RHWF 3S3BB 4X0KA 4BE6A 4AM0Q 5JYMA 2K8MA 3D85B 1HHHA 3GMOB 2EACA 4M5ZL 5AVSB 4POYA 3QFDB 5GZOA 3KCPA 4HIPA 3K2UL 5CS7A 2OXHA 3HNSL 5CN1A 1JHLH 1W8OA 5CZVL 3REVB 3QJQB 3BUYB 5I1GH 2DQDL 3GLEA 4RRPA 2V3EA 3H3PH 2K0RA 5GRYA 3X3GL 5KAQF 5D70H 3DPBA 3IU3B 2VLJD 2CHXA 3E9TA 4L9LA 2VJXA 4BJLA 3DOIA 2HRPL 2M26A 3QQ9D 2EH8L 3SD5A 5HYQB 1E4XL 3O4LB 3TTYA 4DSYA 3WFEL 1Q1JH 1RLBA 1CXKA 3GSUB 2IH3A 3UTQA 4NAJA 1YEKL 1H8OA 2XX0A 3WN5C 2BY3A 5EO0A 2I9LB 4JZNA 1ZHBA 3EBAA 1A21A 2ICWI 1VERA 3LKPB 5DD0L 4I18B 4KQ4L 3CE1A 5EO9A 1MLBB 3CLEH 3BVXA 1IBGL 1BJ8A 3PWUB 5HVFB 3CFEA 2DQHL 2XFXA 3UDWC 2AK4D 3EYUH 5DT1L 3NSJA 4X6FA 3V0AC 5H4YA 1Y0LB 1QBLL 4EVNA 5CEZL 1EXHA 2YAFA 2Y7QA 3QJSB 3QIUA 3EJUA 3H2PA 2VT0A 3PQYB 1XR8A 1I3VA 5KBKA 4YHZH 1BLNA 1ZLSL 1Z2KA 2EIZA 3L16A 2CHZA 4U6VH 1A7RH 1KPVA 1P5UB 4FTVA 1GC1C 4NSKA 2A6KA 3D7QA 1N26A 2A0LD 5CP7B 3MVSA 1BAFH 3QCVH 1MCHA 2VKXA 5DRWA 4PSPA 5EBLB 1HJCA 3U46A 5HHNA 3ARED 1BMZA 3U0TB 3C2SA 3FU6A 5CZRA 5L9DL 2OOXA 3IXAA 3H1ZA 4JQXC 2F15A 4YLQT 4AYFA 4H26B 4PR5B 2Y36L 4QHUA 5MP6H 3TO2B 4X4YB 2OMXB 1WGOA 1KYOJ 1RCYA 1MG3C 4R9HA 2DB8A 3N41B 2GAZB 2OMTA 1KEMH 1XGTB 2N1KA 1S9VB 2DQFA 2AJYH 2GTQA 4GUOA 4W68A 1KYFA 5C0BB 2CGRL 1AY1H 4JM2C 1CPUA 5KG9B 1ZGLM 4XVTL 5ADOL 3HN3A 1BAGA 4XE5B 1N70A 3FRUA 2Z3FA 4IDLA 1FIGL 3GKWL 5JDSB 5KYYA 5CM1A 4MCYB 3MJ9L 4ZI8A 5LDUA 5EDXA 2ZUXA 4IBWA 3W9DB 2GUYA 1KWKA 1N8OE 3P2BA 2Q7AA 5HHOB 2H1PL 2VDLH 3HR5B 1PZ5A 2AI0L 1MRFH 4RMSA 3MNDA 1T4WA 3ULUL 5CEYB 1IFHL 4PUBL 4IKJA 1KGUA 1DVTA 3Q2VA 2ZOKB 3BAXA 3AS2A 3GJEB 1OTSC 5AAPA 2YC1A 2IPTL 2OPCA 3SO5A 1BWWA 3BO8B 3RA7H 4HPOH 5DDHA 2N1TE 3RTQC 3RVUD 1NKOA 4B3EA 1TUOA 2BVQB 3K81A 5KSAA 3H7BB 2K70A 4GAFB 4AEHL 4AYSA 1P1VA 2EDFA 4PGEB 1XFPA 4GKNA 1NC4A 2DWXA 5KEZA 4EIUA 2BSDA 2NXZB 2M1KA 2OMYB 2HJLB 4UTBL 1SUJA 3SBWC 3BUDA 2YOAA 2HT4D 1BPVA 2VSMB 1J48A 1ET8A 1XIWD 4PW4A 1FVDA 1UJ3A 1Y6KR 2EDJA 5K39A 1D9KB 4LMQE 4NM4H 1D5MB 1ORQA 5GJSH 2V9UA 1R0AH 3ZTJG 4WHTB 3FT2B 4Z7VB 4MNQD 4FXKB 1FV1B 1DQJA 3H53A 1IU1A 3RUGA 3JYBA 2Y25A 1NAKL 5FV2A 1PS3A 1FWXA 4FABH 3FT0A 1C16A 2WIIA 5L2KA 4AQ1A 1UZ8B 4NUJA 3V4VA 5C3IA 2C4FU 3U0WH 2J1WA 4A2GA 3NJNA 3KLLA 2LLNA 3RIKA 4Q14A 3NABH 4F37K 5I1CL 4ZX4A 2AC0A 1I9RH 2VL5B 1NL0L 4A6YA 4WK4B 2B15A 4N8CH 4DGVL 3HMWL 1ZWIB 5CCKH 3JV4A 4NO3B 5E6YA 5F7WC 5IK3B 4LSRL 3QFGA 5DRZB 1JRHI 2Q8AH 3PWLB 3OF6A 1MOEA 2IV9A 5AD0B 1MQ8A 3GMLB 2NSQA 4N2OA 1GR7A 4BWWA 4IIQB 2XQYK 4HVBA 3LXCA 4PB9H 5E1AB 2XHIA 5DHMC 3RY5A 2FT8A 3KPOA 5CIPB 1YQVH 5BCAA 4BFBD 4G8IA 1JYWA 1ZDQA 4CMHC 1T1WB 1SQMA 1JYVA 1NJ9A 4TQEH 1JFHA 3S37L 4JCLA 4D7BA 3UBXG 4TSCL 3MJ8B 1C5BH 2J12B 3GSVA 4LRIA 5DO2D 2DL9A 1SHSA 4TVSa 5JMVD 1TNMA 3FTYA 4NI6A 3CZFB 4WCYH 3T0EE 4ZFOL 3NZSA 3PFUA 5GPRA 1AGDA 4FERA 1DBJL 2CMRH 4OUUA 1KIPA 2NW2A 3SE4A 3Q1SH 4DKEL 1XL4A 4KZCA 4CDHA 1J11A 2FQDA 3LRSA 3UZQB 3ABGA 1JDAA 5F44A 1WQAA 4PLJC 2A9ML 4OKVB 2YJQA 4FZEL 2EDRA 1VADB 3CDGA 4A7UA 4YHKL 4XP5H 4NUGL 5A43C 2XQYA 2QV4A 1XCQA 5IB5B 3TN0B 5A2BA 1ONQA 2BW5A 2QHRL 3F7KA 3B9KD 1JZHA 3LN5B 5GGUB 4YXLH 1JHKH 4ADIA 3H85A 3KPQA 3KWWA 1MJJB 1R19A 4KK6D 5IR1A 4OBSA 2Y07H 3U6XA 5CJBA 1UOLA 1CUOA 3U7WL 1M7UA 4LEOA 3V7AG 3DX2A 3SDAB 2BMKB 3O6LH 4RH4A 4K94H 4XNMB 3GSNH 3C6SB 3D4YA 1G7LB 4N90E 5JW4R 1T7VA 3WL9B 2OXGB 2J88H 1SXBA 5EZJB 1BWMA 1D3UA 3O0RL 5IUSA 2JQAA 4MNQB 3HCVB 1B3IA 1IE4A 2QKIA 4HDIA 2HX8A 3FH5A 4RRPG 4ZUTA 5D7IA 4R0LC 1I1CA 1Z7JA 3FS9A 1I8IB 4YDNA 3TJHD 2JXMB 1EBPA 2UYLB 1F6AA 2AAVA 3BH8B 4UMGA 2I9TB 1QZNA 3VI3E 3D09A 4CMMA 3L5WB 5ABAA 3ZZQA 4YHLH 3DO7A 1FRGH 2X87<