3HS9A

Intersectin 1-peptide-ap2 beta ear complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 complex subunit beta-1
publication title Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 52
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hs9A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3hs9A02
1KY6A 1QN3A 1TGHA 1AISA 2Z8UA 2D0AA 3HS8A 4RODB 4PY5A 1YTFA 1NGMA 3VN5A 1MP9A 1TBAB 1VOLB 1B9KA 1QN8A 1QTSA 4B0AA 3H1ZA 1NH2A 2IV8A 4WZSD 4ROEB 2MJ7A 1CDWA 1QNBA 1QNAA 1QNCA 2D0BA 5IYBP 3OCIA 1QTPA 3HS9A 5IYDP 4ROCB 1QNEA 1VTLE 1NVPA 1KYFA 2IV9A 1W80A 1C9BB 1D3UA 1JFIC 3OC3C 3EIKA 2D0CA 1RM1A 1QN9A 1QN7A 1PZDA 1KYUA 1PCZA 1KY7A 1KYDA 1VOKA 2VJ0A 1QN4A 1TBPA 5IYCP 1R4XA 1YTBA 1E42A 1VTOA 1QN6A 3ASMA 2G30A 1QN5A
chains in the Genus database with same CATH superfamily
4PGBA 5DMGD 4XE0A 1IBBA 4NSKA 3TT1L 4A38A 1USQA 1B88A 1NLBH 1T22A 1V3KA 3G6DL 1AD0A 4FFWC 4I0PA 5IOKA 1B0GA 5I6XC 1CS6A 2J5LC 2ZUXA 3BSZL 4HLZG 2OR7A 1PW3A 1V7MH 4ADGA 4HSCX 1EERB 4D9LH 3I50H 1UVQA 1YEIL 4CN1A 5KVEL 2H8PB 3FF8A 5DGQA 3K6FA 3PE9A 4WUUA 3W11D 4UTAH 4R4ND 3P4MB 5EU4A 5HGHB 4Z7WE 1SDDA 3MV8B 3ULUH 4LCUA 4K3GA 3RIFF 3FQWA 1KJ3H 1XVSA 3NA5A 2K6WA 1WAAA 2P52A 4YOKA 2VQ1A 3EO0B 2EDEA 3CVHL 4K55A 4FTVE 1IM9D 1J05B 3RNQA 43C9A 1JTTA 1M71B 1GPOH 1H3GA 2QADD 4NN5C 1CI3M 1NLDL 4QHLB 3PQYB 3CZKA 2HL9A 2CIIA 1JN6A 4NO2A 1MNNA 4IRZH 2IOMA 4HETA 4XVOA 5IF0B 1S9WA 1T7ZA 4NQEE 4QGYA 4HOWA 4U1HB 2PWDA 3CC1A 3TCXA 2ITCB 2R8SH 4GI6A 5A1AA 3QRFM 1WWAX 2D0GA 4U31A 3KPOA 4CMHC 1QRKA 4ZFGH 1CFNB 2C1PA 3TWCH 2R1XA 2AK4D 5DZAA 5C08D 1ZEAH 1QKZL 2YXVA 2E9WA 2ENQA 5GGTA 3ZLQC 5CILH 3TVMB 5IMOA 4D0CB 1YMMD 2X44D 2ZF8A 3B56A 1OHZA 3CFJA 3O3BA 4B5EA 2ICCA 1EJOH 1A65A 1YN6A 3UOAB 1RURH 3MRRB 2DW5A 4Q6YA 4WSJA 1KCRL 4NKOB 4L3FA 1DUZB 3ZT7A 1N68A 2JB6A 2JXMB 1BVKA 3OXSA 3FDWA 1OEZW 1G94A 4POZD 4MZIA 5CZVL 3EHBC 3UC2A 2XOTA 1CTOA 1DFBH 1XF1A 2VLJE 1A1NB 3K74B 3BN9D 9CGTA 3FQ1A 1OOAA 2Z0FA 1JXJA 2L04A 1QBBA 1U8PB 1QBML 1NBQA 4P4KD 2YAEA 4XN8A 3V52H 3Q44A 1LP9A 1S9VA 2BP3A 1NCUA 3U9UB 5DR5H 4C4UA 3T4AC 1W6LA 1SJEA 3CWGA 1KENH 3O9WB 4ECNA 4QUOA 4WV1B 4NRYB 5GHWH 1XB3A 5DURB 4N0FA 3TA3C 2BHFA 5HJDA 4PJFA 3HVDA 4XB3A 3I75B 2EH8H 5HJ3A 1TJGL 3NJXA 2DMGA 1XL6A 4ZMAT 5GS2H 4B41A 1E6OL 4BGDA 4FXLA 1ACZA 3W9DA 3ARDB 3LRSA 4P2QE 2UYLA 4TUJA 2XC8A 1BZDA 1WIOA 3KEHA 1CQKA 2YBRB 1SLWA 1PNCA 3U1SH 1K8DB 4FQXA 4JPVH 2BZCA 5K9QI 5DRNA 2AITA 3MRHB 3HPJB 3RUGF 3ZTEA 3U25A 3MLRH 3M7FB 3QEQD 3GJFB 2C9AA 3A23A 3ZL4H 5BRZB 1XCQA 2EH7H 2FIKA 4Q11A 1J0HA 4KKBC 4M7KH 3VVVA 5EU7C 2MCAA 2Z0BA 1YPZB 1QR1B 3DOIA 1VFAB 3SDAB 3UABA 4LOEA 4XPHH 1WYJA 4MJ6B 2MCPH 2F8IA 4KC3B 3WTUA 5MEPB 3C5ZB 3G5VB 2OULB 1IEAA 1WC7B 1PZDA 3LS4L 3QJOA 3W37A 4MAZA 2ITDA 4JFPB 4RMTA 1T1WA 3TESA 1RJLA 5IW6B 2I7OA 3P0VL 1OGAD 3C08H 4OGAD 3GMOB 3TYGL 1B90A 2IDCA 4C47A 5D7SH 2WCSA 1S2EA 4O5LH 4MHHI 4V1DB 5ANMB 5H35A 1F0LA 1T66D 4G6AD 5JXEA 3QULB 1HL9A 2WXOA 2IANA 1PCMX 4BSWA 2CJTA 1F02I 1RSFA 2BSRB 3FAXA 3G04B 4NUQA 4TVUA 5AQ0A 4FABH 1A9EB 1A0QL 2JKLA 4Q6IC 3Q2CA 4KV5F 1M1XA 1QATA 3G6JF 5CU5A 3MNWB 1KJVA 5E6IC 1I3GH 1W9XA 3EADA 3GJEA 2IFFL 5EUOA 1QSVA 5FYKH 5GRZA 3WNOA 2R29L 2YR3A 4ZMOA 1VAHA 4O9HH 5A2JH 1FAIH 4PJEF 1U8JA 3IJHA 3KPSD 1QW8A 1IC1A 3R0MA 4WKXA 2V37A 5IJVA 5DF0A 1BEYL 1CLZH 3O2VH 2EDOA 1OANA 3THMH 2I5WA 1AD9A 1VADB 5KVFL 2L7EA 4PRBB 3PAYA 3GRBA 2CPCA 4RSVA 2NY5L 4XWGL 4GIAA 3FFDA 4RBPK 6FABL 1E8WA 1QRND 4V11A 5IMKB 5DFVC 3IJSA 3IMSA 2R0LH 3B9KD 2OCFD 2GK2A 4DGWC 1EO7A 2WXQA 1WBZB 4OCSH 5EF2A 3VGEA 4P8QA 1RP9A 4Y7MA 3PIQB 5CJOL 1JHKH 1INDL 2EKSA 1M9SA 3NAAH 3W5MA 3D5OF 5DA0B 2GKIA 2WJ5A 3VU2A 1NWOA 1IAOB 3PG2A 4AYFA 4UINH 2AEWA 3UP1A 4R7XA 3AREA 1RQ5A 4W9ZA 4G70B 1JZ3A 5J9PB 1B2WH 4RETB 5EEYA 3BPNB 3W39A 2ENPA 4ONHB 4AENB 1JVLA 2W59A 3EGXA 4PJ7F 4ZS7H 4HZ1A 4PWFA 1PCJX 5IR1A 3EFDH 3LIZA 3T0XA 1OK8A 2ADFL 4GSDL 4OLVL 3L1EA 3NACL 3Q2LA 4I2XB 4HOZA 4E68A 5HDLA 1GAFH 3DDGA 1NFIA 4JO4L 1DN0A 5BOZG 3SDXA 4GW5B 5HGAB 3QG7H 3BZFA 2BY0A 1LWJA 4LKXB 3STZA 4C83B 4AK2A 5CP7B 1L3NA 3RVVD 2VMEA 4HBQA 5IM7B 5T1LB 1OP9A 1DSWA 1HHHB 4H8VA 5BO0D 4HOXA 2YPVH 1WZAA 3KGTA 1O9ZA 5C86A 2R69L 2CO4A 1MI5E 2O5ZH 3KD4A 3VXMB 5MENB 2DLFH 2MTPA 2P4AB 5D4QA 5I1EL 1DR9A 2A99A 3ZHFA 1XO8A 5MHSD 1KGJA 4V2BA 3RVWC 4PFEA 5GPRA 4HK0B 3SN6N 2R56L 5LO7A 3QAZC 2FIRT 5DFWH 3ENCA 4MLIA 5KTEL 3FS9A 4XMZA 2BCKA 4FG0A 2QREA 4D7RA 5I1IL 1A66A 5H2BA 1MFBL 2F54D 1NDTA 3DMMB 3RBSA 4ELKA 4N2FA 2G60L 1WWBX 3CDYA 4ZAKB 1RUKL 4Q0XH 5JR1L 4UM9B 1PU0A 1TCRA 3C2AL 4IQHA 1WA1X 4N2MA 4Y1AE 3L5XH 2KHAA 4MJIA 5L6YH 4MWFA 4YGVB 2X4PA 2BSEA 3EJQA 1M7DB 3K2IA 4HKZA 1QWHA 1UZGA 4N0UB 5F7UA 5BS0B 3KL3A 4P9HL 5F0JB 2OSWA 4OR1A 3VXOA 1UACL 4Z77A 4BM7A 2QHRL 3OBAA 4MXVE 5TDNB 1KNOB 4Y19A 3ZKNC 3NIGF 3O6KH 4A39A 3UJIL 5KSVA 3FOMA 3L4YA 4B0AA 1UA3A 3BFWA 3F6LA 3WMPA 2PP7A 2VISA 1X5XA 3FO9A 4LCVA 3ZDZF 4XAKD 1PQZB 2ZOLB 3DX6B 3K3QA 5K39B 5DEJA 1NAMB 1IAKA 2VUYA 4JE4B 1NOAA 4R84A 4QLRA 3PP3H 4EDWH 4EAIA 2DWSA 5E5UB 1MVYA 2HT4D 2I9LB 3GHPA 5AD0A 1ZHKB 3RGVB 4MB4A 1IE5A 4B9KC 4H25B 2W88A 3SKJL 3AG3B 1DVZA 1GZQB 2R5XA 3PYCA 1LYQA 4GRLC 4LSTL 4I4WA 4FRWA 4LOFA 4ZFOB 1HINH 2FO4A 2HP4A 3U46B 4HGWB 1REIA 1JK9B 2BWQA 3ZQXA 4NWTH 2ID5A 4XGZA 1WEJL 1J0IA 1KXQA 1QPXA 2R2HB 3O0RL 2EYRB 1X9RA 1IQDB 3EYFA 2EP6A 3N85H 1N8ZB 1U92A 3L13A 4U2YA 3CX2A 1CN4A 4N3TA 1QSEB 1HHIB 3HZMA 1LO5B 2B15A 2FYYA 1F86A 3MV8E 3T1FA 3QCVL 3ZQ9A 4RAUA 3QH3A 4PSPA 1NMAL 1NC4B 2ZX7A 1JZ4A 3HAEH 1LO4H 2ZOOA 4M48H 2VJXA 3C2SA 3UZQA 2VLME 4JPIA 4LSRL 5ADOL 3PQYE 1SHSA 2DWTA 2EE3A 4ZD3H 4F7MA 4EDXB 1ZANL 1NCWL 5I76B 4CFFA 2WMPB 4HWZA 5JIKA 1KYDA 2IDSA 3FTVA 2XZZA 1ADQA 4OZHF 1ZVYA 5IGXH 2DLTA 4BFOA 4F7PA 5JXAH 1J5OL 4Y4HB 4AKOA 3E1F1 1SUHA 3OKLB 3UYPB 2Y6SD 2F1BA 1KDIA 3ULVD 3CV5A 3WGVB 4M43L 4KWUA 5TE4L 4HX1A 5TQ2H 3TO2A 5KSAA 4UQ9A 4L3EB 1UGKA 1XHHA 4OZIA 5JPMA 3FAWA 1FC2D 1CL7L 1IEBB 1TMQA 3AM8A 3F7VB 3HEIB 3U0PA 5SX4I 4KXZI 2HFGH 1CTMA 4JUTA 1IM3D 4P23A 2X4OA 4KI1A 2J73A 2XFXB 3AXHA 4IRSB 4PJBA 3EH3B 4JPKL 2CHWA 3JSSA 3BYYA 4I77L 3TF4A 2GTWA 1KFQA 2AXFB 3D12B 2VSKB 3K46A 1CD0A 4G7VL 5BOPA 2PPDA 2H2PD 2Z1KA 2FWSA 1UGNA 1Y18B 2AV1B 2VLJD 3NPZB 1M57B 3MAWA 5JW5B 2CGZA 3V5HA 2NY3D 2YIHA 1ZVNA 1T4KB 3J07A 4R0LC 3QARA 3G5YA 4TQPA 3S35X 4PB0L 1A14L 1MHCB 2ICWI 1BD2B 3H3KA 1MXGA 3X3FH 1U95A 2Q3ZA 2WOYA 2IBBA 4X42A 4A2HA 4L8CA 4D7QA 3KJ4C 4N90D 5HTSA 3EYQD 5DFAA 4YXLL 3CSBA 1QEWA 4AM0Q 5FUZL 3OKMB 4RFOH 4Q89A 2WN2A 4BK5A 4FC3E 3HUJA 2GJ6D 1TETL 3LQZB 2F9BT 5ACMA 3QEHA 4X0KA 4JANB 3OGCB 4LL4A 3I9IA 2JVUA 3B34A 3BLPX 3IGAA 3L7FA 1PF3A 4IS6A 1PLGH 3B7UX 2VH5L 3KDMB 3IFNL 2VC2B 2CCWA 3BVVA 5AW9B 1E50A 3DTDA 32C2B 1I1AB 2NMSA 1DJWA 1O7SA 5SWQA 4ETQB 2NY0D 3PWPB 3POCA 4XZ4A 4HJSA 1XBDA 1NM4A 2GHZA 3VGFA 1EXUB 3RFZA 2H2SC 4RFNC 3NJJA 3OF6A 4JFFB 4NKIH 2R2BA 5IFAL 4BSVA 1Q72L 4NZTL 3P9MA 3ZQWA 4P2OA 2W9EL 5J3HD 5BRZE 5C7ZA 3D0LA 4BBWA 3DJTA 2R9HC 3B7RL 1NGYA 4AH2B 2EADA 3ORJA 4PGDB 3EXJA 4DCQA 3O8XB 5IMLB 1P5UB 4OAWB 4JHZA 2JQZA 5GSVA 3S4SG 2NNRA 4QRQA 5B38G 3MYJA 1RM1A 2Z4QB 3KJ6L 1LO0L 4FZ8L 3CBJB 3IMVA 4LLMA 5DJAA 3LCYA 2H41A 4YK4C 4TSAL 1QFWI 3T0EE 2WLLA 1Q9LB 2PXYD 4LHUA 5J8OA 3PL6B 4JRYB 3N1FC 5BMFL 5L2KA 1JHLH 2QQNH 3M7OA 5F0PB 2NUTA 1JDCA 4M6AA 4GI8A 3R18A 2LV4A 2W95A 3GSWA 2VE6B 3MGTB 4V1DE 5ANME 1JPSL 2OL3L 3IS1X 1BBJB 5GRUH 2XQYA 1H6FA 4BWWA 1BWWA 3EJUA 4AEIH 2VOTA 2WWOA 2X0WA 3FPYA 4P59H 4NI6A 2YRLA 1AKJB 1MG2C 2LTQC 1BPVA 2DB8A 4RFEA 2K70A 1UC6A 3PV6B 2ED9A 1CGWA 3OKOA 4LCCC 1T5WB 1L3WA 4W9JC 1JWSB 2HT3D 3MR9A 4Z95L 2YEZB 4UT6L 4E9TA 1SYVA 3NIDB 1N10A 3ULXA 1KB5A 1YEKL 4PH8A 4NN7B 1T0PB 4L4TB 1KB9J 2EACA 4UUJB 1DUYB 1PJ9A 4OM0H 5HYJB 1MCBA 1HXKA 3F7PC 3WFHB 1N3AA 5DQDH 4WW2C 1CD1A 5KJ7E 1SVBA 4RA0C 3MCLH 1S46A 5LJYH 2VERA 3GXIA 3ARFB 1R33A 3BVNA 4XBGA 1BIHA 3HBQA 2I07B 3WN5C 1TBPA 5DUPH 3WUWB 4DGVL 1CYGA 4L1SA 4UV7H 5GIRB 1E43A 1SXSA 1N6QH 3VD3A 4FADA 4P3CH 4OI8A 4KZDL 4PB9H 5D7JA 3CQPA 4YZWA 5DJ8A 4K3DH 5BVPH 4OB5H 4DEUA 1XIWD 2BVQA 5JW4M 4IBQA 3QWRD 3CC5A 3T4YB 3UZEA 3S37H 4JFOA 4A63A 1CDCA 1H3VA 1MFDL 3B7YA 5E8EA 1U8MA 3BQUB 2VXTH 5DQJB 1ZHNA 2D7QA 2ICEB 5E6YA 1R3IL 1AKPA 4XXDA 3VQ2C 1U91B 4K73A 2QKIA 4GP8B 1ETA1 4APXA 5I1GL 1BLNB 3A67L 3UBGA 4Q2ZA 3VD7A 3BGMB 3P11H 3DPBB 3PWLB 5KJ4A 2VGLM 3WKMH 4HT1H 5LCVH 1Z6JT 4OCRL 1KCVH 1FH5L 5AZEH 4BH8A 3BP7B 3BRDA 1QA9A 4I3SH 4PGBB 4A2FA 5C0RL 3U7YH 5L0QB 5IT2H 4NSKB 4Z3JA 3I0WA 1RIHH 4N2AA 2F5AL 1T22B 1AD0B 1FHNA 3K0YA 4I0PB 4NM8L 4AWJC 3AY2A 4NP4H 1AG0A 3NCYS 5E6RB 1B0GB 5KANI 1G9NH 2HVBA 3WJLA 4LSQH 4I2XE 4PV1C 1RERA 4PTTA 2Z9TA 4X7DC 1FGNL 1PLCA 1KPVA 4E9YA 3HVNA 1JWUA 1UVQB 5D6DA 1MFAH 2D3LA 4WUUB 1B6UA 3IDUA 3UROR 2V9TA 4J12A 5EU4B 3KGRA 4PJ8D 4XVJH 4A55A 1SDDB 3H4FA 3F85A 4LCUB 1PIFA 3FQWB 5JTWA 1ZA3A 5KVDH 2VQ1B 4FNRA 3GFUA 1MI5D 2K4WA 3EAYA 4NX0A 3RNQB 43C9B 3KM1A 2CKBL 4F3FA 3GBNL 3VXME 5MENE 1E4KC 3DARA 1OPOA 2CIIB 1JN6B 1MFCH 4NO2B 4N5UA 1PZ5A 3QVAA 4PWHA 2NW3A 1JP5A 4B9YA 1YAZA 4DUXA 2Z92A 1S9WB 4KRLB 3SDDA 4Z7VA 1FPTH 1MJJA 5I0VA 1PLBA 3DGGA 5I73B 3LEXA 1AAJA 1YQVL 1ULVA 2BIMA 1A3LL 3WNKA 3KPOB 4CVUA 1XDTT 2C1PB 2K0RA 2R1XB 1TDQA 3ETTA 1N9PA 1VCBC 4LSPH 4RAHA 4HXAH 3RGBA 4Y1AD 4UILL 4X4MA 1QG3A 1P7BA 4LEXH 4XI5D 5IMOB 3CW7A 4PS4L 1D7CA 3O3BB 3CFJB 4LRIC 4Q97A 3SQBA 4M1CD 4GQ9H 1YN6B 3IPEA 5CJ5A 4N0UE 3EH5B 5BS0E 4RODB 2JB6B 3OXSB 1BVKB 3HHRB 4MJ5A 4NHCL 2VLRA 4XHJC 3G5XA 1M3QA 5FS5A 4YEFA 1Z0MA 4CW1A 4XB7A 4KZ0A 4F1ZA 3EG9A 2UZIL 2ZUUA 1J9QA 2VLKA 4WGVB 3MJGX 1MCHA 4P9ML 1XF4A 7CGTA 3A4EA 1B2YA 3I9GL 5KOMC 1NDGA 5I0DA 4FCHA 1M56B 4TRPL 1G9ML 2B1HL 4PREA 1LP9B 1S9VB 5ECGA 5IV2A 4PY8J 2RBLA 4OZ4A 3BE1L 5E5RB 3RTQC 2HH0H 4P05A 3WFBH 1SJEB 2XXGA 1RMFL 4UM8A 1T7YA 3RWFA 3UACA 2EXTA 2XVGA 5CEYA 4WHDA 4MZRA 2DKCA 3A6BL 4N0FB 1MELA 3BIBX 4PJFB 4ELDA 3EYVA 3OKDA 4L1LA 3H6AA 5EO1A 5HJ3B 5IJDC 3WO4C 1OTUC 1TJHL 4X8JA 5CZXC 3W9DB 5HHXH 1G4MA 3MJ9H 3LRSB 4GS7B 1TQUA 2UYLB 4TUJB 3QQ3A 1JPEA 1KTDA 5E4IA 1X7SA 2R0KH 3M8OL 1CE6A 4FFTA 1U3HA 4H0HB 4RGMC 1IVTA 1TGHA 4OFDA 1QSEE 3X1EA 4FQXB 3MI6A 4BQ6A 2A4EA 2Q6WA 5FUCE 3VDAA 5IHHA 5DRNB 5CR1A 1OPGL 1B9KA 5TD4A 1WO2A 1KCLA 4QGTA 4CC4C 5AKVA 2QQKL 2EVIA 4XO4A 2FHCA 3BPLC 1XCQB 2FIKB 4OLUH 4ZOEA 3FTWA 1P4UA 4PJDE 4O02L 3RRQA 3QPXH 4W81A 5HD8C 4ZO8A 4QCIA 3L4VA 2XJLA 3GXUB 1TKWB 2BRRL 4XMTA 1DJIA 1IEAB 4NRXA 5FW8A 2I26N 1UCBH 1BFVH 2IEPA 2ITDB 4PTUA 1M7UA 4LOUC 4QRFA 1T1WB 4NUGL 1RJLB 4L3EE 4I5BA 1BQHA 4C7PA 4ROEB 2YXFA 4DZ8A 2E8YA 4FLRA 3HMXH 2AS5M 3OPZH 1NLBL 1WUNT 1INQA 5H35B 1NA8A 1TUPA 5I30H 2D4FA 2IANB 3FCBA 2H3NA 4BSWB 1D3CA 4F93B 1S7QA 3LTVA 3JWDH 1V7ML 4ONOA 4UNIA 5AWNH 1FYTA 4D9LL 3I50L 3QE5A 4GFTB 1M1XB 2V3DA 1T04A 5BPPA 1KJVB 4UTAL 3INOA 3GJEB 2H5AX 3B7SA 5EUOB 5E5MA 5CJXA 3N1PC 3ZL2A 5CD3A 3ULUL 3NJKA 5I71C 3SCMD 3D39A 4IKNA 1KJ3L 3L9RA 4HJ0C 1U8JB 3IJHB 4JG1H 3Q8CA 1BD2E 3ZSTA 3MUGA 3ARGC 4NEHB 4EZLA 1FYHB 1NIAA 1ZGLA 4AYBA 4E9RA 1YDPA 5D4JA 1DDTA 1GPOL 1IE4A 4G8EA 5IJVB 5L8LB 2EXSA 4IOSA 1ZWIA 2C9RA 1AD9B 4GT7A 4IRZL 3ABKB 4H2CA 4NQDD 2F68X 3CDCA 5DVLA 3GEWB 3FFDB 4RAVA 3RPKA 2FGZA 3DGCR 5JHDA 2R8SL 2G3XA 3IJSB 5ISZA 3GI8H 4U33A 3V0HA 3OKEA 1KTBA 3U9WA 3JUYA 5AW6B 1SBBA 1B4LA 4ZFGL 1LK3H 2D73A 3TWCL 2MH4A 1FL6A 1V55B 1ZEAL 1P7QA 4QG5A 4J27A 5CILL 4K3HA 5SX4H 1W8NA 2WLJA 1C8PA 3PWPE 5HI4D 3QIWC 3F05A 3ZSSA 1R34A 5FWQA 1UFUA 4C57C 1EJOL 4AG4H 2EKSB 4TSCH 3NPSC 3DX9A 2Q3XA 3D0AA 3H55A 1RURL 2GHWB 3K6NA 3B6SA 2FLBT 2HTLD 4K71C 5JA8B 3IDNA 1JGDA 4JFFE 3NCMA 4KJQC 3N9GH 5B22A 4AYFB 2VAJA 4M1GH 1G7HA 4L2YA 3AREB 1DFBL 1WIUA 1XGRA 4IIQC 1HJBC 5DHMC 3AQDA 2X6VA 2I32A 1J0YA 4PJCA 1XD0A 4ROCB 2IQ9H 3CZJA 3S97C 3W39B 1F4AA 1GHFH 4PJXF 4F2MA 3Q5OA 1AZCA 3EGXB 5GSRA 5AVSB 2CBPA 5IR1B 3T0ED 5EH1A 4PCYA 3V52L 3BRFA 4F58L 4KK6D 4AM0A 2EEXA 2W8CA 3SBWC 4I3GA 2EDBA 5DR5L 1NOLA 5E8OA 4JRYE 2HN7A 2NZ1A 4ANWA 1NFIB 3VGGA 3BLKA 3UYOD 5F9DC 1AVAA 3MLZH 1DN0B 2D4DA 1KENL 4HJGA 3SDXB 1M5Q1 3BZFB 5GHWL 1AMXA 3FB7A 4NQCD 2G0LA 3STZB 4CUCA 3MRLA 1HS6A 4LCWA 3BGFB 3MLWH 5JPNC 2EH8L 2YK1H 2EQDA 3LZPA 4PVBA 2KZBA 3VXTA 2B3IA 4Z7UF 3GKWH 1F58H 1IGML 2DEWX 5FB8A 2HSIA 4HU2A 5EG6C 2OMNA 1N6UA 4NKDA 3U1SL 4JPVL 1J0ZA 4WW2F 4B9CA 1EWHA 4XT1C 3NIDE 5C0NC 2EHBD 5BV7C 4L4TE 3I02A 5B39G 5EHFA 3MLRL 1U8IA 1GC1C 2ERJB 2PKDA 3TFBA 4XNAA 5BQ7A 1F2XK 3BVWA 3CZNA 2Y36H 1CIUA 5HHNA 5CN3A 3ZL4L 5JHAA 2BCKB 2EH7L 3SGJC 1K5NA 1JPFA 4M7KL 2QDWA 3MV9D 5H2BB 5B3SB 4KZEH 1E8ZA 4ELKB 4F33A 1UB5A 3SSGA 4XPHL 3L8QA 4RMWA 2XBTA 1TCRB 5ESAA 3EUDA 2MCPL 4BD4A 1NIFA 5AAMC 4MJIB 5KYNA 3ZW3A 4MWFB 2X4PB 3OVUB 1QFWH 3OV6A 4HKZB 5EEUA 1AXIB 1O5PA 1VFBA 1N7MH 3MJ7A 4M6NH 1KC5H 2P5EA 3LPGA 3VXOB 4Z77B 3C08L 5LAXA 3LX9A 5AVQB 3HS9A 4Y19B 5D7SL 4JL2A 4O5LL 4YSRA 1W72H 1JNNH 5KSVB 3FOMB 4OFKA 3FUFA 3GUTA 1MW3A 4OBSA 4Y2DD 4RWHA 2VISB 5BQDA 4U49A 3FO9B 4GPVA 1L9MA 4ODBD 4QKXB 3SIKA 4RDBA 1T7WA 1BQUA 4BZ2A 4FABL 1IAKB 3RKPA 2F15A 1N70A 3O2WH 1KV3A 1T80A 3AG2B 4WGKA 1I3GL 2O4EA 1SNRA 5FYKL 4X7CC 2Y7SA 4MMXA 2EDWA 5AD0B 4L9DA 2HRLA 4O9HL 5IZ7A 1FAIL 4XMWA 5A40E 1U8LA 4UTBA 5IHUH 5T1DH 3RVUC 3B4NA 4PJ5D 2GUYA 4I4WB 3ZZLA 4MS8D 2FO4B 2DF3A 2BWIA 4LGRB 1CLZL 2YPLA 3W0WD 3O2VL 3THML 4XGZB 1OALA 3HRPA 5JIHA 1J8RA 3EYFB 2ITFA 4FHJA 5I18L 5E8DH 1QYGH 1U92B 1TQBB 4OFPA 4RGND 5JHLH 1MZYA 4Y5YB 1QABA 2D3NA 4JMNA 4A7GF 1UH2A 2FYYB 4HC1H 3T1FB 3GT6A 4X6CF 2R0LL 4NQQA 3UYRH 4RAUB 3CH8A 3QH3B 1WAAE 4ZMTA 1KTJA 4OCSL 2E8ZA 1G6VK 1DVXA 2FEDD 4ES9A 1EEUA 3QFDA 4H1LG 3UZQB 4JPIB 1KT2A 5L4FA 1OF0A 4FFZH 1JHKL 4KROB 2CJ3A 5DRZA 4F7MB 3NAAL 3B5HA 4YDLB 2Y69B 4HWZB 4X98A 1L9OA 2G9HA 1S9YA 3PABA 5FO9A 4OZHA 4IRJD 3RB7A 1UZ6E 4F7PB 4BUHA 3HE6A 4UINL 1J9CT 3UMTA 3ARWA 5EN2A 5T5FA 1DLHA 4HX1B 3TO2B 3UPAA 3O6FD 3TBTA 4ZNEA 5KSAB 3VFSA 1E5YA 4CDHA 4ERSH 1SJXA 3T5WA 3POHA 4OZIB 3ATFA 5JPMB 4ZAKD 1B2WL 1DVSA 1QBAA 3OKNA 1VESA 3U0PB 1TYJA 3NRQA 4DP5X 4ZS7L 4TUOA 3EFDL 3G6AA 3OLGA 4LVHB 3ECUA 4P23B 1HWHB 2X4OB 1MDAA 5B7EA 4PJBB 2QLVA 2RAMA 1YTFA 2NW2A 1GAFL 5CIPH 2O5NA 3GLEA 3CAFA 2GTWB 4GO8A 3QG7L 2MOVA 5L9DH 4BQ9A 3LRLA 3V5HB 1N3CA 4U1LA 2TSAA 4JFVA 4N2DA 3FU3A 1KYAA 3KAAA 3RL2A 3G5YB 1E4JA 2YPVL 3T4AA 1U95B 4FG6D 1XXDC 4EMZA 4W9GC 4L8CB 2XYBA 4I18A 4P5MA 4J7RA 3LPPA 1LP9E 1QEWB 2DLFL 3HUJB 4P2RD 1DBKH 5E9AA 4PN6A 3QEHB 4MKTA 3ZJAA 3QUYA 3RP1A 2Q9OA 4X0KB 1M05A 1AJ7H 1MNUH 3IGAB 3L7FB 4YHKH 5A2CA 1R0AH 4IS6B 4L8BA 4PJFE 2V5YA 1UTDA 1QLRA 2BRQA 3VD1A 2H32H 2G9KA 3ZO9A 2XCMC 5IUCA 3U83A 4Q0XL 1DN2A 2ATKA 1WICA 5SWQB 3W5NA 1BVLA 3L5XL 2FX7H 4JE0A 3LAFA 4H8WC 5L6YL 1UT4A 3HAEG 3K1KC 5FFGA 3RFZB 3LZNA 4AYDC 5INDA 2B5IC 2R2BB 3CFQA 5JHBA 4BSVB 1Y6NR 1K3IA 3P9MB 3KYMB 3O6KL 1QSFA 2DIJA 4P2OB 3QT2A 2EXWD 3C12A 3D0LB 4DETA 2NYYC 2PO6A 4YHNA 1NGYB 2EIKB 4J1UA 4DCQB 2EECA 4R7NA 3NSFA 2AMGA 5KBNC 2ZFDB 3HG1A 2YPKA 5GSVB 5CCJA 1QFOA 4QRQB 1J8HD 1ZT7A 3MYJB 2MNWA 5ICUA 1GRWA 4LLMB 5DJAB 2WZ6A 2LLGA 3MUHL 4EDWL 5JMRA 2WLLB 1Y6MR 4LHUB 4X4YA 1SQ2N 4EPSA 5FGRA 2AJSH 5L2KB 2XKSA 5FF6A 2NUTB 5HVHB 1WWCA 4Q6IA 1G7LA 2HFFA 1XEDA 2YD1A 3GSWB 4EN3C 1AS8A 1IC0A 1DVUA 1HINL 1OCZB 1IBYA 2IANE 4JX0A 2XVKA 2OMVA 4NWTL 4IKJA 4PGZA 5E2UH 3TZVC 5ICXA 2D0AA 4RFEB 1TMCB 4GOSA 3EFFA 3N85L 3QQNA 2X2UA 4K9EH 2VUKA 4QRRA 3X2QB 3OKOB 3WD5L 4OV5A 4N3UA 1QTSA 3MR9B 4LT7A 5EUOE 5IB3A 1SYVB 5DMJB 3HBPA 4L1HA 1KB5B 4W4NA 1WFIA 2YGPA 4A66A 2GUOA 1J5DA 4MAYD 1CD8A 3VH8A 5KSBE 3WS6C 3WMQA 2C5DC 3H9SA 5E08H 1S6NA 3A47A 4UQBA 3QIUD 1JV2A 4Z7NF 1BFTA 2R7EA 1LO4L 4L4VD 3DIDA 4M48L 1YSOA 3RVTC 1CD1B 1P2CA 4GG6E 1VCAA 2QZ5A 5TDOA 1S5IH 4CMMA 1FVCA 1ZKAA 4ZD3L 4FA7B 4XBGB 3BVNB 2LU3A 1E5CA 2EUZA 3DVFA 1OE3A 1QFUH 3CFIC 3E8UH 4PJGA 5JXAL 1HKLH 1IBHA 3OM3B 3NJMA 2XWRA 1X3DA 2AEOA 1BQSA 4W4OC 3ZT6A 1YECH 2RFXA 1EAPA 3TV8A 5TQ2L 1AR1B 5D7JB 5FO8A 3QBTB 4QIRA 1FCCA 4U6XA 5DJ8B 3SZ6A 2BVQB 3JT2A 4AW4A 3CC5B 5GRJH 2LU4A 4RLDA 3HN3A 4JFOB 3D25A 4TTDC 4QHKJ 1FJ1A 1A6WH 5DZJA 3ZYZA 4EXPX 2HPOA 5C2BH 1LQBC 1U8MB 1Z9OA 2RR3A 5E8EB 1ZHNB 3GF8A 1CFBA 5IJCC 1CLVA 1QX1A 4NUJA 4NXSA 5HI3C 5E2WH 4XXDB 2DDQH 4EI0A 3FTYA 1A64A 2QKIB 2A2QT 4APXB 3D2UA 2OAAA 4Q2ZB 4P0DA 3KMDA 5J0BA 3CZUB 1TJXA 4BH8B 1R3KA 3AWGA 1QA9B 1D5XA 1W15A 1U21A 4NS0A 3X3FL 1G7JA 1NICA 1D6EA 4JEGB 3PCYA 2I9TA 5HDBF 1RK1A 2AXJA 5I5JA 5I75C 5DD3H 2NY1B 3SDCC 2L4OA 4RFOL 1TITA 4PTTB 4Z8FH 1K2DA 1MFUA 15C8H 3QIBC 4X6BA 1KPVB 4HCFA 2VUOA 3WKYA 1A9BA 1JWUB 3SDXE 1HU8A 1ZA6A 2DKMA 1Z9NA 4XB8A 1QOKA 1A4CA 4HLEA 2Z3FA 2BHUA 5LXGH 1G9MC 2JLPA 1PLGL 2XN9A 5GS0C 2YD8A 2ZOKA 1AKJD 5AL0A 1ZA3B 1IL1A 2BNQA 3L4TA 1KN4L 5D7KD 5EBMA 5IROD 3FXIC 2E7LA 3R1GH 1ZLUH 1SVCP 1DJHA 3JV4A 1ZHLA 3N3EA 1I1YA 2HX7A 1LEIA 1MG3C 1MCWM 1TVDA 2D0FA 3RTLA 1S7UA 4F3FB 3WTXA 4JLRA 2D9QB 2BSTA 5IK3A 2HUHA 1WAPA 5CSZA 1AP2A 3BEWA 1PZ5B 2NW3B 4NKIL 4F27A 2Z92B 4Z7VB 3SDDB 1YJDH 1MJJB 1RL1A 3DGGB 3LEXB 2CO2A 2YMXH 2ZCZA 5K9JH 3D4YA 4GG8A 1KGWA 3P2TA 4C4BA 1G5GA 1AHWC 4M9PA 1X5AA 3QRGH 4ZUTA 4F80A 3CCHA 1V5SA 1GJUA 1EGJH 3V4UH 1P1VA 4MJIE 1CJYA 5DMKA 2XYCA 4I0KA 3RE0A 3SQBB 3GNMH 2YQ2A 3FL7A 4MHHG 2WXJA 3CG8A 3N44F 4RMBA 1HYRC 5C07A 3ZDWA 4AQ8C 1LEKA 1JHLL 2QQNL 2EUXA 3GKZA 4MJ5B 1P69B 5DXWA 2VLRB 4YFDB 5AVTB 1ZOXA 3G5XB 1MWAH 1A3ZA 1DLFL 2MMXA 3ARUA 4KKNA 4OZFH 5GRUL 4CW1B 2E7BA 1FRGH 3P0YH 4AEIL 3QPKA 1TLMA 3EG9B 4PD4K 2HKFH 2VLKB 4P59L 5E1HB 2EDFA 3LZLA 1XF4B 1I9EA 3OHXC 1NDGB 2B9AA 4ZMZA 3I3WA 4KKQA 4PREB 1JXDA 3QORD 4OFVA 4GRLA 3U30B 4WI3A 5IV2B 2XV2A 2Y0SA 4OZ4B 3TASA 4P5RA 3VI4F 5KG9A 4FMFA 3ZE0B 1Z3GH 1IFHH 3GJFH 2WXHA 4EI5C 4KOBA 1U2HA 2X70A 4OM0L 4UM8B 2D7PA 4UAOC 3RWFB 5HHOA 3S3CB 2NY6C 5CEYB 2FX9H 4MNQA 5FYLE 4N0YH 5DQDL 4AYMC 3CX5J 1SEQL 3BUQA 3MCLL 1TTAA 3EYVB 1YEHH 5C0CA 3OKDB 4NIKB 5EO1B 5DJCA 1Q8MA 4X8JB 1KXQE 3MPCA 1CFMA 5DUPL 3B37A 3GI9H 3QQ3B 4U7SA 2W92A 1KTDB 2WKLA 4UV7L 1CE6B 1U3HB 3ASNB 1N6QL 3CLEH 3QYNA 4P3CL 5F1IA 2Q6WB 3W81A 2QFRA 4PB9L 3U1PA 4HJTA 2NPLX 4K3DL 5BVPL 4OB5L 5ICYA 1DP0A 5D72H 5CWSA 1VOKA 1I8LA 5C09D 3S37L 3QUXA 1VDGA 5HDWA 3OLEA 4ZTPH 5B7MA 4MYPA 2AJVH 3OQRA 5F0LB 2VXTL 2OSLA 4DQOH 2IDTA 1I8IA 4QCIB 3VMNA 1CDHA 3KPLA 1JF1A 4XRCA 3VU1A 4FI6A 4RNRA 5F97E 4LVOB 1UWEH 4EQ2A 3K5RA 1OD9A 4NRXB 4DZBA 1Q4NX 5HYEA 1FFTB 3P11L 4PRAA 4PTUB 3WKML 2I5YH 1MJ7H 2CHXA 2IAMC 4HT1L 5LCVL 1KCVL 3GEFA 3KLSA 4I5BB 1BQHB 5AZEL 4AY0A 4OZIE 3RDJA 4I3SL 2MZ8A 4DZ8B 3U7YL 3LOWA 5IT2L 2W38A 2VDRH 1TYEB 1WTLA 1XF5A 3KDPB 1RIHL 1SFDA 3PNRB 1INQB 2K6ZA 2X12A 2WBKA 3VACA 4O4YH 1HHJA 4ILDA 1G9NL 2H3NB 2VKWA 4J3OC 4LSQL 4PJBE 1WJ3A 3BAWA 3R8BB 1IILE 1TTBA 3WIFA 5IP4A 1EBAA 1YQLA 1S7QB 2EAEA 4R0LA 4Y5VC 1FYTB 1OXYA 1MCQA 4TPRH 1T04B 1MRDH 1MFAL 2IWGA 3RKDD 4LPUA 3SBPA 3ETSA 5AVXB 1VZGA 1G1OA 5E5MB 3CPLA 4XVJL 3VWKD 4E5XA 2NT1A 3FB8A 5CD3B 4WWOA 3D39B 3L9RB 5KVDL 3MUGB 1ZCRA 3LDBB 1DBJH 1ZGLB 4FNSA 4OLXH 1YDPB 4K7PX 1JDDA 4K8RC 4DULA 5JDSA 1ZWIB 2K8QA 2X89A 1WZKA 3HUJE 1A4BA 3HIZA 1AMYA 1IC4H 4GH7B 4OJEH 1MCNA 3O4LD 4PWIA 4RAVB 4PQXA 3UDWC 4RISL 1FPTL 5AYQA 2JTYA 5JHDB 3V6ZA 5ISZB 3OKEB 3WEXA 2FT7A 2A4CA 4YZFE 4A2GA 2X6MA 2UV3A 3RI5F 4DN4H 1AQ8A 4LSPL 4TQ8A 1WV7T 1FL6B 3BP5A 4HXAL 1J48A 1P7QB 3ILPB 3MBEA 4LEXL 3CMOH 1QI4A 5T5NG 4DH2A 5DVNA 4KKCC 2IWFA 1O7VA 1R3HA 3DX9B 3L3HA 4GO6B 4GQ9L 5EC2A 3IMBA 3B6SB 4DP1X 2OOYA 3BLBA 1QASA 4R90H 3IDNB 1JGDB 3O9WC 4WV1C 3ZUCA 3RWCA 3P9WB 3CWAA 4TSBL 3JYCA 4NZ8A 3TBVA 1G7HB 4YJZL 4H8PA 1NCDH 1XGRB 4DKDC 1EV2E 1UD5A 4PJCB 3NFPA 1W16A 3EJSA 4PGCA 4Y4KD 1IU1A 4KI5D 5GSRB 3A24A 4EO5A 5LKNA 2H0PA 3TBCA 2C3VA 4AM0B 1TR7A 2C9PA 2DYPA 3UBXA 1CDWA 4EIZC 3MNMA 1CICA 2W91A 1OB0A 3F62A 3IE9A 2HN7B 5DS8A 2HH0L 4R83A 5E8OB 2MQGA 3WFBL 5L2KE 2FYVA 2AQSA 4ONFH 1INEH 1RK7A 4JVWA 4H26A 4HJGB 1JVKA 5CUSH 3CBRA 2HFTA 2JKJA 3FB7B 1UFGA 2VABA 3MRLB 4LCCA 1P5VA 5GGUA 4LCWB 2A6IA 1UXSA 2X2IA 4PJ9A 3SDAC 1NMCC 2NZ9C 2V9RA 1YEGH 2ZXCA 3VXTB 3BSZA 4Z7UA 5HHXL 3MJ9L 4CBPA 2JJTC 3C5ZC 1BF5A 5FB8B 2K45A 2R0KL 4HH8A 2JQMA 2GCYB 4NKDB 4OF7A 2EO1A 4WW2A 4XMUA 1UD4A 1UXMA 1L7IH 5I8KH 1K6QL 2OLDA 3LNDA 3I02B 4OF5A 4UQCA 5H94A 1HC1A 5BXFA 3K0WA 1U8IB 3OJ2C 4XP5H 1U58A 4YEEA 5BQ7B 1QUPA 4PY7A 4KRPD 5HHNB 3CVHA 4NLAA 1RFDH 4OLUL 4C8XA 4Y2OA 1K5NB 3SQOH 4S1DC 1JPFB 5LVEA 2A1WH 1CVSC 3FUEA 3QPXL 3V0DA 4F33B 1FFPA 3UPCA 1UB5B 4HZLA 4AEFA 3ZIMA 1YUHA 5ITFA 1KEMH 5ESAB 2GIMA 4Z3IA 5CGYD 5E5LA 2XWDA 3NA4A 4N8UA 1UCBL 1BFVL 3LNEA 2VZOA 1VFBB 4UV4H 1YQ2A 2O3OA 4MQSB 1PY9A 3MJ7B 4YDMA 4X83A 2NY2D 4AITA 1TEGA 2P5EB 3L2MA 4FYQA 3GXFA 5DJDA 3QQ9C 4AEEA 5LAXB 3QRBA 4E0RA 5H4ZA 4G82A 3UG5A 5KZCB 3GUTB 1HKFA 3BW9A 3EUUA 1GS8A 5I30L 3ZDZB 1RJYA 5D1XE 2G5RA 5KSUA 4LPTA 4IK7A 5FKAA 3JWDL 5AWNL 1ZHBA 3BUTA 1MJ8H 4JDEA 4QRSA 4XBEH 5FW7A 3WXWH 3ABZA 4GAFB 4X9GA 4R7DA 1SHWA 4JY4A 1F4YH 4I7ZC 4MMXB 4ICXA 4B97A 2VN6A 1QI5A 1BJ1J 4ETYA 4JG1L 3VWJD 1GJWA 4A7QA 1Y1DA 1JNLH 2BLFA 4LIQE 1EAOA 5LGKA 2CO6A 2ALWA 2VITA 2N56A 3JVGC 3QEGH 2VMCA 2YPLB 3ABGA 3UCRA 1W0YT 4F2EA 5K59E 5E8NA 1SXCA 2VDKB 4PAZA 2PF6A 2GFBA 4FLHA 3ARYA 4JFYA 2XUWA 5IW1A 1AFVH 3ARZA 3L2LA 1CFTA 3WY4A 5ID1A 3GI8L 2JHJA 4NN5B 5EO9A 1BBDL 1E4KA 1JMXA 3EJYD 4X6CA 1LK3L 3NJNA 3T6ZA 5GZNA 4GAYA 4IYKA 1MY5A 1GMIA 2Z7WA 2F5BH 2J21A 1RCYA 3QFDB 2LLLA 1ZK9A 3UAJA 3LVEA 1QN8A 1KT2B 4XODA 4AG4L 4TSCL 4CMHB 5DRZB 1D5RA 1M7XA 5SX5K 5I5MA 4X98B 3PABB 2G9HB 2YQGA 3NQKA 1NKGA 3UMNA 3B1TA 5FO9B 4OZHB 3N9GL 1NEPA 3BIAX 3L5WA 3HE6B 2QT6A 4Z7VE 4XO3A 4E41D 2ADYA 2AI0H 4M1GL 5EN2B 1ZJAA 1DLHB 1MVUA 1PKQA 3KYAA 3TBTB 3VFSB 3X1BA 4KO5A 1MFEH 4ACTA 4BINA 4ZX4A 2HFEA 4HK3J 4LEOA 2QPEB 3OKNB 3WBDA 2IQ9L 1O6VA 2APVA 3CU7A 5FXCH 3SOBH 5FGCB 1KIPA 2V3FA 1GHFL 1G4RA 4X4ME 2DY2A 4OCWH 4TUOB 2O61A 3G6AB 3C04A 2D7OA 5IFJA 3MREA 2QLVB 1ZS8A 2MCMA 1EZUA 5F70A 2EDJA 2P8MA 4IEFA 4L5FE 2NW2B 1RZKC 3MJ6A 1KGYE 5MEQA 4WI5A 4OFYA 3MLZL 4CU7A 5HSFA 2UXVA 1WP6A 2VLRE 2WBJD 4X7EC 5JYMA 3VD2A 4JRXE 1DFXA 3DMMC 3N42B 3NSYA 3P3TA 4U1LB 4X8CA 4WJKB 4XWOC 5DHDA 1KY6A 3MLWL 4PYGA 3RL2B 4BCZA 2A9DA 1V5JA 2VLKE 2YK1L 3RTQA 4QXTA 4DPAX 1GYVA 3T4AB 4OFIA 3CDFA 1D9KD 1F58L 3GKWL 5AW0B 4WF7A 3C8KA 1VEPA 1PZAA 4I18B 3AT8A 4P5MB 4OV6F 4OU3A 3CXHJ 4N8VG 1CXHA 1ZIAA 3ARRA 3IRCA 1JZ8A 2W60A 3CN3A 2VMDA 2H47C 2R29A 3ZE0E 4AGMA 5DRWA 2A0LC 3QDJE 3QXVA 3QUYB 4R2GD 4CVXA 2Y36L 4CU6A 1P9MA 1M05B 3OSKA 3DETD 1M3JA 1U2YA 4L8BB 4AKPA 4X5WA 3RVXC 3WNMA 4KZEL 3VI3A 2HKHH 1GH7A 2ZONA 4E36A 5CCGE 1QLRB 3NFSH 5E00A 4LQ1A 4B7LA 3L1OH 2ATKB 2NOYA 2VDMB 2XQ0A 4CVWA 1BVLB 4PRNA 5KUMA 3PUUA 4P46A 1BEXA 1HNYA 1WH0A 4L9LC 1TO5A 3KHOA 1QFWL 3HR5A 3D7QA 3WJJC 4A2DA 5INDB 4M6NL 1KC5L 2P5WA 3SGKA 5TPWH 3BWAA 1G5AA 1NBCA 3S34H 1QSFB 1W72L 4PLKC 1JNNL 1VERA 4WFGD 1IEHA 4YHNB 2PO6B 3VFGH 3WFEH 1UXWA 4HBCH 3HCVA 4J1UB 4HJEA 3NDZE 2V0AA 4R7NB 1EUTA 2WVTA 3HG1B 2YPKB 4HUXA 5A2IH 1EA9C 1ZT7B 1MW1A 5E6UB 5KWYC 3ASWA 1ACCA 3QWQB 3O2WL 1P7HL 5IB5A 5FUCC 4X80L 5LGJA 4X4YB 3FQXA 2GTQA 2XNAA 1VIWA 3D52A 4J3OF 5IWLA 3MDJA 4WTZG 5FF6B 5KANG 4RRPA 4Q6IB 4BXVA 2HFFB 4U1MA 5T1DL 5IHUL 2XWEA 5G5DA 3F7LA 4R7VA 2D7MA 2ZWNA 4J28A 3D9AH 5FCUH 4ZTOH 2OZ4H 1ZLSH 1ZMYA 3D30A 3KZ8A 1IJ9A 3V0WH 1K72A 4WI6A 4ABVA 5ICXB 4KV5E 3EFFB 2DWXA 2YSTA 3G6JE 4XN9A 4QRRB 1QYGL 4OY9A 5E8DL 3ARGA 4OV5B 5JHLL 2XKUA 2OMZA 5IB3B 2HKAA 2J56A 4HC1L 5CMAA 2GUOB 2ATPA 3UYRL 3MV7A 3D39E 4AOFA 4QXGH 3VH8B 2GQHA 3H9SB 1DJZA 5DVPA 1QFWM 4ZXBD 1X5FA 1JV2B 2Q7NA 2OYLA 2OCJA 2R7EB 1R3LA 2R69A 1UWYA 4IRSC 4WCYH 1P2CB 2EDHA 4FFZL 4J4PD 5TDOB 3ZTDC 4CMMB 3II3A 1FVCB 2M1KA 1OT4A 3LNIA 5DMGC 3ZYJA 4Y1TA 4G8FA 3FU0A 1KG0A 3BUIA 4PJGB 1FL3A 1ORSA 5DD1H 1RP8A 3LEVH 3ABLB 3JTTA 1H19A 1OZTG 2RFXB 4PJ6A 4KKLD 5ISZE 1EAPB 4Z3HA 4L1DA 5FO8B 4YH6A 5FW6A 4U6XB 2DLHA 5LG1A 2YJLA 4ERSL 2A77H 5FV2A 4G3YH 1C5DA 3RA7H 1CBJA 4JGMA 2EDKA 2HLEB 5M95B 3D25B 3IU3A 1FJ1B 1HAUA 4AQ1C 2DQ6A 3W11C 4KGLA 4PS3A 2DI8A 4R4NC 4BH7A 3GPEA 1NBZA 4PJHA 4JFDA 4UT9H 1NMBH 4NUJB 5E9DA 3VNZA 1E3FA 1IVLA 3QYCA 4N1EA 1C5CH 3D2UB 5L9DL 2JIXA 3P73A 2W80C 1T6AA 2XIDA 1M1SA 5AKTA 3JV5A 2FZ3A 2XXMB 4OCNC 5EULV 4BA0A 4M7LH 3SBWA 4OQTH 1K85A 1R3KB 4PJCE 1D5XB 1NJ9A 4DEWA 1IJNA 1G7JB 4WU7A 1BW8A 1QEXA 1D6EB 2VRKA 2I9TB 3KW7A 1RK1B 3B2UC 5JQ6H 2P44B 1I4FA 4LQFH 5L2KD 2ZX8A 1KYOK 1YPZF 4NZRH 2R1WA 3LY6A 5TK4A 1K2DB 5C0BE 1T7VA 4X6BB 3VUAA 1DBKL 4L8SA 4CSTA 1A9BB 4HCIA 5AOMA 1TT6A 4LPVA 1IGFH 1USZA 1ZA6B 5DZ9A 5FYJE 4KMTH 3AY4A 1AJ7L 1MNUL 4YHKL 5E0QA 4TNVK 5E1GA 4LCWE 3O8XC 1R0AL 1PZBA 2XN9B 1AQHA 2ZOKB 1E2VA 1EHNA 2Z31D 2WD0A 4D7BA 4NCDA 2G75A 2A6KA 1IL1B 2BNQB 1SOXA 4JJHA 4M56A 4PV8A 5EBMB 5GGTH 2XJKA 3QUZD 3JV4B 1ZHLB 3QAZB 3QZWA 1I1YB 1P6AB 1LEIB 1QNAA 1HQRA 4POZC 2WN3A 1S7UB 1YEDA 2FX7L 2WXLA 4LPYA 2YD2A 3BIKA 1ETB1 4JLRB 3WFCH 2BSTB 3PL6C 2EC9U 4G42A 5IK3B 2O6FA 1A25A 5CSZB 3T71A 1RPQA 4ABUA 3BEWB 1NPJA 1O0VA 4MCYA 3WLWD 1JZJA 2WVUA 5D93B 4DP9X 4NO0A 4ZI8A 2UXGA 1T2JA 2E27H 4IBWA 5CD5D 1VA9A 2BHZA 2X2YA 1HSAA 3AWEA 4MD0A 4ZUTB 5IEKA 1CGSH 3CCHB 3W56A 4Y1SA 2RALA 1M53A 3JWNE 5DMKB 3SPHA 1IGIH 2QPSA 1MREH 3GDCA 4I9WE 4NN7C 4ODWA 4PSRA 1JNHA 2AJSL 3NABH 5C07B 1ILUA 5HI5D 1LEKB 1ZRUA 5CHNA 1XSIA 5I2IA 3CE1A 5IVOA 3NIGE 4FQCH 4JGUA 5D1XD 1I7UA 1D6VH 4J3XA 1AGFA 5IVXA 2YQBA 3TYFA 3ZDZE 3QZMA 2Q3AA 2AEPH 1BAGA 3HBZA 1AQDA 3WKQA 4P5TD 5E2UL 3L3IA 4YPJA 1X4XA 3Q13A 5T1KD 4K9EL 1FNSH 4KTDH 3KBPA 3DXAA 4NLHA 5D1ZA 4TNGA 5LB1A 1FA4A 1QN7A 4GRLB 3L6FA 2ED6A 4HQQH 5F3BA 3VI4A 5KG9B 2JHNA 5E0FA 4AJYV 2WVSA 1SXNA 4LDLB 4FX5A 5E08L 2X70B 1GSKA 2XZQH 3WN6A 5HHOB 1I8UA 2ZWSA 3KXFA 5F21B 2VRQA 3IKCA 4MNQB 3BQUC 4M4RA 4YLBA 1KBWA 3OLPA 2ICEC 2N7SA 2NYZA 2ZAHA 2YPLE 5C0CB 1S5IL 3CIQA 5F7NC 4E9WA 4HOMA 1DIZA 5DJCB 4ZUSA 2F7IA 4ATWA 1QFUL 1AACA 1XGPA 1ACXA 3E8UL 4ENED 1HKLL 4HJUA 2Y7NA 2ZE0A 1YECL 3QCUH 4G6AC 5F1IB 3TEUA 1KULA 4XC1L 4UYPA 5DEGA 5ICYB 4PJAA 3ZE2B 5HDQH 2A6JA 2ODHA 2MEJB 4JDVA 5CWSB 3ERXA 5GRJL 4DEPC 4I0PC 4ZUWA 2YO3A 4JN2A 1A6WL 4NFCA 1ZV5A 4XNMA 5KN5A 1BIIA 5C2BL 2PR9A 3MLXH 2ZXBA 2EXYD 4RIRA 2OSLB 3VXSD 1U8KA 5ILTH 4EAJA 1OE2A 1A4KA 4OJAA 5E2WL 5EOCJ 2WZPA 3W82A 1I8IB 2DDQL 2VR7A 3SDDD 3KPLB 4OZHE 4XR8C 1T6WA 1JF1B 3P4OA 4XRCB 4RNRB 5J6GA 4F9PA 2W65A 1EEYA 3EDFA 3NCXA 5A2FA 4DZBB 2X0UA 2PPFA 1MLCA 4PRAB 4PM1A 4ZNEE 4XOAA 3K8LA 3RL1A 4XH2A 5J7CC 3KPPA 4OJFH 1F4XH 2WTOA 5E7BA 1XF5B 5FGCE 4LCYA 5ITBH 4E9QA 4FHBD 3CN4A 1FUNA 4IBLT 1B4JH 1HHJB 1NKRA 4NC0B 5DD3L 5F3HA 3WI9A 2DJMA 2B39A 3FFCA 3WIFB 3MA9H 4OZFG 4YHYB 1JZ7A 4ATTA 4YR6A 5CCKH 4Z8FL 2ICWJ 3GC3A 4R0LB 15C8L 2VLRD 5I73C 2J2ZA 4TQHA 4JRXD 3KJ4B 2XLLA 4W9CC 2Z64C 3FT2B 3QB7C 4OT1H 5LXGL 4AL8H 3CPLB 2OL3A 2EICA 4E5XB 3AGVA 3FB8B 4TLUA 2E9GA 3I2CH 3QDMD 4IMKA 3R1GL 2KLTA 3ZKQD 4ICWA 1HK6A 1A4AA 2V4LA 3DDFA 1IRAY 1OOWA 5JDSB 2AP2A 4PR5A 4UT6A 2X9YA 3QDJD 2NSXA 1LDPH 1I3RA 1SJHA 4R6UA 3ZOAA 1YJDL 2JELH 4PWEA 4ZW6A 3PLYA 4AQAA 2CQVA 3FH8A 3V6ZB 2K7QA 2YMXL 4KQ3H 3H8NA 5K9JL 4YBQD 5AUMA 3WEXB 4DPRA 2FRGP 4Z0BH 5F44A 1D7FA 3X1FA 4RQQA 1G84A 3IDGA 3BP5B 3QRGL 1ID5I 3SKNA 1EGJL 3V4UL 5HHPA 3MBEB 5FM8A 3MRJA 1H3TA 2HMIC 1E2ZA 2ESVD 3N89A 2X1OA 5BUGA 5L8KB 2NOIA 3GNML 3L3HB 4EIUA 4HJIA 1DVFD 4PY8I 3C6LA 1N19A 1FSKC 5EC2B 5F96H 4W9DC 3S4SA 1CR9H 2V33A 4DGYH 5HPOA 1PY0A 4X50A 1ZSDA 2NY4D 3RWCB 4NQXA 1CI5A 4Z76A 3L95A 4NO5A 2YAHA 1MEXH 3TBVB 1QSFE 1MWAL 2AMUA 1F00I 3Q9QA 1FRGL 1E9PA 3B43A 3P0YL 3OMZA 4YHIA 4PYHA 3NFPB 2AVGA 3L16A 1T0NA 4UIKH 2F53A 4PGCB 4LAQH 4L1TA 5D4IA 3NCWA 2XQYK 2UZXA 4D9QE 4FQXC 1ZVHA 2Z6FA 4MQTB 2C3VB 4ODVH 2DYPB 3UBXB 4A6YA 1FO0A 1CICB 5DS8B 3NGBC 2WXPA 3TCTA 5D7IF 4APQD 1Z3GL 3ALXA 3C5JA 4XPTH 4BJUA 3TZVA 1IFHL 3AW5A 4JKPL 4H26B 1H3PH 5IBUB 4LPWA 4MBRA 2DM3A 2YA0A 2VABB 5GGUB 2FX9L 1P5VB 4LCCB 4N0YL 4DP0X 1KUMA 2A6IB 1UXSB 3EGSA 4PJ9B 2YKKA 1YEHL 1QNBA 4YIQA 4AMXA 5I1AA 5ALCH 4YHLH 4Z7UB 3CSFA 2E0PA 4JFHD 3GI9L 1A1MA 4QRRE 5EOQH 4RZCA 2QSVA 3RGHA 2R15A 3CLEL 2XV3A 4WW2B 3ASMA 3D39D 4J3WA 4K5MA 3S48A 2OZNA 1LE5A 2WO2B 3EW3B 5H94B 2VDLB 4K5LA 5D72L 3V4PA 4GAGH 5BXFB 3TCLA 1U58B 2O1AA 3H9SE 4L48A 4MXQD 4WO4A 3SJVD 5JXEC 1G7QA 3CVHB 5JMVD 1FNGA 1X6NA 5DZOA 1UYWH 4GIOA 4O00A 4Y2OB 1AO7A 2AJVL 1G1CA 4ZTPL 1DQDH 1F6AA 3V4LA 5F9OH 1JPTH 4DQOL 1FFPB 1ACYH 3H2PA 4B3EA 4HZLB 5IQOA 1YUHB 1L9SA 5TFSH 1J11A 2W0PA 1ZT1A 4H13C 4AC4A 5ITFB 3VVWA 1QN9A 3NJFA 2B59A 4IOFC 4PJGE 1D5BA 1UWEL 4YFEA 1BZOA 3C60D 1YAIA 1IKFH 3GSQA 2EC9T 1PCSA 1G6RA 4PP1D 2I5YL 1MJ7L 2QQLH 3T2NH 2D7TH 4NENA 4KJPD 1L0YA 2APFA 4KMQA 3CFTA 5DJDB 1YNTF 1A8ZA 4YN3A 1TJIH 2VXVH 5CN1A 3MNZA 2VDRL 2DWDA 7PAZA 4YL4A 3QS3A 4E0RB 1XGQA 1ZSHA 1ZLUK 4XP4H 5FYLH 2OQJA 3KR3H 3PDKA 2XX0A 4ZMVA 3BW9B 4O4YL 1MQ8A 1RJYB 2WOBA 4RMRA 1MW2A 5DVOA 5KSUB 5A3IC 2L7QA 4HIPA 5FKAB 4KK5D 5E7FA 4ESKA 4CL7A 1ZHBB 2YAFA 1VGKA 4JDEB 4QRSB 2ADGA 3D87B 1HN1A 4TPRL 1MRDL 3O6LH 1EJFA 4LSDA 1E65A 3CDZA 5T3ZE 5GQBA 3CZEA 1AZRA 3KLHD 4LZKA 2GG1A 2VJ8A 4R7DB 4JY4B 3ZKMC 2Y22A 3DV6A 4NT6A 4K5PA 4YE4H 4OLXL 2CO6B 2VITB 3VSTA 3ULVC 2EDQA 5C0BD 1QLFA 3QI9D 4PRPA 1W6WA 2BM3A 3EBIA 5E8NB 1ADQH 1UA7A 5KYXA 2OX5A 1IC4L 2Y25A 2GFBB 3EOBA 1AZBA 3EZ8A 3PS6A 4JFYB 5IW1B 3TO4A 3VXUA 4YX2H 3HNTH 5CP3A 1WA0X 2X3AA 4YGAB 4LCWD 5D1QA 1CFTB 4JB9H 5ID1B 1I9JH 1TPXC 3BVXA 4GP4B 5EO9B 1TBAB 2XN9E 4X6CB 3RIAK 3VD0A 1L9PA 4DN4L 4GAYB 5CXPA 4JFEA 3L9EA 4NQVA 1RV6X 1WZMA 1OP4A 3VX1A 4HHAA 5CZVH 4QOKD 3CMOL 5CJQH 4L37A 5B1JA 2YS4A 3VFNB 3GXDA 2PW1A 2A9NH 4L23A 2G4GA 1AE6H 2EZ0D 2X7LA 2KUTA 3BN3B 3LQAH 3UCQA 3QYMA 1J1PH 4R90L 5H37H 4FKHA 2QGEA 3DUUA 1S5HA 2FCBA 5AVRB 1XTMA 5JZ7C 2RACA 3L5WB 3MLSH 1JZFA 2P49B 3CVIH 3BGFC 4XOCA 2BPBA 1EMTL 2P42B 1MVUB 5HBBA 2QHLA 1NCDL 1PKQB 1Q9KA 3PWJA 4UOW1 4O02A 2HFEB 4LEOB 4JDTH 1P5GX 4PJIF 1HWGB 2X1PA 5HJGA 1KIPB 4KNSA 4WTXA 1HWWA 5EV7A 4I9WD 3GSRA 5T3XE 5LQBH 2O61B 5IFJB 4G6MH 1R46A 3MREB 2XN2A 1ZS8B 2P8MB 3N50A 4IEFB 4OKDA 3ESOA 4V33A 5C07E 1X6LA 2GTZA 1EJ6A 4FULA 4ALAL 4HVBA 2ERJC 4ONFL 1INEL 1LILA 2IBZX 5MEQB 2GY5A 2WGNB 5BZWA 5CUSL 4YSAA 4J3TA 1MCSA 3QXWA 1DJYA 2NY0C 5DJYA 3RYMA 3UTSD 2X6BA 1GGYA 3DSFH 4GINA 5CF3A 2WNXA 2K9UA 4MA7H 1TQTA 2CM5A 4KTGA 2XU9A 1YEGL 2VN5A 3IAPA 3HRZC 4QXTB 5K33A 3RTQB 4AZUA 3EYUH 4EALA 2VM4A 3UH8A 1XCWA 5DJ2A 4EI5A 3C8KB 4FFWD 4N8PA 2AQRA 5JHMA 1BZEA 1C7SA 4UTAA 1XR8A 2ZCHH 4GXUM 1CBVH 1L7IL 1ANUA 4GRWF 2W60B 3VXRD 1S7SA 5I8KL 4LLVA 2RH0A 1EO8H 1KIRA 3B3IA 3V6FA 5HGBA 5DRWB 1BJMA 2YAMA 3RPBA 1BYNA 3IFPA 4XP5L 3S37X 4CVXB 1RJCA 2DH3A 5HHOE 1RFDL 4MNQE 2J8OA 3Q2VA 3ZDYB 1L6XA 1YLBB 2A1WL 4X5WB 5DHVH 2MOQA 5C0CE 3VI3B 4Y16D 3PXJA 3A6CH 4M8UA 2Z7YA 5E00B 1ZE3H 3H7BA 3UBHA 4XN7A 1ZAGA 4AQEA 1NCHA 2BWDA 1CLCA 4XOBA 1KEML 4XVSH 2AQ2A 4PRNB 5E2TH 2DQTH 4P46B 1HVXA 4H44C 4X9HA 1KGUA 3HR5B 4UV4L 2P80A 1YY9D 2Q5BA 2PWFA 5ABZA 2P5WB 2K7PA 1JS4A 5BUPA 3BWAB 5AVUB 2FEJA 1IX2A 2G0KA 5EPMA 1UKSA 3WFZA 4ZFOL 1X4YA 2FL5A 3CZSA 3H9HA 1YEFH 1UXWB 3SPJA 3HCVB 2IAMA 4TM9A 5EIQA 2NXZC 2IDQA 4HUXB 1EHKB 1WAAF 3DI2B 5A7BA 2E4TA 3BGAA 1SN2A 1TQBC 5FO7A 3PDDA 1MJ8L 5IB5B 2DJSA 1UKTA 4OFQA 2JKWA 4HKBA 4XBEL 2RHEA 4LASH 3WXWL 5LGJB 1L5GA 3FQXB 1NIBA 4BGLA 1F4YL 2XNAB 1Z5YD 5KVFH 1PD1A 1U8CA 2X4NA 4K0OA 3LB6C 4N2OA 3ZMNA 3ELQA 4QYOA 4ELMA 4Y5VA 1UZ6F 5G2NA 2KI6A 6FABH 4U1MB 2FVNA 5I0WA 1JNLL 3EHBD 5G5DB 4ABQA 3QS2A 4DP4X 3WD5H 2F19H 3HI6H 3DNKA 5I28A 4KROC 2IPUG 1YO4A 3QEGL 1T0MA 4YDLC 1NC2A 1WWWX 4MGXA 2WTPA 4D0DA 1J8SA 2OSYA 1CG9A 1AFVL 2J44A 3ARGB 5KSAC 4HHWA 4FLSA 2OMZB 2QR1A 1K35A 4UMGA 4A7TA 5JPMC 5CMAB 1UURA 5IB4A 2ATPB 3MV7B 1LWWA 4IBTA 3AM8C 4WFED 3AMLA 1LVEA 2F5BL 3QNZA 5JORA 4Y2LA 3WIIH 3P69A 1OQXA 4Z7NB 3UDWA 2WY3B 4QI3A 4P23C 1R3LB 1WUZA 2BNRA 1ZPLA 5DK3A 3TA3D 1SLUA 5HHMD 4WQOA 3TH4T 1KTCA 3ML9A 3FFOA 1DVYA 1WBYA 3ZE1F 5SWSD 4CKQA 4HUWA 4G8FB 3V9CA 4B53A 1KG0B 1FL3B 4Y4FA 1ORSB 3AAZA 3ZZ1A 2AI0L 2F1AA 2ADFH 2AZAA 2WLZA 1LP9F 3JTTB 4OSUH 5KYYA 3GIZL 4YHZH 1JPGA 5J6HA 3NPSB 1ITBB 1MFEL 1RSYA 2WXMA 4RDQF 1C5DB 1J18A 1OKEA 4XP1H 3SOBL 2H3XC 3HE7C 2HJKA 4JO2H 2YA3A 3H54A 1MRCH 4WENB 1F1AA 4TUKH 1EEQA 3ESNA 3IU3B 4OCWL 4Z78A 3L17A 1BG9A 1A6AA 4BH7B 3FHEA 4FXKC 1NBZB 1NBYA 1PX8A 1FZKA 4PJ8C 1F13A 4PJHB 1MCPH 2EYTA 4BK5C 3OLDA 5E9DB 8CGTA 3FN0H 3Q0HA 3GBEA 4IIZA 3HJ0A 3O81A 5I1HL 3A22A 3WIHH 1QSFD 2Q7YA 1UKQA 3IMWA 1CFSA 1I75A 2QVKA 5J12B 2JIXB 3F58H 3P73B 3MFFA 4LBEA 2FZ3B 1UWXH 4TVPE 1JYNA 4X5RA 1WCBA 2C26A 3VRLF 1NJ9B 1NCCH 4M5TA 1DE4A 4WU7B 2NX5E 4HGMA 5E95B 4XMVA 1RHFA 3K6OA 2MJWA 5HDBB 4DTGH 5KTEH 3GZQA 3QRLA 5B8CC 3HC4H 1GGUA 3GBLA 3TIDA 4AGPA 1I4FB 5IBTH 4X5XA 4KO9A 3RFZC 2R1WB 4AGOA 3KWXA 4N2BA 5JW4N 2BC4A 2WZ0A 4QNPE 2HRGA 4JZOA 2YSSA 4L8SB 2H9GA 1MCFA 5E6ID 2JJTA 3MJ8A 1MRFH 5AW5B 2J7LA 4JQIH 2QGBA 1TYRA 3VRIA 2HLFD 4ZW5A 4KRMB 5HYFA 3ULUD 3TDHA 5HHQA 3BKCH 2E46A 2HKHL 3FN9A 3NZSA 5B39A 3QZNA 5BV7B 2A6KB 1FV1B 2VSCA 3LKPA 3NFSL 4PV8B 4Z7UE 3ZKXB 4K4KA 5I23A 4KU1A 3QC6X 3QZWB 3L1OL 5KVGH 2FGTA 1HQRB 2BVYA 1YEDB 3BIKB 5FPIA 4NPKA 4OD2A 3TL5A 4G42B 4L5FH 4HJJH 1BFOA 3FQYA 2HTKC 3D69A 3RJOA 5HVHC 3IDJA 4MCYB 4MSWA 4Y2NA 1WF5A 3IRZA 4M6MH 5TPWL 4WWKA 1P6WA 1O5DT 3KLDA 3QJUB 3WHXA 3S34L 5DFVD 5JUEH 3CN1A 2D0BA 5HYSG 4R4FH 3VG0H 3EDEA 4NO0B 3QNFA 3FT4A 3MN8A 2XHNA 1CF8H 4HBCL 3WFEL 4MD0B 1HSAB 1ZIBA 5IEKB 5EOTA 4DQAA 4H8HA 1RZJH 2H1LM 2ZSVA 3BUDA 1KEGH 3NZUA 4KZCA 3HR6A 1HHKA 4ODWB 3OB0H 4ZMQA 1JNHB 3QUMA 1JI1A 3DX3A 5CHNB 4E9VA 5I2IB 1QUNA 2VW7A 3I6LE 2ODIA 2IMMA 3L3KA 3N55A 1I7UB 3TJPA 4YE0A 2O6PA 3JYBA 1AGFB 5IVXB 1OD7A 4GBXA 3D9AL 4MRBA 5FCUL 3UTPE 4ANXA 4ZTOL 3ARVA 1CFQA 2OZ4L 2I24N 1ZLSL 5D7LD 1L4IA 1AQDB 2FATH 2B9BA 3V0WL 1TTCA 2VMJA 4AE1A 3L3IB 5I6KA 4LHQB 1X9UA 5ADPH 3DXAB 2V92A 5D1ZB 3MRGA 1AR1C 1FVDA 4N26A 4HUUA 3L6FB 4NNXA 3OSTA 2FH6A 3VI4B 3JVGA 5F3BB 3ULVF 3MRBA 4F7TA 1P84K 3GQFA 1DSYA 3IXAA 3NA9H 3MSPA 4JFWA 1H8LA 4NQTA 4QXGL 2YPVA 3ARBD 3D4GA 5F7BA 3SO3B 4B9JA 2HJLA 1SPDA 3KXFB 4QHKI 3IKCB 3GXNA 2AJXH 2OFQA 4M4RB 1PNDA 4WCYL 1LXMA 2C9XA 5I1KH 3Q3GA 3ATDA 4N6QA 2KDYA 5EB9A 4ZUSB 2QKIC 4I48A 1ZY9A 2NTSP 1HE7A 1BYOA 1XGPB 2DWYA 5DD1L 3LEVL 1WZ1H 5ID0A 4GI9A 4RGOH 5DEGB 4X6CE 3RVWD 3EBAA 3GBMH 2A77L 4PJAB 2A6JB 4G3YL 3RA7L 1T5XA 4JDVB 5I8OL 1HH6A 1WLHA 3DVIA 4ZUWB 1YJDC 4JN2B 2XICA 2DBLH 2E86A 2NY1C 2WQRA 1QLEH 3DK2A 4XNMB 1BIIB 2ZXQA 3TBWA 3UL4A 4GW1A 5KN5B 3CVCA 4QRUA 4RIRB 5HGGS 1U8KB 3BZ4A 4UT9L 1NMBL 1A4KB 3RWIA 5D6DC 1NSNH 4UQDA 3P4OB 5DD5H 5J6GB 1C5CL 2W65B 1EEYB 3ILEA 3ECBA 1N2RA 2Z91A 1MLCB 4XO9A 5SWZA 1D7BA 2F74A 1PKQE 3NSCA 5E2JA 4TNVF 5AAPA 4M7LL 1CXIA 4MZ3A 4JM2A 4OQTL 4XH2B 3RL1B 4S0SD 3KPPB 1W0WA 4TTGA 2E7CA 3BAYA 3ZKND 4K5NA 1Z9MA 4LCYB 2LLNA 2QBWA 5JQ6L 4CJ0A 4HCGA 1UT1A 1FNEA 5F3HB 1MCKA 2PYED 4LQFL 3C6SA 3FFCB 3PDGA 3PHSA 5JQIB 4NZRL 1OZUA 3RZCA 1FG9C 4YR6B 1O9VA 3MZGB 4LLUA 2J2ZB 3CD4A 1IGFL 2XZAH 4KMTL 2A9BA 2OL3B 1ZLWK 5BRPA 4QRPA 5E1AA 3MOBH 5CJBA 1JZ5A 3Q06A 5GGTL 4KKAC 4GRLD 2JE8A 2J57A 4NOBA 3WFCL 1OM9A 4PR5B 3VM7A 2MNUA 4M00A 5DUMH 4BKTC 5GRWA 3WE6A 1LGVA 4POYA 1I3RB 1JZIA 1SJHB 2F8OA 4X9BA 4HWNA 4HMCA 3FQRA 3AVEA 5FA3A 2GBVA 2PWEA 3IPFA 4AQAB 3HG2A 3HAEA 2EIDA 2PPAA 5AUMB 5C0CD 4L9LA 3ZDYE 5I8CA 3CWUA 2YA1A 1VPOH 2E27L 5JOEA 5HPMA 4RQQB 4BJLA 3CPUA 3IDGB 4JO1H 3VFRA 4XNZC 3GRGA 3ROOA 1CGSL 4YHOH 3RURA 2O26U 1RLWA 2B5IB 3S88H 3SKNB 1J1XH 3O4OC 5HHPB 4EZJA 3OAYH 3FQUA 3IYLW 5J1TC 4NBYB 3MRJB 3II2A 4JDZA 4IJTA 2E3VA 1IGIL 1MREL 2VXQH 3C6LB 4HIXH 3NABL 3S4SB 4BA8A 4PRIE 1GL4B 5C0AD 3D07A 2P5WE 2YAOA 1ZSDB 3OSMA 4NQXB 3RIKA 5A43C 4Z76B 1M6UA 3L95B 4FQCL 4NO5B 3I74A 2G5UA 2QPFA 1D5IH 4FQ2H 1D6VL 5JOPD 2BY3A 2ZCKH 1E9PB 4YHIB 4Z9KB 1DZ0A 4FNQA 4BFRA 5AB2A 3H2QA 3D6GA 2AEPL 4TVSa 2XT1B 2JJWA 4ZW3A 5CFAA 5C8JA 1ET7A 1T0NB 2F53B 3KPRA 4KHTH 4LLQA 2O5YH 1U3HC 1FNSL 4NXKA 4F92B 2UZXB 4KTDL 1E5AA 5ETUA 3AXIA 3UFIA 1ASPA 4LDCA 1LWYA 5HDOA 4HQQL 4A6YB 1FO0B 5DEFA 2BDNH 3BQVA 4ZPVA 2J3SA 5D7IA 3DHPA 3C5JB 2B08A 4L3AA 3TZVB 3UIYA 1UWFA 1CK0H 3B9EA 2NR6A 1OCCB 2DWEA 4XNBA 2XZQL 1K4CA 3BZEA 4QTIH 3GRWH 2ZX5A 1U0QA 3V9FA 2LAGB 3FMGH 1MY7A 2EDDA 2C8NA 4YIQB 5I1AB 5G4MA 2VO5A 5CR8A 4TMPA 4E9XA 4RX4A 3EJRA 3BCDA 4FZEH 3RWJA 3GDBA 1A1MB 2HVJA 4RZCB 2XWTA 1MHEA 4KO7A 3EO1A 3QCUL 4PJBF 1KWGA 2J88H 4Y2DC 2E4FA 1ZTXE 4MA1C 1LE5B 3MV7E 3VDBA 4FLOA 5HDQL 3V4PB 2X3BA 2VR8A 3TCLB 4WO4B 3WOVA 1G7QB 3EIFA 4F57H 4Z7NE 1SLVA 1E67A 3PWNA 1FNGB 3LHAA 1HL4A 4M7ZB 2IO5A 1AO7B 4LPXA 1F6AB 3MLXL 1OWWA 2GJZA 3AS2A 5ILTL 3H3PH 3DHMA 3PP4H 3GINA 3KL0A 1ZT1B 2B59B 4URKA 2X40A 4HUNB 4U6VH 1D5BB 2EEFA 3AQXA 2VQUA 1VGEH 3DSNA 2PYFA 3HC3H 3NP4A 4AQ1A 3GSQB 5CJXC 2MPVA 2PMZA 3N04A 4MNHA 1G6RB 1YYMH 2YUXA 3ILQC 4MS8C 4XNUH 3HS0A 3MFGB 2H2SD 4NENB 3HUJF 3NZHH 1YNTA 4WI4A 3UBFA 1F4XL 1R6VA 3LDBC 2DWDB 3MNZB 3MXWH 4GAAA 4WHTA 4ZPTA 2ZXWB 3W2DH 4JZNA 5ITBL 2OQJB 5DVMA 4G2AA 4WWNA 1B4JL 1VFOA 1NANI 2FNBA 1IM9A 2IADA 2R9HD 2ZXGA 3QFGA 4MDIA 3TTSA 3MKGA 1CYXA 2A7BA 2C9QA 4FFYH 4YSDA 4N28A 4YZFF 3MA9L 5E9DE 1U8OA 2VDKH 5CCKL 2IPKA 5F3FA 2MWCA 1T20A 1VGKB 2ADGB 1EK3A 5FAAA 3CSTA 3T65A 5FECA 5EMYA 4C56D 3CDZB 4EJ1C 2ZQKA 4OT1L 4AVHA 2A9CA 3MU3A 4AL8L 4G83A 2MOGA 3SDCB 2NOHA 2Y3AA 1Q1JH 3FH5A 3COOA 3BH8A 1QWNA 2OMYA 3DV6B 3I2CL 4O2FA 2NX5D 4BQBA 4NT6B 3LKNA 2AK4A 3BFQG 4W1TA 3ESVF 5DSCA 4HIEA 5C08A 1KFAH 3U0TA 3VCLA 5HDBE 4WI8A 1TZOA 2DICA 1MCEA 1YMMA 4HKXA 4XTRD 3QXUA 2YOAA 5DQ9A 1UEYA 1QLFB 4PRPB 1EH9A 3OX8A 5KYXB 1MWOA 1LDPL 2OX5B 3BYTA 4WEUD 5FOBA 3L7EA 3EOBB 3VXUB 2GI0A 4HAKA 3WEBA 3TO4B 2NOBA 3GM0A 5DD0H 5F93C 4ORZC 5D1QB 3H4HA 4JR9H 4XPGH 2AJUH 1I1RA 4KQ3L 1XCTA 1QW9A 4U1GC 4Z0BL 1OM3H 4LCIH 4DIXA 4XCEA 1M9WA 4JFEB 3IFOA 4NQVB 3AACA 2WUCH 4Z3FA 4HHAB 4L37B 2PW1B 4AGNA 4P4KA 3GSVA 3FYEB 5FR3A 2X7LB 2X2JA 2JWYA 3ZHLA 4GSUA 5F96L 1CR9L 1WE5A 1S5HB 2MHAA 3DUUB 4DGYL 5J13C 3D4VA 1YNLL 3D0VA 1MEXL 2C3HA 3R8QA 1YQRA 1QI3A 3OZKA 1Q9KB 3PWJB 4L29A 5DEZA 2X6UA 1ZV2A 4O02B 4PJIA 3ATAA 1WSST 3SKOA 1T7XA 4UIKL 4LAQL 3NCEB 4AE0A 1WT5A 3GSRB 3RFRA 4WAFA 1U3JA 3UBXI 5I74C 2XN0A 4ODVL 5F89A 4AQZA 2AZUA 1AZVA 1TJHH 2GTZB 2Q2LA 5LCVA 4XPTL 4Y89A 2Y8QA 2H26A 2VZTA 4KUCF 1H3PL 3WDHA 3M8OH 5BZWB 2XSKA 4ZFFA 3UTPD 1NKOA 5DJYB 5B1BB 5IVXE 2AXGA 4DSYA 2WZ5A 3PJLA 1UD6A 4BEIA 3FO1A 3V4VA 3H9ZA 4NKMA 5ALCL 4YHLL 5CZKA 4X6DF 5DJ2B 4EI5B 3JWNC 3QDGA 5BJTA 3OGOE 4UAOB 5EOQL 3M46A 3Q05A 2JMRA 1T2XA 2OK0H 1CIDA 2NY6B 1XR8B 2AQQA 1R47A 2EXWC 2DBJA 2FJGA 4MD4A 4NZUH 3VI4E 1VKLA 1YEEH 2B0SH 1S7SB 2W81C 3CFKA 3FHQA 4LLVB 1KIRB 3B3IB 5HGBB 3V6FB 4GAGL 1CB4A 3IFPB 1OGAA 4LB8A 4NDMA 4AEHH 1WTGT 2C3GA 3KXFE 5KYUA 1UYWL 1BZQK 1DQDL 2ZKWA 3KHQA 3IK2A 3MMEA 5F9OL 1JPTL 3IWVA 5F9WB 5IY5B 1ACYL 3H7BB 1SXAA 3U4KA 1Q94A 5TFSL 3W1ZA 4AQEB 3DC0A 3APDA 5EA0H 4HIQA 4JKNA 1QQDA 3D18A 4JREB 4M5ZL 1VOLB 4MMXC 1IKFL 3LXCA 4CC1A 3LPFA 2QQLL 3T2NL 2D7TL 3TNMA 5K59F 4PJAE 4HALA 1TJIL 2VXVL 3SHSA 2J1YA 3QZPA 5H37G 4LF3A 4NNPH 4XP4L 5EPMB 5FYLL 3KR3L 3KPSA 5GGVY 2BY2A 2FL5B 3GMQA 4YDIH 3H9HB 1CGUA 1BSIA 2IAMB 3AABA 4GRMA 2FQGA 1TVHA 2WC7A 5AVWB 2JI1A 1UASA 2EE0A 4JZJA 1QZNA 2VW4A 4MAYC 3JWOH 5FO7B 1A1OA 3NQIA 4HKBB 3MKKA 3O6LL 3QFJD 4IKLA 3RHWK 1L5GB 3ZVVA 1QRNA 5I24A 3C5SA 1A2YA 1H3UA 1U8CB 1FFNA 2X4NB 1JMZA 1IO4C 3RIAF 1EFQA 2YARA 4TPSA 2XFGB 4ELMB 5K5YA 3B9KA 4QYOB 4Y5VB 4FD0A 1PEWA 4LRNH 4GT0A 4Z7VF 4AUYA 1PD0A 3U4AA 4YE4L 2QEJA 3U4EA 3E38A 1T0MB 1UXLA 2AAVA 2Z8UA 3FFCE 1NC2B 2QV4A 5IVNA 1QO3B 1ADQL 4YBHA 1IV8A 3HE6C 4D0DB 1CG9B 4YX2L 3HNTL 4KVCH 3L08A 2V5MA 1H8OA 1A7NH 1DQTA 4KO6A 4JB9L 2FH8A 4G71B 1I9JL 5T8IA 2DJUA 3UX9B 4IBVA 4OLWH 2J6EA 3RTQD 5IB4B 2EDYA 1KPRA 4M62L 4UDTA 1IMHC 4XVTH 2QSTA 3MCKA 4PS7A 3QNZB 5JORB 4HV8A 4DO6A 2KZ1B 3ZN6A 3MJ9A 2GYSA 3PAUA 1FWXA 1MZZA 1OGTA 1UB6A 4M1DH 2KS0A 5CJQL 3GGWA 2BNRB 2EO7A 1YHPA 2A9NL 3IJ7A 2P26A 4G8AC 1AE6L 1PVHA 3LQAL 1OTUD 1ZLEA 4B9PA 1WBYB 1J1PL 5CZXD 2EE6A 1CGTA 3LH9A 1W2KT 4HUWB 4BFBD 3FT0A 1CZ8L 1OTSC 4Y4FB 2RMNA 3MLSL 1OP3K 2NY7H 3AAZB 3LZOA 3CVIL 4F58H 5K69A 4R7LA 5KYYB 5GRYA 1JPGB 5J6HB 2EIMB 4G6FB 1OO2A 3IBOA 4KJWD 1KYUA 5DC2A 3ZE0F 1AXSA 2CR0A 4JDTL 2JF1A 3MX0A 1PDKA 3CFCH 1V3LA 2EILB 1E2WA 1C1EH 3TH3T 2HJKB 1KLGA 2DI9A 1UATA 2G30A 4GKLA 4I18C 1NINA 3UJJH 3WNNA 5IHLB 4N4YB 1KCSH 4Z78B 5LQBL 4PY5A 2CSPA 5J1SC 3X17A 1A6AB 1NGQH 4P07A 4G6ML 2VZ1A 1NBYB 1FZKB 4PRID 3KLLA 2EYTB 2CA4A 5HD8D 4K15A 3IAGC 4R3SA 2C3XA 3OG6B 1DBBH 1IGMH 3QUYC 3T1WA 2W0KA 2Q7YB 2J55A 3HMXA 4R97C 4W9EC 3KEDA 4AW7A 3MFFB 4LBEB 1JK8A 1NUDA 3DSFL 4LOUD 4MA7L 3O0LA 2YGOA 1WCBB 2XRAH 3EYUL 2F53E 1N5AA 1DE4B 4L8DA 1IGCH 3BOVA 1F97A 3EYOA 2MTAA 1KXTA 3TIDB 2RJMA 1A4JA 2ZCHL 1LWHA 4X5XB 1CBVL 2VWEC 3ET9F 1NMCB 4XXCA 2BC4B 3KH3A 1DQVA 4JZOB 2IOIA 1EO8L 4EJYA 5ESVA 2YSSB 2DS4A 2H9GB 1U3YA 4Z7OB 2XTJD 4DFIA 3MJ8B 1XBRA 1CUOA 2PO6C 3DJ9A 4O51A 2G2NA 3VRIB 3AT0A 4IM8A 2EUVA 5HHQB 1R1CA 3IB4A 4HJ0D 2HJFA 3A6CL 3LKPB 4Q14A 3EGDA 3HKFA 1FFOA 3ARGD 3KTUA 2TRHA 4XVSL 2QSQA 3RWDA 1PAMA 5E2TL 2VDOH 2DQTL 1R3JA 3B2DC 3ZGHA 4OD2B 4D94A 3SKMA 3VFVA 3H85A 1BFOB 2WSDA 3N1GC 3NVQA 4GKNA 4GO9A 2CHD<