3HS9A

Intersectin 1-peptide-ap2 beta ear complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords AP-2 complex subunit beta-1
publication title Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 52
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hs9A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3hs9A02
1NGMA 1TBPA 1QTPA 4WZSD 4ROEB 1QN6A 5IYBP 1MP9A 1VTLE 2G30A 1YTFA 1QTSA 2D0AA 1QN5A 3H1ZA 1NH2A 1KYUA 4RODB 1C9BB 1NVPA 1VOLB 1PCZA 1AISA 1QN8A 4B0AA 1W80A 1QN4A 1CDWA 3VN5A 2D0BA 4ROCB 1KYFA 1YTBA 2IV9A 1VTOA 1RM1A 1QN9A 1QNCA 1TGHA 1B9KA 1KY7A 1QNBA 1R4XA 4PY5A 1TBAB 5IYDP 1KYDA 3OCIA 1D3UA 3EIKA 1VOKA 1QN3A 1PZDA 1JFIC 2VJ0A 1E42A 1KY6A 2D0CA 3OC3C 3ASMA 1QNEA 2MJ7A 1QN7A 2IV8A 3HS9A 3HS8A 5IYCP 1QNAA 2Z8UA
chains in the Genus database with same CATH superfamily
3INOA 4P23C 2Y2WA 5E8DL 5F1NA 3RJDA 1XCTB 1GY2A 4EN2A 2P49B 5MEQB 2HG5A 1LP9A 4FQ1L 4WWKC 1KLGA 3WE1A 1QZ1A 1U95B 1TQBC 5LBVA 3BUDA 3C60A 1CGXA 4UNUA 5JHDA 4MMXB 4QY8A 1AR1B 3TEXA 1ZWIB 4JPWH 3PWLA 3WCYA 4L0YA 5HVHB 2AABL 5DUPL 3KRMA 1QSED 4NKQB 5HHPB 2ROYA 3HMXA 4FLRA 1UUNA 3OKMA 1S3KL 3BVTA 1KDIA 3K4AA 2XQYG 3CFBA 1COBA 2ZUQC 1W72H 1SXBA 1UTDA 1FFPB 3DSFL 5T3XH 5C0BA 1T66C 1ECZA 1ML0A 3KPSB 5CGYC 1YMMB 2X4PB 3N42F 4JRXB 5AAPA 1HCZA 5F3HB 3PP3K 4X6CA 4QEGA 5E00B 3V4PL 3BDBA 2HMID 5F0PB 1WBXA 4FNLL 4PLKD 3CLWA 5HHVL 4N0UE 3UTQA 1QKZL 3QIWA 3S36X 5L88H 3RVTD 4JHWH 4P4KA 4RESB 2GITB 3AU1A 3NN8B 2BIOA 4FGMA 1FZMA 4OZHF 3NJKA 3UC0H 1YEGL 3D87B 2WLLA 1JPEA 2HX9A 4E68A 4FYQA 1R3LB 3IT8D 2J44A 3BGFB 2FGWH 5ACZA 3BP4B 4Z1PA 1OW0A 5B39G 3N1QC 2PO6B 1PZAA 1D9KD 1SY6H 3AB0C 4F7CA 2BSED 1DANT 1KIQA 2VCOA 3D85A 1ASOA 1JZHA 1TTRA 4PB0H 5CMAB 3BN9C 3BUIA 1YQLA 3ZRCC 2NY2C 3MQIA 4PJAF 1AXIB 1MF2L 2YWZA 2V4LA 4RSYA 1FORL 1T0OA 4K73A 4G80A 3HHSB 2VC2L 3DHJA 4JM2C 3D39D 3QXTA 5D93B 2NNAA 1QPKA 2AXGB 1RUQH 2V8QA 1AE6H 4HBCH 2AQ2A 1LEKA 5EO0A 3EO9L 1JL8A 1P4LB 5FEBA 3WEAA 1SXSA 5BMNA 1IGML 3B83A 4ADJA 1IL1B 1BZQK 3O6MH 4WEUD 2PWWA 3IDMA 5F7EH 3L9RA 3K0YA 4UAOB 5AALA 1D5MB 3VD1A 3QAZC 1VENA 2O5YL 2H0PA 2VLJD 4EDXB 3PE9A 3D0VA 4UDTA 4HWBA 2LAAA 5E4AA 2FH6A 2IPKB 2PXYB 3UO1L 3GSRA 4CGUB 4Q89A 4E41E 3OR7B 1EEZA 2XCMC 1MUJB 2VDPH 3ARYA 3HS9A 1P2CB 2P8PB 3QEQE 1J5HA 2Y22A 4BFRA 3SE3C 1AKJB 7CGTA 5I8KH 4WFGD 1AC6A 1CLZL 1SY6A 2J8UE 1I1AD 3KR3H 2M1KA 3KVQA 3QZMA 2C3WA 5HGHB 1HN1A 3PHQB 4N2BA 3FQNA 4HZLB 1C9BB 1T5XB 3F0ZA 5ID1B 4I9WD 4R2GD 2ZUYA 4OGYL 2GSIB 4LKCB 4NJ9H 1QNCA 4HC1A 2DOCA 1C16A 1H8OA 2N7SA 5CJXA 4GXUN 2NOHA 1BCIA 1M6UA 1CYGA 5JIHA 3F00A 1UXSB 2L8AA 3GSQA 4XCEA 1BFOB 2H45A 4P23A 4N0FA 5IM7A 1N59A 1AGEB 5D9SA 1JFHA 2J43A 3W1ZA 5I9QB 3TCXA 4FZEL 4OGZA 2XQYA 4WWKA 4L48A 5SX4H 2XTJD 4DIXA 3OPUA 3T65B 3K8KA 2Y06H 2DQHL 3H9SE 5EPMA 5FYJL 5IBLC 5KSVA 3D0LA 2NX5E 4K2UH 4OQTA 4E5XG 5C3IA 4H8UA 5AL0A 4DN3H 1H0DB 1DJGA 3VVWA 4HH8A 2NY4B 4X6FA 3CZLA 5BXFA 1L9PA 2B59A 1AGBB 4AQ1C 4HQQH 4TUJB 5FC9A 2OJEB 2VXVL 4QRRA 4HCRA 5C7XL 3D12B 3CVSA 5T5FA 3NT0A 5E6IB 1I9IH 1QO3A 1QHOA 5E9DB 1T0MA 5AKRA 1JOIA 1C5DB 2KC0A 4OSUL 3RJQB 5B39A 1ZPUA 2ADIB 1E6OH 4PJDA 1WZAA 4WWID 2RB8A 1F90H 4IYKA 3L54A 3LB6C 4B0MB 2LV4A 4KPHH 3FB6A 5HGAB 1DEEA 3PXJA 3ZKMC 2OAAA 5I16A 1ZSDA 2W0KA 2JK5A 4JPVL 5H2BB 3K91A 2V9TA 3TFBA 1DVFD 3RWEB 2PR9A 1O9WA 1TTFA 4KHXL 4ANWA 3DBXA 1DE4B 2P5WD 5DLMH 4BFJA 4J4PD 4HF5L 2YO3A 3VH8G 1IT9L 2KMWA 3ZZQA 4XZUA 3RILA 1SVZA 2BS9A 5BV7L 4PJFE 1TTCA 2WKOA 5J6HA 1NIAA 4FFYL 1V7NH 3AREA 3CV5A 5IR1B 2OSYA 5AUMA 1LM8V 4J3XA 5HHOA 4OIAA 2KT6A 4OCRL 2PP9A 4PJ5A 2IXQA 2VRAA 2OLDA 3ENOC 3G6DH 5DC4B 2XY1A 2H2PD 5HPOA 2AJXL 2EILB 3MCLH 4L3EA 4NQED 1ZT1A 3Q9QA 4HUXB 2APBA 4JM2A 4MRCA 5GS0D 3EH4B 3VXRE 2O61B 3QI9C 2CNYA 1JNJA 4M3KB 1UWFA 4TNGA 4AJVA 2OTWA 4YSTA 5DGRA 4FXGB 4P5TD 1U3HC 1AO7E 4V1DD 5JHLA 3WFEH 3QJOA 4OLYH 2TSBA 3D1MC 4F33B 5L2JB 4YO0A 1A1MA 4APQD 5CXPA 1U0QA 4YGAB 3B7TA 4G8FB 3TOPA 5HGBA 3UX9B 1TO5A 2B0SH 1I7TA 2F18A 1VJSA 2NOBA 3DOSB 3FNKA 2BNRA 5C0IA 3PWJA 5IB5A 2PPCA 2NDGA 2DMHA 1PNCA 4CN4A 3SE3A 1GHFL 2K78A 4HXBH 4E9RA 1KGCD 2OV0A 3Q5OA 2JIXA 4C56A 2WNXA 2QKIC 4EIGB 4Z3GA 5KYWA 4UQEA 3ARGC 3UPCA 1Y6NR 1A4JB 1KLGB 1NICA 4FL4B 3VWJC 4ODXA 3BKQX 1F3JA 1X4ZA 5D7JD 3NCWA 5JHDB 3BH9B 2C9RA 4BUHA 1OK0A 2BK8A 5IJDC 4PW4A 2B77A 2VGLM 3HE7B 3OQ3B 4E5XA 3WE6A 4ZMZA 4PJXE 4QF1B 1JV2A 2RBLA 2WYZA 4OZIB 3C8HA 3N55A 1FNSH 3REWA 3WHE1 3DX8B 2DM7A 4F27A 1AZUA 2X1WL 2QQLH 3LQAC 1KULA 1T1WA 3TEWA 1C12A 1E27A 3CFBB 5L2KB 5AVQB 1KENH 2H26A 2P48B 1KF9B 3S3BB 3EGDA 2RCSL 3B34A 2ROXA 1BEYH 3VRIA 4AL8C 5EBMA 2QPUA 5F97E 3BDXA 2DWYA 3QYCA 3TT3L 3FT1A 4JKWA 4IMLA 3FH7A 4M8RA 4ORZC 4AQ1A 5E7FA 2MNUA 1WBXB 3LX9A 4TNWF 3ZK0A 5I1HH 3QIWB 1I8IA 4YFLI 4P4KB 1RU9H 3AU1B 4I0KA 2EDXA 4P46B 1V55B 1XB6A 2VM3A 2HVKB 1X5MA 2PPAA 1U21A 1NBZA 5F88A 2Y07H 4GINA 1H6EA 1NDGA 2WNGA 3GZKA 4NUQA 3VH8A 3UBXB 2N56A 2OCFD 3UTSA 4XP1L 1V05A 3ILQD 4LOUC 1JG9A 1MJ8L 3FHAA 2ZPKH 3D18A 4W9GC 1PSKL 4X4XA 3VFRA 4W9EC 4JRLA 4WI0B 4WFEE 4KZEH 2HZHA 5KJ4A 2JKIS 1HL9A 2GIMA 3VFMB 2CIIA 4IHBA 4GRWH 4FZ8L 3HNVL 5CCJA 3MX0A 2IH3B 1UOKA 4TTGA 4G80B 2QGDA 3ULUL 1C47A 3MRHA 2NNAB 4Y4HD 5BMPA 3BKCL 4DEWA 4K9EC 3C5ZC 3O2DA 1N18A 5BW7C 5DVKA 2RH0A 1YQRA 4FTVA 2F53A 1ONQA 1UASA 4N2HA 4OFQA 3B2UC 1LO3H 3R18A 2WD0A 4OZHE 1GGBH 3AY2A 4MMZA 1TIUA 1BJ1H 4G8EA 5HVWA 1FZJA 3VFNA 2EIBA 2FWLB 3IDMB 1P5VA 4TQEL 1C08A 3QI9A 1PJ9A 2VAJA 4WUUA 2XUWA 2WNKA 3D0VB 3VO0A 1NQBA 1J1XH 3BPCA 4IRZA 1CJYA 2QV4A 3GSRB 4EN3D 1IM9B 5TPWL 1U3HA 2RJMA 3LQAH 3LPPA 3VXMB 3OF6A 1VA9A 4QWWC 2ADGB 2J6EL 3D25A 4PJAE 1FG2B 1T7ZA 4I48A 5ESAA 1JRHL 3KM1A 1PEWA 3RE0A 2XACC 3TBYA 2OTUB 5CBAA 3NJHA 3KPNA 5F70A 4BZ1L 3FQNB 3OX8A 3JBG7 4C4KT 3EO1A 3CSGA 2OMUA 2K6ZA 2XRAL 1I8UA 1YEEL 1FF5A 1L9SA 4J7RA 3ELQA 1KC5H 1R5IB 2W60B 1DQVA 3M07A 3RNQA 4PW3A 3CH8A 1PS3A 2WPGA 5DEFB 1S9YB 1IAKB 1ZSHA 1PNDA 3GSQB 3IE4A 3IFOA 3PDOB 4KTGA 4AYFB 2GJPA 3L9BA 1MJUL 3OHXC 2DQUL 2NXZC 2PCPB 4G6ML 5AOZA 3TEYA 4X7FC 5D9SB 3DOHA 4IBSA 3HN3A 4LVOC 4U3SA 3ARGA 2ICWB 3C5XA 5IQLA 5IF0A 2G3NA 5J9PA 1R47A 3VWJA 3BAEH 4ODVH 1DO5A 1TQBB 1SN5A 1FIGH 2FX7L 3FUDA 4UF7C 5TJWK 3MLZH 3D2UD 3DYMA 1VHPA 2DWEA 2OMVA 5EPMB 1ASQA 3D0LB 3KWXA 4KXBA 4ZAKD 3U4BH 1CFVL 2FO4A 4ZFOL 2KL6A 2DI7A 4ETYA 1OAYL 5FECB 1R3IH 3GLEA 1ACXA 2H0FA 1F4YL 1FA4A 3H0TB 3LKSA 3I6LD 4PS8A 2ZXWB 4CSPA 5F9WC 2XWEA 1E4HA 1QO3B 2Y1VA 1NIFA 1T0MB 1RHHA 1ZHBA 4RA3A 1WQVT 5E6SB 1F56A 3FU3A 2XBZA 3RZCC 3TYFA 2R56L 3FCSA 1J86A 2JI3A 5E1AA 5EU6E 3HC3L 4GG6A 1Y7VA 5B39B 3KH3A 3CSYA 2NZIA 2CNZA 2WQRA 4I18C 1J3MA 1I1RA 2YN3A 5FK9A 3BCFA 4CC4C 3VD0A 1Z32X 2NYYC 4QXUH 5E5MA 4JZJC 1ZSDB 2VXSH 5C09D 3SDDB 2B7DT 1EFXD 2E0PA 2OR7A 2YC1A 3L3IB 4XI5D 1LWHA 1KTDA 2DDQL 2HTKC 3TC9A 2HH0L 5HJBA 4XZUB 3B7SA 2CPCA 2OYMA 4KK6D 4JUSA 1KEGL 4LASL 3AREB 2NSMA 3HUJE 5AUMB 4WSJA 1EJOH 2Y1ZA 3MRQA 2NY2B 4PJ5B 2IXQB 2QQKL 2Z4TA 5C9KA 1BPLB 3JTSA 5KVDE 3M6DA 4Q97A 2YUZA 4M00A 5E9NA 5I6MA 4L3EB 1ZLSH 5D2NE 3UZQB 3MTRA 4BGLA 1NGWA 3C5ZA 3OAYK 5IQOA 1GKOA 5BW7A 3T6QC 1A7QH 2MH4A 1ZY9A 1MCEA 4Q6YA 1JERA 3IJYA 4F7MA 3V8OA 4EKJA 4XVJH 4KKCD 2MKLC 4QGTA 3KNBA 3VQLA 2H3NB 1VOLB 2DEWX 2OL3H 3HAEG 4EJ1C 5LXVA 1F58L 1IIIA 2VUKA 5HGBB 4ANVA 3A67L 3QAZB 5FGSA 3ARZA 4WGKA 4FA7B 4EI5D 4K7PH 3FC8A 5FYJD 3QDMA 4HH9A 4Y1TA 5I76B 1DHKA 1TCMA 2BNRB 4YNYA 1I1FA 2IOIA 5C0IB 3B7UX 3PWJB 1MCWM 4L1SA 3VXOA 1NBVL 4LSSH 4XPTL 2WTOA 3L4UA 4RCAA 4XMPH 1IKFL 5INCA 3A23A 4XHQA 1F3RB 5AVUB 1NSNL 1E3FA 3ZHDA 3R0NA 2R0ZL 5ALBH 2P5EE 4CJ0A 3W9EA 5F96L 2QBWA 1F3JB 3MLTA 3DXAE 4AE0A 3E7JA 4B3EA 5KS9A 2APFA 4PGBB 5CGTA 3OGDA 4E5XB 5B21A 1E4WH 3WE6B 3CX5J 2PTTA 2QDVA 5I1GL 3D5OF 3OHXA 2JB5H 4W9HC 1PW3A 4HHWA 3SGJA 4L4VB 4HFUH 5EU3A 2F8VA 1LGVA 2XXCB 3LPGA 2DW5A 1R3KA 2G0LA 2NSXA 1T1WB 2WZPA 2MQGA 1IEAB 3K6IA 5HYSG 3UZEC 4N9GA 2H26B 1E7VA 1T4KA 1Z9PA 3FN0L 5SWQB 3EGDB 2O5XL 4JFYA 3WL9B 5ILTH 1HTYA 4ANUA 5EBMB 2UZXA 2ZAIA 3RLSA 2OULB 3AG4B 2ITCA 3X13A 4PV1C 5GGVY 4AQ1B 4AK1A 3IN0A 2DQTL 5C6PB 2Q10A 1UH3A 1JYXA 1I8IB 4DUVA 2RACA 1KFGA 1P4UA 5AOJA 4MJ6A 1GMEA 2APVA 1G1CA 2CJTA 2XC8A 4KZCA 3CZNA 5EEVA 5B1CA 2UVEA 2VZUA 5F88B 3O9WD 1NDGB 5E5LA 3NZSA 4I18A 1AHMA 5HY9B 3UTSB 3Q43A 2YAOA 4CC4A 3D18B 4W9JC 4X4XB 3P3RA 4QRPA 4JZJA 5F6HJ 4MA7L 3KWWA 4IOSA 2ZE0A 5D1ZC 3I75A 2ZSWA 2Y8QA 3CC5A 1RK7A 1HKLH 1Y0LA 1ZHKA 4N2FA 1A1OA 2YA1A 5J13C 2E5EA 2WWMD 4FI6A 3WSQL 5A2CA 4PRIA 3OL2A 2HX8A 3MX0B 5CIPH 2ZYSA 2JKSA 5K1VA 4ODHL 4O51A 4WZSD 4JO5A 1YECL 4HKXA 3Q5YA 1OM3L 3NA9L 4QYOB 5DQDH 4QYAA 2BY2A 3WEXA 3KPQA 5I0WA 4X9IA 3NRFA 1ONQB 2IEPA 3CVTA 1BD2E 3DIDA 3EJJX 3F6JA 3K2UH 2FO8A 4G9FD 4M6OH 4PJGA 5E1QA 3WENA 1F18A 4X2UA 4MMZB 1HKFA 4G8EB 4ZMLA 3HAEA 2VDKL 3NP4A 2C1OA 3B9KD 3V0HA 1P5VB 2N3JA 1C08B 3MZGB 5DD5H 2F58L 2ZWNA 3QI9B 3O8XC 2XXGA 4PVNA 3GI9H 1WWWX 1UL7A 2WYHA 1KYOJ 3IVKA 3QT2A 4Y19A 5J4MA 2X88A 1SVBA 1WA2X 4Y7MA 4MXVE 2WWNA 4CN1A 1H3PH 3S8WA 4X0KB 3D25B 4N2AA 4JFZH 4I48B 5ESAB 6FABL 4NO2A 3U4EB 1NH2A 5DA4A 4PGJA 5BNXD 1JWMA 3M1BA 5CBAB 3KPNB 4G5ZH 1EO5A 3EO1B 2BVYA 1AOZA 2OMUB 2XZQL 3WN5A 4W6XB 4ZO9A 3FMGL 3ZZLA 3HPJA 2K7PA 3K4DA 4PY8I 2YGVA 3EZ8A 5DR5H 5CIPA 5BMFL 4YHKH 4YSOA 3ZHLA 5BJTA 3CUPA 4YXKH 1ZPLA 1NCTA 4YE4H 3I9PA 4M7JL 4TRPH 5GIRB 4GBXD 1UH2A 4H8WC 1KCUL 1FBIH 3GK8L 1BXAA 4FN0A 3NJLA 1IGTA 3UZVA 3QULB 4BSVA 4IL8A 4NZTL 4WCYH 3DMMC 3T3ME 2V17L 4RAVA 4HJSA 4BKLA 4OZGE 3THML 4KRLB 4Q9QL 2JELL 4XN2A 4C57C 4NQVB 1X7SA 2NY0B 3SOTA 4LAQH 4YZWA 5GHWL 2FX8L 3I3DA 2WLHA 4DPCX 2L4OA 2XG4B 3S96A 5C9JA 5I6KA 2Q86A 2FT6A 4KMLB 4WDIA 2G4GA 5F44A 3CHOA 1EERB 2P4AB 5IVZA 3T0VA 1IGCL 3LKSB 1PLBA 2AP2A 5TDOA 2CD0A 3ECVA 5LGKA 1AZVA 4N1HB 1INEH 2QL1A 1BZDA 4MD5B 4HUKB 1BFSA 1ZHBB 3ULUD 1RHHB 5KSUA 1MFAH 1D7FA 3TYFB 4BHUI 2ZKWA 5JORA 5GGSA 5J12C 5KW9L 4GG6B 1A5FH 4KO5A 3CSYB 3ESUF 5CJOH 2ZOLA 1JZ4A 4TQPA 1AQDA 1YEIL 3K4ZA 5E5MB 1WRFA 5IESL 2DRUA 3QQXA 2ENPA 3NTCH 1JGDA 1MFEL 3U46B 5E4EC 2OMWA 3TF7C 2YC1B 1J05B 3GKWH 2W5PA 3S5LG 4KY1H 4LCWD 1YPZF 3VM5A 1KTDB 5LBGA 4LESA 2GY5A 3VD4A 1UFUA 2H47C 4I77H 1EHLH 4ACPA 2B4CL 3L3KB 4OF6A 5MEOB 4JFSA 2WAQA 4I4WA 2YBGA 3P1VA 2EC9U 3AQZA 5D1ZA 4XH2A 3P2DA 1RIHH 3MRQB 5J8OA 1AXSA 3MV01 3EUUA 1FVEB 1XD0A 1J88A 2B1HL 5DJDA 5C0CA 1Q9UA 3JTSB 4H26A 1Z5YD 2TRYA 4KK8C 1SHSA 3KJ6L 4UQCA 3SE6A 1KT2B 1JGLL 4JDZB 2ZP9A 2A6JA 1Q9WA 3AMKA 5L9DH 2DIJA 2R2CA 5FF6A 1MCCA 2X2YA 4ZXBD 1JDAA 2BOLA 4LCCC 1RUKL 3D4YA 2OZ4L 4XN4A 2XN9A 2C3VA 3L3DA 2E75C 4O00A 4BUGA 3UGUA 4K94H 2BDNL 2I24N 4F37K 4CSSA 2BNQE 4Y4FC 4D0BA 4U1MA 3T4NA 1UB5A 2VRQA 4OCLC 3QDMB 4JRYE 1I1FB 2D3JA 5LWYL 3SE9L 4PY7A 3VXOB 3SY6A 3UJJL 5B1JA 1N6VA 1USQA 3UGEA 4ONGH 5C2UB 2CUHA 2NPLX 3PHOA 3X3GH 5IYBP 1WHPA 3I02A 5JIIA 3UC2A 5LG1A 3LRKA 5HYEA 1XIWB 1CCZA 5DZLA 3OSEA 4BYHA 4XAKD 2YMXL 3P0VL 5AYUH 2BOBA 5DD1H 5I1KL 4EF3A 5I1LA 1I85C 3BLBA 1GRWA 5L4JA 5CLTA 5EDXA 5LLIC 3T6VA 2WXLA 2PTTB 4NUPA 2O6EA 3OHXB 1A7OL 3GIZH 2RA1A 2CO2A 4RGOH 3SKUD 4C7PA 4QGYA 2BHUA 4LVOB 4DF9A 3DMMA 5EU3B 3T0DA 3C5SA 2WHVA 3F2LA 4ZFGH 5EU4B 4KJWD 4NB7A 4MJID 2VJXA 4JG9A 2ARJA 1N6QH 2AW2A 5IHUH 4B41A 2ESVE 1T4KB 3GMMA 3DARA 4ZX6A 1FQ9C 3MRPA 2C5DC 4JFYB 3SBPA 1GYCA 1VGEL 3JV6B 4GKZA 3IS1X 1CGSH 5DVLA 1VAHA 4P9HC 3JWOL 5ADPH 1E43A 2ITCB 3X13B 4EZMA 4YMPA 5KYNA 1N3CA 1IJNA 2OP4L 1DVXA 2E9BA 4F2EA 3TYGH 3FUJA 3ZE0B 5KTEL 4MD0B 1SHMA 5CUSL 2WBJA 1CE6B 4P57B 5DUMH 1HZHL 1Z3GH 2L3BA 4MJ6B 3S5LA 1BG9A 2VR8A 2Y36L 1FFQA 5B3SB 2FECI 3JWNE 2MCAA 3QNXA 1NDMB 3QK0A 4I18B 4ZD3L 3MRCA 4ZG1A 3KAAA 1RAMA 1FLRL 2EE6A 1QFUL 3VXQA 4BQ9A 2DEXX 3BWUC 3VG0H 5IJVB 3I75B 3ZKND 1CFMA 5BZZA 3AT8A 3QO0A 3IGAA 3QFDB 1ZHKB 1J9TA 1XCQB 3NK4A 1A1OB 1QSFB 3UTOA 2PYED 3VRJA 4ZK8A 4POYA 5F89A 3VTTA 4R8WL 3VFOA 3LIZA 3LEXA 3QRFM 4Z7WE 1BPVA 5EC2B 1VIWA 3AGWA 3Q1EA 1N64L 3L4XA 4HKXB 5HI3D 3RIAF 3WAJA 3TBCA 3WEXB 2YKLH 1CL7H 2BFGA 3MBWA 5F9JA 2NW3A 1HCVA 2WXQA 4BJLA 2EICA 1W80A 4CKQA 3S88H 4GP5B 2V5MA 5E08H 4PJGB 3EW3B 3S3CB 3ZDWA 2WOYA 5CZXC 4P2OB 2BP8A 3HAEB 4A68A 5A40E 4ZOEA 1K85A 2V2TA 3D0AA 3UP6A 4ICWA 1JHKH 5I1JH 2OK0L 4GB9A 5AAMC 5DJCA 5DJ2A 3OV6A 5DMKA 5C86A 4RMWA 4YH6A 4LCCA 3ESOA 4OGAD 1RV6X 5FR3A 3WS3B 4JFDE 1JF1A 3DPBB 5DRXB 3OSTA 3MRGA 4KKLD 1O6SA 3HKFA 4FNSA 1X5IA 4NO2B 4L8BA 4LKXA 4L4TA 1JWMB 4QG5A 5JO5A 3HE6A 5ESVA 4UOZA 4Y4FA 2R9HD 5F3BA 3MLUH 5KBKA 1G1YA 1U36A 3D30A 5C3TA 3WN5B 4B6ZA 3CFCL 4HUWA 4JR9L 4S0SD 3HPJB 4AGPA 1HE7A 1JWSB 4AIOA 4S1SL 2JI2A 5AW7B 5ECGA 2LLLA 2Z65C 3CUPB 4LF3B 5C07D 1ED3A 3TCTA 1MCOH 2X0UA 3CN1A 4FERA 4JJ5A 1DBML 2HMIC 3IJ8A 5J56B 4PLKC 3IMBA 4RMBA 3L1FA 1IGTB 5FHAL 3UZVB 3RVTC 1VTLE 1JMZA 5KVDL 43C9A 2EH8L 5HYSB 1NCDL 3SOBL 2J1KA 1RZ7H 1P6AB 1QLEB 4JO3H 4PSRA 4NC2B 5I75C 2F7QA 2R4RL 4P2QE 4HOXA 4WW1A 5C9JB 2AFNA 2XWDA 1D9KC 4JPSA 3TF4A 2Q86B 5LN4A 4MKMA 3FRPG 5ICUA 3TWCL 2AEQH 1E8YA 5KSAB 1AZRA 4YDZA 3CMGA 3VFSB 1CBVL 4HIHA 5KVFE 4CMHC 2EDJA 1WUNT 4Z7VE 1NAMH 2NX5D 3BSZH 4UBDD 5LNGA 4KKRA 5HDBB 1XGYH 1RULH 3DJRA 2L7EA 5M7QA 1QOKA 3WYRA 3T4YA 4DTGH 4UT9H 3WTWA 1JZIA 2R2EA 3ZSSA 1ADQH 2A38A 3CVHL 4Z7IA 3WIFA 5BZWB 4JREC 4Q58C 2K6YA 2YN5A 3GRGA 3KXFE 2G60H 2OMWB 4P99A 4OZIF 2V9QA 3OXSA 4PMFA 4QT5A 2KUTA 4MZ3A 5CR8A 3MNVA 1SQ2N 4PJIA 2Z91A 1A6VH 3W0WA 3LEVH 2W80C 5D4QA 4NKOA 1EZVY 4I4WB 1TVBA 5D1ZB 3ZT6A 4ROCB 3BYTA 4PG2C 4MDJA 4XX1E 2F19L 4OM1L 1BFVH 4Z7OB 3UTTB 4LEXL 1I1AC 3UEZA 2HT4C 3BX7C 5J13B 1MY7A 5C0CB 2AGJL 5B3JF 2GKIA 3PFUA 5KVEE 3GS7A 4H26B 4N6RA 4R2GC 3K1DA 3MRLA 1F13A 1E3ZA 4YFDB 1A8JH 2QHLA 4H88L 2A6JB 1Q9WB 4HKBA 1TJHL 5FF6B 3RBGA 1NAMA 4HJ0D 5ACMA 5BCAA 4PJ7B 1SF3A 4GO8A 1T80A 1T2QL 4LSVL 5EUOA 2XN9B 4WFHE 3L3DB 3SEPA 2E4FA 1ACZA 3WIIH 4L3FA 5B1JC 2HKPA 4ELKA 5ICZA 2XTJC 4DESA 5AAMA 3GMNA 4XB7A 3VXRD 3V9CA 1UB5B 1R3JA 3CD4A 1A7RL 3CLFH 1F4AA 1R46A 1L6XA 1QSEA 2WW8A 3D69A 4RIRA 4M6ML 4HDIB 3KPSE 1YMME 3PHOB 4JRXE 1ODAA 1GZPA 1ZANL 2ZNXA 4HGWA 4WI3A 3KEHA 3TPUA 5HP5A 3JVGC 5GRUL 4JQIH 5AFAA 4RX4D 2LLNA 3WKPA 4GQPH 3T2NL 3H8NA 1N0LA 4KXCA 1MHCB 4NM4L 1RPQA 4QAWA 3HBGA 3LDBB 1M57B 1WD9A 3U9UA 5I1LB 4NZUH 2AK4D 3Q5TA 1KY6A 4ONFL 1BMZA 4JL1A 1EZLA 2BVPA 1ZIAA 3FRPA 3LEYH 1AQKH 3VSTA 5DYOA 3UTZB 5A16A 3DMMB 3C5SB 5BUPA 1QLFB 2CXGA 2EDYA 1EUTA 1DVFC 4JHUA 4DHLA 3LNDA 7FABL 2I26N 1ZJAA 2ZXDA 1FH5L 4MMYB 3SJVD 4PV8A 2IBZX 3K46A 3GMMB 4A2MA 2NRDA 3OBAA 2VW7A 3A4EA 4HLJA 4J4PC 5F72S 4XTRD 3T2LA 1D9KA 3BE1L 4GKZB 4RQQA 4TLKA 1CLOH 2BSEA 3LKRB 4ZW6A 3VD3A 1IAOA 3GMPB 4K5NA 3OR6B 4FQCL 1EXUA 5DSCA 3WUWG 5BOJA 4M02A 2WBJB 3I50H 2E4TA 1I9JH 2H2PC 3CE1A 4M5YH 1U8NA 2EO7A 3MGOB 4AVHA 4IRSD 2VLRD 2WXNA 1N2RA 1SMDA 1VSCA 2VDNL 3D39A 2NOEA 5GS0C 4LEEA 5IEKA 5KOVC 3HCVB 3QNXB 3S36H 1OF2B 1MAML 3ROOA 3DO7B 4XOCA 1E5AA 4YAQA 5DFTA 4LPYA 2V5YA 3ZTNL 3VXQB 4U1GC 4OFDA 2XLLA 2DTML 2K3HA 5IMKA 1AGCA 3QA3B 1JK8A 4APQC 1K2DB 2QADD 3QO0B 3T0XA 2DQGH 1RUPH 2VLJA 4LCUA 1A6AB 2WQWA 3NAAH 2QJDA 5F89B 2CBQA 1D7BA 3HG0A 5EOTB 4N6QA 1OLLA 5TE6H 4Z8FH 5I18H 3DGCR 1KGJA 4LLVA 4PG2A 4S1RH 1YY8A 4KDTC 5D6CB 3MBWB 3UP1A 4XCNA 3QPKA 3UMNA 3DK0A 4AXWA 1I1AA 2XY2A 4WHYH 1P5DX 1CYWA 1A3ZA 2BP8B 1LEIA 1MKFA 3BUYB 3L13A 4QO1A 1P4BH 3ARBD 1WJWA 1F4WH 4ALAC 5D7JC 4X4YB 1URZA 5DJ2B 4I7ZC 2BPBA 2Y2YA 4QUOA 1KACB 3MJ9H 3ULVC 3MJWA 1D6VL 2XN2A 5I74C 5E5UB 1JHLH 1JF1B 4RNRA 5IIEA 1O6SB 3NABH 4GJTB 3GM0A 1CZ8H 1WFMA 1WT5A 3BHBA 1CUOA 1F02I 1WEJH 4L8BB 2OR9L 3POCA 4G9DA 4L4TB 1JK9A 1ZT7A 3MI6A 3HE6B 5ESVB 1CK0L 3VB8A 2EAEA 4M29A 2K6WA 3BRFA 4MLSA 2WO2B 1AAJA 2WINB 1WFNA 4HUWB 1IAIL 3R8BB 1CFQA 1OGAD 4PJBF 3K6DA 4OIIH 3RWHA 4E9QA 5E9DE 3MGAA 1JZ7A 1ED3B 2EDHA 4JJ5B 3VQ2C 5SX4I 3OZ9H 4JLRB 3JVGA 3LPFA 3V7AG 2HFTA 3VDCA 4ISVA 2P8MA 2CHXA 1OAQH 3QG7H 3GBML 3GXTA 4OJDH 3GXDA 4R3SA 3FUNA 2XETA 2NCMA 4MCMA 3K74B 5DQ9A 4B9YA 3RGHA 1PFOA 4PGEA 3SDXA 2NTFB 2QTVA 1MOEA 1XF3A 3F7PC 1GPOH 4QTFA 4WW1B 4LGRB 3ILQC 2W0FA 1OSYA 2VL5A 4PBWD 4DVRH 2JKRM 4A66A 3MV8B 1SFHA 2DIEA 4A7GA 3WUWA 1HHKA 4JM0A 4WVRA 3MLWH 4OLEA 1RZIA 5IHBA 1MIML 2ERJB 3FBQA 1DVFA 5ESQA 3VD7A 5KVGE 1HH6A 2YGQA 1OKEA 4X80L 6TAAA 2P5WA 4MA8H 5FM5O 3MRDB 4J4PA 3QWNA 2A6DA 2R7EB 4H8HA 3L3JA 4KJYA 4Y4HC 3MODH 5BO1H 3OD3A 1IBYA 2IPTH 4KUCF 3WIFB 4A7TA 2A73B 2ZTBA 3SPVA 4S1QL 3VXNA 1VPOH 1GGCL 1RFDL 4NQEA 1PDKA 3OXSB 3ULVH 1XAUA 2XZCL 3GB7A 1X9LA 4QT5B 1T3FA 4OFYD 4PJIB 2Z91B 5D4JA 4BA0A 3JUYA 3KWVA 3QJTB 4EN3C 4NKOB 4P5TA 4V1DA 1TVBB 3B8SA 2H6PA 1UB6A 3V0JA 4M48H 2D31B 3L5IA 3MLSL 3EJYD 4MDJB 4APQA 4Q0XL 3Q8BA 2C9XA 4UT6L 2Z7YA 4ZODA 1LYQA 1PYWA 3K72A 4H44C 2WBXA 4X7DC 4HXAH 5FKAB 1I1YB 1BWWA 3RY4A 3LNGA 5C70A 3MRLB 4MAYD 3CFTA 4ZYKA 1LP9E 1YA5A 4HKBB 4FULA 3FK3A 2Z8VC 3A22A 5FOBA 3FSAA 3MRRA 3PL6B 1N0XL 5PAZA 2BZDA 5JHDE 3QZBA 1XEDA 2GI0A 3U1SL 4KTDL 4HSCX 1Q0EA 2WQUA 2O6PA 4EVNA 1CXHA 1E4XH 3QC5X 1QATA 4KRNA 5JIPA 4WGVB 3B37A 3LH9A 2IAMD 3VFGL 1B6UA 5D7JA 5ICZB 4ZMYA 1HWGB 3GMNB 3LRLA 2FT7A 1KSRA 4IOIA 3VYPA 2VQUA 1KEMH 5EOQH 2G2NA 4KQ0A 3MLYL 1WITA 1KLFB 3D34A 1LQBC 3IFNL 4ZAKC 3WFDL 2H6UA 3D69B 4RIRB 4LSPH 1DYZA 2XWJA 3CFIC 2AV1A 4FLOA 3MFGB 3AUWB 3N2JA 4WIQA 4OJEH 4HGWB 1GZPB 4ELMF 5B3JE 3W37A 2K7QA 3D9AL 2ADJA 2GSGA 1FNAA 3FCUB 5KEZA 2RQEA 3LMJH 4X6CE 5CGMA 5CLWA 5D72L 2GTWA 2IIJA 3G5XA 4NO3B 5ADOL 1IGJA 1ZTXH 3PGCA 1N0LB 5AZEH 4KVNH 3IDUA 3E2HC 2Z31D 3CQQA 4K8RH 5I19H 4X9YA 5DJZA 5E8DH 4XNZC 2MMXA 4P8QA 1ETJA 4FQ1H 3G7TA 1KCVL 3LVEA 2BVPB 3FRPB 1NCIA 3GXMA 4XOBA 3FQXA 3QXUA 5DZOA 4A2FA 4DGWC 2V2XA 5FA4B 5B22A 2AQNA 3QBTB 1S78D 3Q2CA 3GMRA 1T21A 3N1GC 2AABH 4XI5C 5DUPH 3OPZL 4MA1C 4PV8B 5L0QC 3BZ5A 4XBGA 3UBHA 1MWAA 3AG1B 1S3KH 2FDBP 2Z3FA 4Y5VB 3SZKC 4Z23A 1DJYA 1TBAB 1D9KB 3VI4F 2Z1KA 1UT2A 2FHBA 4OIBA 2JMRA 5HJ3A 3DSFH 1EXUB 2FT8A 5DSCB 5F6IC 3RHWK 4UM8A 4X42A 2EEBA 1CURA 1JI1A 4JY6A 2I32A 1IJ9A 1U8NB 3TCLA 3ULSA 4UTBL 3V4PH 1N2RB 4I3SL 3D39B 1U33A 5HHVH 2OJZL 4FNLH 5CSZB 1QKZH 4Y4HA 4D8OA 2WXOA 4X5WA 1MW0A 1XT5A 3ZR6A 2DWTA 4Y2DD 4YAQB 2VWEC 1NAKL 4YQXL 1YEGH 1A8ZA 1P1VA 3SODB 2XVGA 3BKJL 4GKSA 1KXHA 3MBEB 5SV4A 4KKCC 3CLEH 5IMKB 3VXME 1AGCB 1CF1A 2XZAL 1JK8B 1IZKA 1JP5A 2VZOA 3CZFA 3OM3B 2VLJB 4PWEA 1JGVL 2E7BA 1U2HA 4Z3HA 5F7WC 4EI5C 3GZQA 3D07A 3O6FD 4I0PD 2DJMA 3CVBA 4M03A 4EN3A 2VE6A 5SWZD 1QI5A 4KOBA 2JKXA 4IBYA 5FKPA 2VW4A 1ES0A 1MF2H 1QW8A 4LLVB 1TF4A 4M7LT 3ZT7A 4XCNB 5IVOA 3RX9A 1WV7T 2GABA 4Z7AA 5C0ND 1FORH 1I1AB 2X3AA 1JXKA 2VC2H 2I9LA 5IB2A 3CX5K 3RA7L 3B9DA 5I8CA 1YQ2A 4G7YL 4R2GB 4QO1B 4GG6F 3PDKA 4POZD 3C08L 1TZAA 5KVFL 1U3YA 1KCSL 4LHUD 4NPYA 2DLTA 3QIUB 3WLBB 2XIIA 3B7YA 3C6LD 3EO9H 1IGMH 1P7QD 1NUDA 3OAUH 5HYQB 3UFIA 2QT6A 5SV3A 1CDGA 5M95B 4RNRB 1F6LL 2O5YH 2JJTC 3WN6A 3BHBB 4YVNA 1PZ2A 4LDEB 2QSVA 3UO1H 2X4TB 2J5LC 2ICWJ 4WI4A 4Q74A 4A2GA 2XTJB 3APDA 5TF1L 3O0RL 2FZ3A 4AM0A 3D2UA 1SMOA 2H1PL 1UM5L 4NZDA 4QRRE 3DX9B 3D2TA 3L3GA 2WYIA 1CFQB 3NP3A 1CLZH 1RZKL 4ZAKA 1SYVA 1FVDA 5E8EB 4Y4KD 2CJSA 3RWHB 5I8OL 4I1PA 4FQXD 1FZOB 3CVIL 3VCLB 1QBLL 1R6VA 4OGYH 1Q9OA 3ATEA 1DANU 2H1LM 2P8MB 3SQRA 2D0FA 4R3SB 5DFWH 3I3BA 4NQSA 5KVEL 4NQCD 4M1GL 4UTCA 4PGEB 4Z7NB 1G6RL 1XF3B 2DD8L 3O9WC 43CAA 4PI0A 4FZEH 5B3NA 1MLBA 4W6YB 3LVTA 3WUWB 1HHKB 1PZSA 4P5KA 2DQHH 1BYOA 1UVQA 3PDGA 5FYJH 5C09A 1LNUA 1EFXA 5ESQB 2EYSB 4OCYH 4RMQA 3QWOA 2KPNA 2WWMC 4IM8A 5CP3H 5HHOE 4PJ5E 3T1FA 1E2WA 2YD9A 5J1AA 5EBGA 4YDIL 1J5IA 1RERA 2A6DB 2X41A 1RVFL 4UQIM 2VXVH 4BSWA 4KJYB 3AVEA 4L3EE 3RTQD 2ZF9A 1VZGA 1QNIA 3GXIA 4UT7L 5C7XH 1KTKE 4D94A 4TNWK 1KYOK 1N6UA 1EGJL 1QEWA 2GJ6D 4LHQB 3SPVB 5JA8B 3B9KC 1CG9B 1ECYA 4FKKA 4NQEB 3WNOA 3DX6A 5EEYA 3GB7B 4R4ND 4M1DL 3DTXB 1TO4A 3G5YA 4JPVH 4BIKA 4P5TB 4V1DB 2I5WA 2Y7MA 2H6PB 4MXQD 2NQCA 4YVUA 5I30L 2BNRE 4DP9X 1H9VA 5J11C 1MXGA 4HF5H 5FGBC 3WDIA 1IT9H 1QA9A 4K3GA 5FWRA 5EEWA 5BV7H 2YUVA 3M45A 2C9VA 4EI5A 1DBJL 1R24A 4C56E 1KCWA 3D4CA 4OR1A 1S5HA 1ZVHA 1A1NB 1OE3A 2OXGA 4YC2C 3KS0J 4OCRH 5CN1A 5CP3A 1E40A 3UAJD 3ZE0F 2XHIA 1Q90A 2I60L 5DC2A 2ALAA 4LVNC 2AJXH 4GBXC 5IGXL 1J8HB 4IS6A 5IWLA 2QFRA 5DWPA 4QRAA 2IMMA 3KPOA 4L4VE 4ODUA 1NEZG 4XNDA 1HAWA 5BQ7A 4GW4A 4LCYB 1OARL 3P4LA 2W9DL 3OMNB 4P05A 1KGUA 1VEOA 4IMKC 3MNWB 4M6AA 4NYLA 4ERSL 5K69A 5D7EA 2JJTA 2Q8BL 5ITBL 4XNQB 2AV1B 3ARVA 2WXRA 1FFNB 3E6FA 3HNTL 3RZWA 2ADJB 5JXAH 1J8SA 1VFBA 5K9KB 3DRQB 4KTYA 1IGJB 3U25A 5EB9A 1S46A 4BWTA 5K59F 3ULUC 1GHFH 4FFYA 4RZKA 4MRQA 3ALPA 2WAHA 2IMNA 5J7CC 3KBFA 4BSJA 3LN5A 2X2UA 3UTSE 3NYKA 5A43C 3N85L 1KNOA 2GBTA 2V2XB 1SOKA 3QG6A 3PP4L 4L8SC 4Y9EA 3L1GA 3EFOB 7PAZA 3WNLA 3GMRB 1RZGA 3ZUNC 4QJ4B 1T21B 3RG1C 3O9WA 4Z7UF 2V5SA 4O02A 3VXUB 1MWAB 1XGPA 5IREA 3U0TB 3N41B 3L5JA 4MQTB 2GUYA 3CDFA 2IANB 2DWSA 5HJ3B 3VXTA 1LWRA 2BFVL 2H3KA 5JDSA 2ZG3A 2RCSH 4ILDA 4U6XA 2DQ6A 1M7DB 3RFZC 2Y5TA 4UM8B 2GC4C 4F9LA 4U6YA 1WBYB 4JY6B 3HI1B 1KELL 2JQAA 3TT3H 3ULSB 4ZMVA 3NZ8A 3ESMA 5IKCB 4AQZA 2W0LA 5E2UL 3FT4A 1Y07A 1VFMA 2WLJA 1FC1A 3HIZA 4X5WB 2JTDA 2QKSA 4NUGL 4WUUE 1CFTA 2HXAA 4ZXBC 5KN5B 1MY5A 1OXYA 4G9FA 4JN1L 3KLDA 4L29A 4F9PA 3QUXD 5I6OA 4GKSB 1LO4L 4MNGA 2VXQA 3B9KA 1Y6MR 1D2OA 2WWKO 3X1NA 5DDHB 3CZFB 3VB9A 3GUTA 1MJ8H 1PSKH 4F58L 2EVJA 1RIUL 4LPVA 4GIOA 4WNSA 2OW6A 3M1CA 1FL5A 1O7SA 3MACL 5FKPB 2X0WA 4FZ8H 3P9WB 1SEBB 4YN3A 4MAUL 4L3CB 3BPNC 1ZS2A 3LS5L 3MV9D 5FGBA 2WZAA 3ULUH 5C0GA 3WNIA 5HDBF 1HU8A 5IB2B 5I8CB 3BKCH 2GG1A 4QAMB 1NEZA 3QEGL 3KCPB 1M71A 4HIXL 2ZAGA 1PLGL 2VLKD 1SBBA 3HNSL 4DOHB 4XVTL 1YQVL 3MNMA 4XMLH 4GBXA 3ZE1B 4ZS6D 3H3BC 4TQEH 1G7HB 3LNIA 2H32A 4HP5A 1D5XB 1RMFL 4BDVA 4KJWC 1QD0A 4UOW1 5TPWH 2BHFA 3MCKA 3OGOE 5FM4A 1B6DA 3BIKA 3FT9A 4CJ1A 2J6EH 1K3ZA 3L3GB 2X5PA 2F61A 2GTZA 4IMKA 1WPCA 1JRHH 3V0GA 4ORGA 2CRYA 4BZ1H 4ZZKA 1P7HL 4N8VG 1J5CA 1YYLL 5I66A 2XRAH 4PJHA 1YEEH 1IC4L 2Z0UA 1HEHC 2CLVB 3B1UA 4GG6E 3VFWB 4AIZB 2VMCA 3TIDB 4NQSB 3TH2T 3OKDB 2K9FB 3CZSA 4YHML 3E2HB 1U92A 4PJ7F 5CKGA 4AG4L 25C8L 4GNKB 4DERA 1MJUH 1M9SA 2DQUH 4G6MH 4JFFD 4NLAA 3X14A 4HKZB 5A6MA 3K5SA 2WLMA 4RRPM 5F9DC 1DZBA 3BZ4B 5INDA 3FU8A 3GZPA 2FX7H 3Q8FA 1TTUA 1AZZC 1JF5A 5DZAA 3GS4A 2WIIA 1BVKA 3S0PA 3ZKNC 3P3YA 1DBAH 5C09B 1EFXB 2JFCA 4X6BB 3QWOB 4LCWA 4PWIA 4B53A 1CFVH 1T1YA 4NZRL 1OCCB 2FGTA 1G1OA 4MWFA 1OAYH 2N0MA 3H2PA 3MJ7A 3NRPA 3RGVB 4GQQA 3T2PA 1F4YH 3W9DB 4NUMA 2Z7WA 2J6EA 5HI3C 2WTPA 4B9GA 4BSWB 3CPLA 1OSZB 2X05A 3E8UL 3RFZA 5D7IB 1H3GA 1NLDL 5HGGS 2R56H 1QASA 4K71C 3HC3H 3MOQA 4L2LA 5JHMA 1HJBC 4MB4A 1DTUA 3DX6B 2FWSA 4JFEB 4IU2A 2FUTA 2O1AA 3KPRB 1BZOA 3ML8A 3ZYIA 2V3FA 4MX7B 2NXYD 5HPMA 1WFUA 3GHEL 3WMPA 4ZXBA 4OGAC 4KFMA 1PVHA 5LN8A 3P4NA 3QDME 4DGYL 1FFRA 3L95B 5E95B 5KYXA 4AWJC 2Y5QA 2DDQH 2HH0H 3OVUB 4HK3N 4XN1A 1QA9B 4L9LC 2KHAA 2R9HC 3HMWL 2UV3A 4ODWB 1KEGH 3TJEL 4LASH 1L0YA 3KYKL 2X4QB 2OXGB 5IQ7L 3I6KB 1VFOA 3BP7A 3ZTJH 2K8MA 2QQKH 1DLHB 3D8MA 1IQWL 3LXCA 1PKQB 4LQFL 1GZQA 5KS9E 5I0DA 4WKZA 2HT3D 5C6WH 3HVDA 4YPJA 4NNPL 3SGEH 2R39A 4H2CA 5KG9A 4UTAA 1P69B 4KKNA 1Z5LA 4V11A 3KPOB 5HI5D 1PL3A 3FO9A 4YHPB 5BQ7B 1RI8A 4DEPB 1KN2L 4WWOA 1HH9A 1XGTB 1I7ZB 1LO0L 4ZW5A 5TGBB 5FGRA 4MDIA 1FL3A 1F58H 1AR1D 3A67H 4NYLB 1B3IA 4HWBL 4N8VA 4ZDHA 3Q48A 5GGVL 2WGNB 4TVUA 2WXFA 3PPEA 5IOPA 3D6GA 4MJIA 4YL4A 3RWJA 3NJGA 3LSOA 1VFBB 4E9SA 1B9KA 4UV4L 2F74A 1NBVH 2A4EA 4N20A 4XPTH 1E65A 5E0FA 3ZE0E 3IMSA 5F71A 5CZVL 2F5AL 3F7KA 3V5KB 3MRNA 1NMBL 3RDTD 1NSNH 3IPBA 2EABA 4HC1L 3KPSD 4D8PA 2HAZA 3PWVA 2P24A 2R0ZH 5JW4N 5F96H 5IHWA 2YXMA 4G3YL 2V7HA 4EI6B 2A9ML 3MLXL 3I84A 1ET5A 3DX7A 3DVGA 5I1GH 2A77L 3IMVA 5CJ8A 1T7WA 2Z8SA 1EBAA 5C0JA 2E9WA 1XGPB 5JW3L 2BRQA 2YAQA 1QSFE 1BQSA 3IAGC 4PRIE 4W70A 5MEPB 5IY5B 3FU9A 1FNHA 2VH5L 1AI1L 4OQTL 5ELIA 5EH1A 2CJ3A 5HHXL 3FN0H 2O5XH 3M8OH 2NT0A 3OGCA 4LRNL 2Y5TB 2OA9A 2PYEA 1MFVA 2BP0A 2OMXA 3SO3C 4PJGE 4DNLA 3L4YA 3D4VA 5LNEA 3P73B 2XIBA 2YKKA 2M8XA 3CGTA 3JTTA 2DQTH 4HCRL 4BM7A 5T5FL 2DQJL 4PJCA 5EZOH 5E2JA 3ZDZB 4HJ0C 4CVXB 4HJEA 3KGRA 1LQSR 1CFTB 4BCXA 5E7BA 4CVZA 2W8CA 2ZZUT 4KNUA 1KJ2B 4Y5YB 1BEXA 2X89D 2VAAA 3CH1A 3RP1A 4Y19E 4AYDC 5MEND 2NY6C 1N7ML 3O6LL 3B9KB 1SLWA 1J5OH 1FO0A 3CZUB 5HI4C 3POHA 5A2IH 5C97A 1OT4A 4L37A 1G87A 1CL7I 1BOGA 4LB8A 4MA7H 1SJXA 5DC9B 3SCMB 5CLXA 1AYRA 1FL5B 1DUYA 1MREL 4XAWL 1UENA 2AQRA 2Q2LA 4S10A 5KSBA 3RVWD 3OWRA 3WSQH 4PN6A 2WKLA 2WBWB 5J3HD 4ZQTA 4DFIA 3SQOL 4L9LA 4ODHH 5C0GB 4WI7A 1YECH 3TT1L 3C12A 3O11A 1OM3H 3NA9H 2X3CA 1NCBH 2Q6WB 1UKTA 2JH2A 2BSCA 4M7ZC 4YC2B 2IGFL 3LNHA 4R7XA 1M71B 4FG2A 4Z18A 5CEYA 3W2DL 1N4XL 5C07A 5KBNC 3O4OC 4R7DB 2VDKH 3LAFA 1GIGL 2J8UA 1H8NA 4GBXB 5ITFA 3HG1B 4OFKA 4Q4EA 2F58H 5D96B 3VSQA 4PJIF 4MB1A 4BDVB 1S7SB 3LPOA 5JHLL 5L4MA 1BQHG 3WIHL 4XX5A 3RNKA 2J1YA 4Z78A 2GTZB 6FABH 4MQSB 3QDHA 2YJQA 2NQ3A 2CIKA 1B4TA 1IVTA 5AKSA 2DLGA 3FPXA 5L8LB 2XZQH 3MMEB 3FMGH 6PAZA 1T83C 1UACH 5BMFH 4C59B 1SJEB 3MHZA 4EDWL 4GEIA 3TVMB 1C5BH 3B6SA 3CSTA 2NX5A 4M7JH 1U92B 4IRSC 3ILEA 5CZKA 2PN5A 1KCUH 3BH4A 3GK8H 4LL4A 5F1IA 1GA2A 3GTTA 2DQDL 1IM3A 3GF8A 3OJDB 4NZTH 3O3UN 3WKML 2V17H 4NX0A 5INDB 4MHHG 3GJEA 5DTFA 3THMH 4Q9QH 2JELH 2X6BA 3CU7A 4L1LA 2EACA 3GFUA 1KCRL 2ZP8A 3BXNA 3ZZ1A 1BVKB 2C3XA 2O3OA 4HHAB 2QADC 5GHWH 2FX8H 1ZLWK 1BBDL 1HI6A 1NGQL 2JKWA 3WMQA 4Q6IC 4HAFA 3HZ3A 3MNDA 4Z7OE 3UTPE 3UTTE 3CX2A 2F68X 1WFJA 2YPVA 5C0CE 3MJ7B 2AC0A 4B7LA 1M5Q1 3ZL4H 5E8OA 1IGCH 3IH7A 4K5PA 4C54A 3IBOA 1BZEA 2IDCA 1EIBA 5HHMB 4PTUA 4NO5A 2E59A 3RFZB 4YWGL 1AXTH 1F97A 1KTCA 1ZA3A 3PNRB 2IOMA 4JG1L 2E7LC 3ET9F 4PJ7E 2JXMB 5KW9H 2AAAA 1HU0A 3ARBC 1T03L 2XN9E 3NUKA 3C6SB 1NA8A 3KDMB 4R96A 4PJFA 4ZUWA 4WV1B 5JOPE 2A7BA 4LL9A 1YEIH 4WY7L 5HPMB 5IESH 2EVIA 2BSSB 4JE4B 4ZXBB 5EIQA 5I6NA 5FYJU 1CMOA 1FZKB 3NIDF 3HN5A 5KYXB 5IEHA 3HRPA 4WFFE 4C4UA 2R4SL 1ORQB 2B4CH 2V5RA 3CN3A 4NRXB 3VXRA 4JN2B 3H7BB 3ATFA 3EYFA 3S37L 4K9JA 4PUBL 4RFOL 4F8NA 3RIAK 1U41A 1SXNA 2B1HH 2A74C 5ABDE 3JWOC 5FGCB 3RWGA 3LJ3A 1BXXA 2G5BA 2IC2A 4IBZA 5K1NA 3KJ6H 3BPNB 4MQ7B 1JGLH 2GEEA 2NOYA 1X5LA 3O2DL 4RX4A 4BFFA 5KG9B 1J0KA 1S4IA 4U0RC 4UINL 1Z5LB 1BQHA 4NGHL 3V5HA 5G2NA 1A7NL 1L7IL 4HWZA 4F8OA 3ZX1A 2OZ4H 5IBTL 3U4AA 4Y16D 2DMGA 2AK4A 3KLSA 3D7PA 3EBGA 4MDIB 1TTAA 2HFGL 2NY7L 1FL3B 3SDCB 3G3LA 1WBZA 3HE7D 2OYPA 4N8VB 1DQML 3NPZB 4X98A 4IRZL 5CJBA 2WJ5A 1ND0B 4M9PA 4IRJB 4TUKL 1XH1A 4WU5B 5FXCH 1UXLA 2HPTA 3LSOB 4FJZA 3SJVA 3SE9H 5LWYH 2Q76A 4JUTA 5FX3A 3UJJH 3CSFA 3QO1B 3TLRA 4NZ8A 1WCBA 3KH4A 5L2KD 5IMLB 1JZ8A 4OLZL 1V27A 3MRNB 2XSKA 3BQUB 3GIVB 1UD2A 2JNZA 1DQKA 1F3DJ 4C83B 3O41A 35C8L 4D8PB 1F11A 4MNHA 1GVIA 2P24B 1TYRA 3PWVB 1T83A 4PRNA 2EDLA 2YMXH 3P0VH 4XP4H 4YLBA 4M61A 3CCHA 4F7TB 5I1KH 2N0KA 3VG9B 3QYMA 5L7XL 1JNLL 3BESR 4AUYA 4XCFL 4WXAA 1INQA 4K3HA 2OMTB 3B5HA 4Z76A 4ESKA 4IRSA 2AI0L 2VLRA 2EC8A 1A7OH 1T5WA 4P46D 4YHLL 3H4HA 2BJML 4TUOA 3LRGA 4WO4B 5T3ZD 5IFJB 3LKNA 3DV4A 3HI6L 5FYKE 4Y5XC 3OG6B 4H0LC 2FX9L 2QPDB 3ECBA 1O7VA 5D8JL 1NCCL 1VGEH 3RVUD 2XPYA 1KZQA 1M42A 2XN1A 2PPFA 4Q6IA 1QTSA 3BIBX 1MFNA 2OMXB 1XSKA 1KIUA 2PWEA 3JWOH 2BLFA 4MAYC 2O30A 3ZIMA 1T7VA 2EE0A 2OP4H 3M88A 5KTEH 5CUSH 5AW6B 4JX0A 4PJCB 4G83A 4OGXL 1HZHH 5I2IB 2BINA 2ED9A 4CVZB 3PABA 2X38A 4M3HA 2Y23A 3ZGHA 4LSUL 4Z7NF 2VAAB 2Y36H 5TE7L 1NTDA 4R5TA 1IEBB 3T0AA 4XT1C 1FN4A 3ARBA 4ZD3H 1FO0B 2IAMC 3ZRFC 2OX5B 3OKLA 4L37B 4IBUA 1FLRH 1QFUH 1NJ9B 2F1AA 2P80D 1MZYA 2VISA 1BOGB 3IXTA 4GEJA 3DV6B 4L4TE 1W6WA 2ZF8A 1O6TA 4JFPA 1LMKA 1W9XA 1UEMA 3EOYG 3L9EA 1IM9D 2Q7YA 2FIKA 3VXMD 3F7LA 1NCUA 4R8WH 4GUOA 4L9LB 2EDWA 4NHUA 4L8DA 5KVMC 1N64H 3GM8A 5CD5D 2V9RA 4JVWA 2EEAA 4EUPH 3FUIA 4XXWA 2Z6FA 1PBYA 1OGAA 3TA3B 2Z31C 2A6KA 4ROEB 2A74A 4Z0BH 1VDGA 3CFEA 5C07B 2H0EA 4G72B 1O5PA 4PJAA 2FQEA 4JKMA 3FUKA 4RMTA 3PAUA 4JFOA 4DP2X 5E8NA 5ITFB 4LT7A 1H9DA 1CDHA 2IAAC 4K9EL 3EADA 4ZPVB 4BQCA 2OK0H 1AMYA 4EXPX 4YHNA 3H9YA 4ZMOA 1IUZA 5EG6C 1CXFA 4NM8L 1AY1L 1AANA 1S78C 3NBNA 4MTMA 1EJFA 1BAFL 4HIJA 1TTBA 2KQNA 1F00I 1UWEL 2BHYA 4LK4A 4E9WA 2J56A 4RAUB 2CDFA 3AACA 1K35A 2NQDA 3U9PL 2CIKB 2XWCA 4RMUA 3CDGA 4GW1A 2E6JA 2GCYA 3G6JB 3N40P 4AIXA 4LOFA 4ZMPA 3VMNA 3BD5A 2DQCL 3CFCH 1INDL 1ZVYA 3GXFA 4JR9H 1JXDA 5LBSL 1X9RA 4S1SH 3DJ9A 5TK4A 3F64A 1RJYA 1NOAA 4MXWL 1DBMH 1GJIA 4JZOB 4KROD 5F1IB 3CVCA 5FHAH 2J8HA 1ADWA 4PVLA 3D51A 2ITEA 3HZYA 5I73C 1TXKA 3CK0L 5KVDH 3QE5A 2EH8H 4Y2DC 2G75A 1CIUA 4PJIE 3GJEB 3LD8B 5DTFB 5E94A 1NCDH 3SOBH 2AK1L 3C9NB 2R4RH 4YUEL 2CZNA 3S98A 1TU2A 4U49A 2BP5M 4JJOA 4OFYA 3PFQA 4I0PC 1QPPA 3O6FC 4HUUB 3SDDD 4A2LA 3TESA 3TWCH 4Z7QB 3KYNB 2I25N 2PP7A 2PLTA 4H0GA 5IFAL 1K5NA 2H2SC 1CBVH 3FSZA 2HP4A 2C3HA 4PTUB 5C0NC 3BAXA 2DQEL 1ZA3B 3QJXA 5EO1B 5I1AB 3SO3B 1AGDA 3E8VA 4LLYA 4OD1L 4MAYA 4POZC 3DO3A 1UJTA 1QP1A 4R96B 4ZUWB 4ZQKA 3C6LC 3CVHH 4L0ZA 1JCVA 4GAJL 2F54D 4HV8A 4EQ3A 5HYJD 3VWKC 5PCYA 1RLWA 4KI5F 2EHBD 2GJRA 3L2NA 4JGNA 1QSEE 3OKYA 2IAMA 1D3CA 12E8L 3NJJA 3GWJA 5G5DA 4WW2F 2DWXA 1KGIA 4LHUG 4FYRA 3S37X 4AMXA 1AS7A 3SE4C 2PYFA 4LQ1A 3I85A 4OZFG 2F19H 4OM1H 4DGUA 3TZVD 4LEXH 5F9OL 4YPGB 1E4XI 2ZWLT 1PCZA 4O2FB 1H3TA 1BBJA 2AGJH 1KXTA 4FQXC 2G5BB 2BC4B 3PWUA 2ZP0T 1GGTA 3LRHA 4P0DA 2IF7A 4P2YA 4ECNA 1TCRB 1TJHH 2G3ZA 4FADA 1PLCA 3VX0A 2I9TA 3DKHA 3V5HB 2FIRT 2Z31A 3S8FB 2WANA 1A21A 3OXRB 4N5ED 2LTQC 4YZFF 1RIVL 1T2QH 4G1EA 4LSVH 2AK4B 4KUCD 4AMKL 1T6AA 4WSKA 2K4AA 3IM1A 2GI7A 3CVHA 3IEAA 4MSWB 5CS7A 1WBZB 3MBXL 5IW6B 5ERWA 4X98B 1KBWA 1EMTL 1OE2A 2H7WA 3C2SA 3ASWA 2X4NA 3FYEB 2AJUL 3L4ZA 4B96A 5IMOA 3QUKB 4J3SA 4LMQE 1BJMA 5JHAA 4L4VD 4XE5B 4CNIA 1MCKA 2E7MA 2A4CA 4R5VA 2Q76B 1X7QA 3DUSA 1C5CL 3WI9A 3HC4L 1EWHA 3C75A 4ZFZA 1G9EA 1ZANH 1KCKA 2HX7A 4B9JA 2ZWYA 4KVPA 4N0RA 4OF8A 3VXSB 1I3UA 5GRUH 1ET7A 1UWXK 3O41B 3D39E 1F11B 3I9GL 4MNHB 1AIFA 5TDPB 3T2NH 2HJFA 2OSLB 3D06A 4NM4H 4PRNB 2XKNA 3ARSA 4ONHA 3UGXA 1DVSA 2A9CA 3P4OA 4PS7A 1FRGL 4J12A 3MRIB 2YSSA 1INQB 1TQCB 2ZOWA 5ANMB 1L0PA 4ZSOA 2VLRB 4LLQB 3ZE1F 1HQRB 3LIUA 4JDTL 3CWSA 5E99H 1G9HA 1IFHL 4N22A 4R4NC 4FLQA 3MXWL 4TUOB 2WVVA 2CBTA 1J0JA 2VLJE 4Y2DA 1XCXA 3LKNB 1QLEL 1X5JA 4UDUA 2GK0B 2V8LA 4MXQC 1OAJA 7FABH 5AVZB 4YBHA 1FH5H 1LWVA 5BS0D 3AC0A 2UVFA 2XV0A 3HKZA 4FG6D 3ECBB 4X0NA 2QADB 1KIRB 1RK0A 3GSXA 2QSCL 1E9PB 3I9IA 3NIFF 4NC1C 4LSTL 3GXPA 4WFGE 5TH2A 1OL0A 2AJSL 4I0PA 3O6FA 3DUUA 4M93B 2I7OA 2ZCLH 3NCEB 5SWZA 4FQCH 2P8LA 4I9WE 3UAJC 3IDJA 2KH2B 3RIFF 4P3DB 3EF7A 3MR9B 1SBSL 3MUZ1 2B15A 3FTUA 4JBSA 3MA7B 4LSRL 2VDNH 1A6UL 2J5WA 5IYCP 3NPSC 2QPSA 3N42B 1UZ6E 1MAMH 2R2HA 3FO1A 4LHUA 1HWHB 4RWHA 3OKLB 3ZTNH 2DIAA 1RZJC 3C6LA 1ZA6B 3CFKA 3C2AL 3IXTB 3NZHL 1P7QA 2NCEA 4OZFA 2DKMA 2XTJE 2DTMH 1MAJA 1S9XA 2KERA 5HHNB 1F86A 4QXTA 3U7YH 1ETA1 4AZ8A 2MWCA 5FV2A 3N0PB 2Q7YB 3GZOA 2FIKB 3TWYA 4I1NB 3VTMA 1I53A 1VLXA 2FYYA 1ZLUK 4NHUB 4L8DB 4XVUD 3IGKA 4DGVL 3RWCA 1AG6A 3SE4A 2DLFL 3KHOA 2YRLA 5DK0A 2PW1A 3Q8EA 1PJWA 2P43B 2A6KB 2CGYA 2A74B 5D7IF 5CJQL 4UWQB 2R1XB 3HI5L 4FQXA 2R83A 3EUDA 4PEEA 5JW5A 1E8ZA 5E8NB 4JFXB 3VN5A 4P4RB 5BOZG 2DB8A 1HNGA 2W94A 4I88A 4YHNB 4U0RB 4NQCA 3KPMA 3NCCB 5GRWA 1D6VH 4EKXA 4HIJB 1FSKB 3UBFA 3IPEA 3ATDA 2CDFB 1HILB 1ZEAL 1AGFA 1YYCA 4ZI8A 1U8OA 1C9SA 3AITA 4OD3L 2NY0D 4NENA 2P5WE 4BH7B 1CK0H 4GW1B 3QUZD 4XNMA 3PUUA 4BK5C 4GQZA 1AOHA 3W3BA 4QRFA 1IAIH 2DM2A 3EAYA 3V52L 2DH2A 5DT1L 2XA8L 3BPOB 5IB4B 2EDRA 1BLNA 3PUCA 1MH5A 1BREA 5TQ0L 4N28A 1H3XA 4OCSL 3GBMH 4NQEE 3RTQA 3HZYB 1EZVX 2G2RA 2ENQA 2QR0A 2G75B 5E94B 1I7UB 3QUXC 1MHEA 4KH2A 3MRMA 2GJ6A 3GSVB 3QPXL 4V1DE 4H8WL 1NUFA 4BRJA 4DULA 4K5OA 4PVBA 5K9OA 2ZXBA 4GKOA 2COVD 4GSXA 1HDMA 3IPFA 4U6HA 1DFBL 1EA9C 4YSCA 3RI5K 4PV9B 4X5QA 4KH9A 4LSQL 2VSDA 1MIMH 5CHNA 2DBLL 1MHPL 1W2KT 1K5NB 1Z9OA 3DETD 3EGSB 4X9GA 4P5MA 4X80H 4D9LL 4J1UB 4AY0A 3WFCL 1CD9B 4JK0D 4MCZA 2OJ1A 4NQUA 3UBGA 2IWFA 1XGUA 4YXLL 4H1LG 4LLYB 4M8QA 1KGCE 1J8HE 4MAYB 4XCYA 2H4LX 2F7LA 1QN8A 3UAJA 4TLUA 4ZQKB 3U36A 4OBSA 3LPWA 5DK3A 4S1QH 1IBFA 3H42L 1MRCL 5FO8B 2FAUA 5EIIG 1M2VA 4ZS6C 2W9LA 1GGCH 1RFDH 1OSPL 2DPKA 2XZCH 1UGNA 2BSDA 1IC5L 1QNEA 1F1GA 5CU5A 4NKMA 1JS4A 2IAMB 4R4BA 5G5DB 4QJ5B 1IBHA 3HTLX 2CMRL 3V7AE 4KGJA 4TSBL 1FYTD 1JUFB 3MLSH 1EV2E 1V7ML 1EK3A 4FNRA 4Q0XH 4UT6H 4F3FB 1CGUA 1WWAX 5FYKL 3B4NA 4I3GA 1NZRA 3B2DC 2R51A 1KXTB 4WO0A 3LIZL 5EO9B 3PWUB 1IGFL 1OSEA 1S7VA 4NI3A 4Z3IA 1VOKA 4R97C 4NOBA 5IB1B 1D5RA 4UV7L 4HGKC 5F7DA 3ZDZF 4AITA 1N0XH 1PX4A 3CZGA 3IU3A 3U1SH 4KTDH 4U1IB 1ETZA 1XIWD 4G1EB 5JNYA 3APMA 3ZDXB 4XWOD 3ETBF 4RZCB 4I13B 3VFGH 5IFHL 5LKNA 5H94A 3FB5A 4GMSL 2WLIB 2X4NB 3JWNH 4OIFA 1Z66A 5IMOB 2HLAB 4JY4A 3MLYH 4LPCA 4CNIB 2VMFA 1B4RA 2IANE 3QUYB 3IFNH 1G7IB 3WFDH 5D55A 1X7QB 1O75A 3DUSB 4CVUA 2VXTL 4LPUA 1L0XA 4NAJA 4ZFZB 1U8QB 3IDIB 3D9AH 4QRQA 3W11C 4BK5A 4IBQA 4NUJA 1JD7A 5D72H 3QEHB 4PRPD 5ADOH 1AIFB 3TTSA 3BGMB 2FBOJ 2XKNB 1IVLA 4ONHB 4DPBX 3P4OB 1S7WA 5I74B 4YEFA 3C09B 4YZFE 3PCYA 1KYFA 1NCGA 2YSSB 1TZHB 2HRHA 4TNEA 2MNWA 4YDVA 4AVJA 4DVBA 1BM3L 3PDDA 4HZ1A 2Y8LA 4U1JB 4P06A 5A2JH 1QX1A 1EVUA 1VEPA 4LVHB 5ENWA 1RUML 2AKRA 3QUXA 1GS6X 5AD0A 3JQOB 3SNSA 1E9OA 1H3WM 4FTDA 3ZUCA 1H5BC 1A3RL 1TDQA 3OPZH 1HXYA 4IIZA 2JOIA 4WJG3 5DMIL 4TQ8A 5CO1A 2CCWA 3GSXB 2MPAL 4H1LA 1L3NA 4NBXB 1KYUA 4MS8D 4HVBA 3FU5A 2V2WB 4X5PA 1QSFD 1RZKC 3TBTA 2HFEA 3ZKSD 1R4XA 3NVQA 4N2LA 1ICTA 2R5XA 4DT2A 4I87A 4GI9A 5EIIA 1LK2A 2B1AL 1S5IL 3OAWA 4HD5A 3MV9A 1JV5A 2IQAA 4PHZA 4URTB 2HT3C 4UTBH 4P9HL 4DOHE 4I3SH 2OJZH 1QAWA 2VKWA 4XBEL 3ZE1E 4FXKC 3S97C 3STZA 4FF9A 3ZRSA 4UNTA 2OM5A 1NAKH 1SOQA 4P2OD 4HIEB 4WHTB 3ROLA 3VJ6B 5HI5C 2VLKA 1NEPA 3BKJH 4D0CB 1JZJA 4OZFB 4B0AA 1R3HB 4G6JL 1IE5A 1S9XB 2XZAH 5JQ6L 1B0IA 4JGMA 4X8JA 1VTOA 4X9HA 4H13C 4MMXC 4QXTB 2FR4B 1AR1C 3TNNB 1JGVH 1QSZA 4UQ3B 4R26L 5HVHC 1S7XA 2VIRB 4GS7B 3K5RA 1J1OL 2FYYB 2ZCZA 4PP1D 3VU1A 2FL5A 1EVTC 2YK1L 2NLJA 3RWCB 1IMHC 1B4JL 4U1SB 5D7KD 3ZKQD 3I6LE 2PW1B 4YHIA 1A2YA 3ZE2E 3LHPL 3DLQR 2OFQA 2JHNA 4Y4KB 4Z5RA 4DPRA 1G84A 3CDCA 4Q52A 3RA7H 5JW5B 3DROA 1DQQA 4G7YH 1A9VA 5FFLA 4BFIA 5DJXA 1X4YA 4EO5A 5KVFH 2R8SL 1KCSH 2Y0SA 1ZS8B 2YSTA 3MUY1 5T1DL 4MA3A 3LKOA 3AW5A 5DFAA 4L8CB 2NW2A 4XP6L 3LXAA 3SPJA 4DKFH 4NQCB 1JRHI 4UTBA 1YDPB 2CPUA 3KPMB 4PRBA 1KXVC 1PZCA 2LTQB 3CZJA 3U82B 4BUQA 3FQ2A 2GEQA 1RURL 4PWKA 5C09E 1B0GA 2WXIA 3EH1A 3PF2A 1E5UI 4QHUB 1AGFB 1R5WB 2CKBA 1U8OB 4GMTL 3T77B 3PJSB 3PNWA 5ICXA 1G6VK 3I6SA 5IVXB 4WJ5A 4NENB 3GMLB 3BGFC 3Q2VA 3P3UA 1NOLA 4IQHA 1QN7A 3O0RH 2F7IA 2H1PH 1UM5H 1LXTA 3LTVA 2D03L 1NGXA 1RZKH 5H35A 2Y6TE 3MV7D 4ZZFA 5I8OH 2KBGA 1SF5A 2MKWA 3CVIH 5FW7A 1QBLH 4C4KO 1MH5B 3QXAA 4B9FA 9CGTA 1K2YX 1FNGA 3T6XA 3RTQB 2X4UA 5KVEH 1P0SE 2G2RB 1UHVA 3P9LA 5EF3A 4I85A 4M1GH 4P07A 3CDZB 5FFOA 2VWEE 4OCWL 1G6RH 2GJ6B 1WS7A 2DD8H 2IDUA 4KITB 1R33A 3N6YA 4LGPB 5CAYB 3KBPA 3AAZA 4KTEH 3SPGA 2G0KA 3BO8A 1HDMB 5EWIL 4ODSH 2MOGA 3VQMA 1CGVA 4UAOC 1LWWA 2JSFA 1KV3A 1F4XL 2YRPA 3HC2A 2VW6A 2CGRL 4XPBH 4UQ2A 1B4LA 3WHE0 5FYJE 1HSBA 5E2WL 1H5BA 3NDZE 4ODTL 4P5MB 3WMSA 1FGVL 5J3HC 2OCCB 4AQ8A 4YDIH 1BQKA 2EE9A 4FQQB 2DM3A 1RVFH 1RHFA 4LP5A 4M8QB 3UYRL 4UT7H 5EBWA 4K23L 2Y5EA 1HHGA 5AW5B 3HHMA 4JQXC 1E90A 1EAOA 5E2VL 3FPYA 1YAZA 1EGJH 3K6OA 1KJMA 1IAIM 3RX5A 3W57A 1M2VB 1WE5A 4TNVF 2O5NA 3I9AA 3NPSB 3ZGIA 1J7VR 1DQJB 3IETA 4FXKA 4M1DH 1L4IA 3DK2A 4NKMB 2Z4QA 4N2MA 5MEQA 2LLGA 3F05A 1NGMA 2JQZA 5I9QC 2WXKA 4OJAA 4ZW7A 5D1XB 3IAPA 2ODHA 5DVNA 2LW3A 5I30H 3UXFA 1QFPA 2NY3D 1PAZA 3SGEI 1M1XB 4GUPB 1ZWIA 2Q0ZX 1DBJH 3WY1A 1C7SA 1YPZA 4F7PA 5HHPA 2Z34A 3NFNA 1FFOA 1OO2A 2HLFD 2W38A 4FQ2L 4L3AA 5IJBC 4PJCF 4OV6F 1NCNA 5A6IA 5JLZA 2I60H 1AQ8A 3IU3B 1MNUL 1FFPA 1ETZB 5IGXH 4AW4A 3RDTA 2ATKA 1MCPL 1VFUA 5CF3A 3OH6A 3KPSA 2X4PA 1F42A 2WLZA 3CJJA 2RR3A 1EUVA 4Y9BA 4K4KA 4CDGC 3CW7A 3BAYA 3P30L 1XCWA 1OARH 1MG3C 2W9DH 4JKNA 3U1PA 3NSXA 4NS0A 5AB9A 1KXVA 4JY4B 4R7VA 3P77A 1RXLA 4ERSH 2FEJA 2Q8BH 3SDYL 5ITBH 4X7TA 4WEEA 4IK6A 1JFIC 2D8KA 2VO5A 4PAZA 3ISYA 3NJVA 1ZLWH 4AQEA 3HNTH 1Q9LA 3P11L 1SNRA 2C4XA 3BP4A 1MELA 4QRQB 2JJSC 1OGTA 4IBWA 2DJSA 1IFRA 3N1PC 2PWGA 1YN7B 4JL2A 4DO6A 5DFVD 2CDGA 3ZDZE 5FIEA 5AVTB 2YARA 3BD3A 1S7WB 2Z9TA 4YDVB 2YJLA 2UUDK 5BJTB 4DVBB 2X2JA 1GYVA 4MNGE 3AMLA 3JTBA 5DWUL 5AZUA 2V3DA 1XAKA 2W07B 3AADB 3PP4H 1ANUA 4N8PA 2AXGA 2PCXA 5AD0B 3LZQA 1E9OB 2X89A 1X5KA 2XX1A 1TBPA 2X6CA 5MENA 1HXYB 2CK0L 3K6FA 1P4LA 1Z1WA 4WK2B 1IL1A 3IE9A 2FNBA 3ETBJ 3FULA 4NCC1 4HLEA 5E70A 1D5MA 3G6JF 4EDXA 2B3IA 2BFVH 3TBTB 2HFEB 5FYKD 5C0AD 2IPKA 4WI9A 5DS8B 3A6OA 1L9TA 2YD4A 3BIAX 3TEUA 1KELH 3MV9B 3IDXL 1KPVA 1P2CA 2P8PA 4EIZC 3KLKA 4GXUM 5E2UH 2VUOA 3STZB 3II1A 4HZLA 1V54B 2APTA 4NUGH 1T5XA 5BO0D 2VLKB 4JN1H 1QNZL 3NOIA 1SLVA 4UIKL 4XO8A 4Y16C 2WC7A 1SJHB 1LO4H 3N5AA 4FL4C 4O2CB 1ZGLA 3GBDA 1NCJA 4TOYL 4X8JB 4XMKL 5CD3A 5GS0L 1DCEA 3T8XA 3HE7C 1F6FB 1UXSA 4F58H 1GGYA 1RIUH 5JOFA 1BF8A 3F7YA 4PU2A 4X6DB 5D5MA 1S7XB 1DQIA 4W9DC 1AGEA 3QNYA 4OQ1A 5KUMA 4JDVA 4HSAC 5FW8A 3TBBA 1A4BA 3MACH 4P9ML 3SGKC 4PFEA 4PJHE 3J07A 2WYTA 3DYOA 2XPZA 2C9PA 2IADB 4MAUH 2J20A 3QGVA 3LS5H 4Z5RB 1KPRB 3ULUE 2VDRB 1PD0A 2ODIA 4HUMB 2F0CA 1NWOA 3GSUB 4DP1X 5I0YA 1DQQB 1H0DA 3QEGH 2F08A 4G8IA 1HEJC 5K93A 2QREA 3EOBA 3HJEA 1AGBA 3LKOB 1PLGH 2I69A 4HIXH 4MA3B 1X5YA 2D7NA 4PWGA 3HNSH 5DRWB 3RL1A 2NW2B 4XVTH 1YQVH 4KO6A 2YXVA 4P4KC 5E6UB 4GIPD 4Q2ZB 1YYMH 2HKFL 4JFFB 4NEHB 1RY7B 4P46C 5HYIA 4L1BA 1N5YL 3NH7L 3U7WL 4B50A 1O9ZA 4ALAL 4LCWE 1RMFH 1C5DA 3PNWB 2X42A 3EYSL 4Z3EA 4WJ5B 3RKDD 3GTVA 1WZLA 4A04A 2HUEA 2VSMB 1CICD 4ZOBA 2BOCB 3TBVA 4K0OA 5HHQB 2X9XA 5AN4A 4AEHL 4X6EA 3MV8D 2YA3A 1AD9A 1NGXB 5DRZA 3RVUC 1RKRA 1ETB1 3R1GH 5H35B 5IMMB 4O2EA 3RTLA 5H2BA 1SM3L 2LR4A 1WAAF 3EH5B 3RWEA 4U7MA 1GOFA 1D5BA 1U8LA 4CC0A 1J5DA 1MQ8A 2HJKB 5CJ5A 5CBEA 1DE4A 1IC4H 1TEFA 3WTSA 5JIKA 4MVBC 4L18A 2ICEB 3FUMA 2BWDA 3QR2A 1FNGB 2ZXEB 1DBKL 5CKAA 3UBXG 4XE0A 2CO4A 2H0JA 4PTTB 3R4DA 3ILDA 3P9LB 4KKZA 1JAEA 4YHMH 3EBIA 4M56A 2IALB 3QQ3A 4AG4H 25C8H 5AQ0A 1THAA 2GY7B 2I7SA 5BVPL 2BVTA 3FCTA 3FOLA 4D7BA 1H6UA 4OBRA 4QHNB 3IDYB 3FUEA 5F7NC 2NXYB 2GC7C 3P54A 4QLRA 4RFNC 2GHWB 2A9NL 4UQ2B 4EAGA 1CI3M 3P2TA 2A6IA 2VQ1B 1IU1A 1P84J 3FXIC 4PB0L 3HMXH 4RGMB 2NVMA 1MWAL 3KJ4B 2XQBL 4NZRH 3FT3B 1BMWA 1P7KA 5FGCE 4OLVH 4KVCL 5K39B 5A2AA 4JO8A 4F33A 4DJMA 4G2AA 5ES4B 1JZ6A 3UW2A 5FO2A 4IBTA 5EUKA 5CD5C 1ID5I 5EBWB 4I2XB 3E8UH 1WGVA 2FUQA 4B9PA 1GTNA 4NWTL 1HZKA 2BS8A 3ISRA 2ZOOA 1NLDH 2FGZA 1DQTA 4XAKE 1UXMA 1EBPA 3LHAA 2BY1A 3I3WA 3MUJA 4HUCA 2ZKHL 3PL6D 2QZ5A 1JIBA 1JSYA 4JG5A 2R29L 4N26A 4A7SA 3IETB 4AV4A 4Y2OB 2C1PB 4B5EA 5FHBL 3RIKA 2Z4QB 3GHEH 4UYPA 3VFVA 1AZNA 3EJPA 4WX8A 1PCSA 4NSKB 4OB5L 4DGYH 1A4JA 4Y16A 5F3FA 4MJIE 1B88A 4KX7A 2WTRB 1P9MC 3V0AC 3BH9A 1UATA 2ZYRA 3TO2A 3HE7A 4NQTA 2NY5L 1D7DA 3Q3GB 4QF1A 4I89A 4OZIA 3HMWH 2H1XA 2K1MA 3TJEH 3FN9A 1YPZB 2I27N 3KYKH 1FHGA 4F7PB 1I82A 1A3LL 1MEXL 1FFOB 3LS4L 3NFNB 5DK2A 5IQ7H 3SGKA 3DX8A 1E9QB 4GP8B 3FKUS 4F80A 1IQWH 3WTYA 3LKPA 1WFOA 4LQFH 5JLZB 2ZXAA 5L2KA 3IFPB 3T0EB 2P28B 3ERXA 3AABA 3J7HA 4NNPH 5EFIA 2ATKB 4QHMA 3RDTB 1OAKH 4BCYA 2D7PA 4WRLA 4WTWA 3NSJA 4HPYL 4AYBA 3APCA 3VW3L 2A1WH 1KN2H 1UZGA 1XGQB 2D7OA 1ZTMA 4K3DL 1VEMA 1LO0H 1M7XA 4OCNC 2R23B 1YSOA 3ME0A 3P77B 1HEZA 3PAYA 3ZO0A 3MTXA 4M4PA 4P46A 1QR4A 4HD9A 4OW6A 4HWBH 3GI8L 4XNBA 2HVKA 4X7TB 5GGVH 3SDDC 1PY0A 4IU3A 3O6KL 4KKPA 2PYEE 4N90D 2QLVB 2Y7SA 4AQEB 3APFA 3FQUA 3O2WL 1GR7A 1Q9LB 3UBXA 4Q9RL 1OGTB 4UV4H 4ZPTB 3TS8A 4X4MA 5FLVA 4PJCE 4WI0A 3KL5A 1MVYA 2CDGB 2F5AH 3AREC 4BQBA 3OSVA 2WUBL 1NMBH 4RH4A 3VFMA 1EEYA 4HC1H 4KRPB 2ZKXA 2WB1A 5FUOL 3O3AA 5IYDP 5CWSB 5MERA 2IH3A 4G3YH 1OWRM 2DS4A 2YUWA 4UU9B 1WVZA 4GAYA 2EEDA 2A9MH 3MLXH 3VD9A 2QPEB 4OGQC 2XWXA 4MJJA 1UM4L 4PJ8B 3IDGA 1BF5A 2Z0BA 1CT8A 2A77H 2XWRA 4P3CL 4TTDD 1CR9L 5DJ8B 3P9MB 1I7RB 1FNFA 1MCRA 1UURA 1XF5B 5AYQA 2ICES 5KSBE 4YIQB 5MENB 4LAJH 5JW3H 5A2FA 5MP6L 3MBED 1NFDF 4EE2A 3W38A 2A83A 1OT2A 2P80A 1SHXA 1X6LA 3COOA 2VH5H 1UZ8B 1AI1H 4OQTH 5HHXH 4ZX4A 3U4KA 3DSNB 4HFWB 3KL0A 3TZVC 4LRNH 1Y18B 1IM9A 4AH2A 3VXMA 1KPVB 2ADGA 4J3TA 5C07E 1MDAA 2DLEA 4DAGH 1FG2A 4HCRH 1YUHA 4PJEF 5T5FH 2DQJH 3SDAB 2CU9A 1QPXA 2OTUA 1XSIA 3RAJL 1EHNA 4N5EC 1GYUA 3FTVA 5FYLE 5DHVB 5I6PA 4AJYV 2V33A 1ZGLB 3MGTA 1QLRA 1G7LA 3O6LH 1N7MH 1R5IA 2W60A 3QIUD 5ETUA 2VUYA 5CD3B 4OLYL 3KLHD 5DEFA 3T8XB 1UA6L 1OPOA 1S9YA 1IAKA 2D9CA 4YL9A 3PDOA 3DIFA 3RUGF 5JOFB 3CBJB 3F7YB 4AYFA 5D5MB 2PCPA 2B2XL 5GRZA 3QNYB 4JDVB 1MREH 4NKIL 2WM0A 2ICWA 4XAWH 4NDMB 3FJTA 2NLVA 2QSTA 4RVBA 1J10A 1YHPA 4A2EA 1SXCA 1P9MA 3ZMEA 4TPRL 1YMHA 4XNAA 2M83A 3T09A 3SQOH 1FAKT 1HQ4A 3A21A 4YDNA 3TT1H 4YGVA 2EE3A 4G8IB 4DK3A 2IGFH 2JE8A 4NKDA 1DIZA 2DKDA 5FECA 3W2DH 3EOBB 1F5WA 1N4XH 2FE0A 3E1F1 3RL1B 1UWXH 1Z9MA 3H0TA 1HFUA 2WWOA 4LLWB 2B39A 2JCCF 3WEBA 1PTZA 1GIGH 4QRBA 2XYBA 1DEDA 1ZMYA 4O58H 3UACA 3GBEA 1QBML 5FDWB 1JE6A 32C2B 3IFLL 3KM2A 4UQBA 5JHLH 4HJIA 3WIHH 2WO3B 2G3XA 4YK4C 4Z7QE 5FAAA 3B1TA 3TBVB 4KQ4L 4EIBA 3WLWD 1AP2A 4X6EB 3KZ8A 1AD9B 3WXWL 5DRZB 3SD2A 2KQMA 2ZT9C 3VGFA 1XEUA 3J8F7 4BGDA 4O2EB 3L16A 4UANA 2YEZB