2D0BA

Crystal structure of bst-rnase hiii in complex with mg2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0bA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0bA02
4CJTA 1Z26A 4PWDA 1JKHA 5SZTA 3K57A 3OYCA 4B9NA 3IS9A 3ZSRA 1BHLA 4RG8A 4DU4A 3ZSYA 2DTUA 2P51A 3HVTA 3HPGA 4FLXA 4DF4A 4PUOA 3V9UA 4CJKA 1ZBUA 3DM2A 3KLGA 3SPYA 1I39A 2HHXA 3AO3A 3CQ8A 4DLEA 1U04A 4I2PA 1JLEA 5IYCP 5I42A 1TAQA 2G8IA 3DLGA 1EP4A 3KIOA 3DRSA 4BE1A 4DTSA 2VWKA 4ICLA 1NJWA 4YNQA 3HVRA 2YHAA 1QTSA 2BANA 2FBTA 2WONA 3C94A 4XIUA 4NYFA 1NJYA 4DS5A 3PO4A 1KLNA 2BGGA 3B6PA 3LAMA 4OPKA 3TABA 2ATQA 1XWLA 3MECA 3NH1A 5KRSA 1C6VA 4CF9A 4F2RA 4UQGA 1RBVA 2DFFA 1VOKA 1A5XA 2XY7A 3O4QA 1HRHA 3VQ9A 3QIPA 3QETA 1U47A 4AH9A 5K14A 1WAJA 4M3UA 1TGHA 3LANA 3TWHA 4FJ5A 3KJVA 3RMAA 1U48A 3K59A 3PO5A 4FJGA 3SJJA 4E7JA 3CM6A 3CFPA 1YTBA 4M3TA 3QEXA 3ULDA 4EP4A 3L8BA 1C0TA 1HNIA 3JSMA 3CFRA 3U3YA 3AVIA 4KAZA 4E3SA 1I3AA 3QINA 3TAEA 4OKJA 5JS1A 4DQIA 4MFBA 4FK0A 4QAGA 2OPSA 4CECA 4E0DA 4IFVA 1RDDA 4CHYA 3LP0A 3WNEA 1S1VA 1WSFA 1KYFA 2IOCA 4CGHA 4HVJA 2AJQA 1RDAA 3TAMA 3QNOA 3AA2A 3OYMA 1L3VA 5HRRA 1JLAA 4FJKA 1RCHA 3D0PA 3L2WA 2ITGA 3G0ZA 1W80A 2KQ2A 1NGMA 4E1MA 4PQUA 4CIGA 4DTMA 2OPPA 4FJNA 3QESA 4FJ9A 1VSEA 5E41A 4BACA 1N5YA 1CDWA 1KTQA 3AVKA 1KSPA 5FRMA 3MXMA 4CE9A 4F3OA 4DS4A 3VQPA 4DMNA 4HCBA 3NH2A 3OVNA 3VA0A 1HQEA 4FK2A 1NVPA 2P5GA 4NCGA 2PY5A 1W9HA 4DTJA 3ZSWA 1GOCA 2E4LA 2Q3SA 4CFAA 3HP6A 5J2NA 1XHXA 3OYEA 1TBPA 1T05A 1VK0A 4HHTA 5EU7A 4E1NA 3ZT0A 1CZBA 4CGFA 1QSSA 3BGRA 3RR8A 4F4KA 3KD1E 3ZSOA 1TL1A 3WNHA 3KK1A 4M41A 2RF2A 3ZSXA 4AHUA 3VQ7A 1BCOA 3RRHA 3THVA 2D0CA 1QNBA 5KRTA 2FBVA 2HB5A 1TK8A 4PA1A 4LY7A 3OJUA 4FLWA 2Y1JA 2B4JA 1WSHA 4B9MA 1RBSA 1LWFA 1RBTA 3CM5A 1U49A 1RT7A 3QEVA 3D45A 1KYUA 4CESA 4Z4EA 4I2QA 4M45A 3TARA 2PZSA 5I3UA 4IFYA 4B9LA 4Q0BA 3V9WA 3VQ5A 4CJ3A 1IH7A 2XY6A 4CK2A 4DTNA 3OC3C 1NOZA 4H4MA 3AO4A 4BE2A 1WN7A 4FZXC 4AHVA 5HRPA 3V9SA 3RRGA 5CZ2A 2VG5A 4KTZA 4DFKA 3S9HA 3PX0A 3QO9A 1J5OA 4IDKA 4PY5A 5HRSA 3L2UA 4FLTA 4WZSD 2YNHA 1AISA 3CFOA 3NFAA 4ID1A 5C25A 2HW3A 3SV4A 4KKOA 3V81A 4CGJA 1BISA 3DMJA 1NK4A 4DFJA 4CEQA 3S3MA 4F8RA 1HYZA 3SV3A 1JLBA 2HMIA 4G1QA 4CK1A 3DLRA 3NCIA 3VQBA 3OYHA 5J2PA 3M8QA 3SI6A 1O1WA 1SUQA 1XC9A 4FJHA 3QEWA 4C8NA 2OZMA 3OYFA 3CG7A 1WNSA 3OYAA 4CF1A 1TKTA 4CFCA 4DSFA 1IG9A 1VTLE 1VSKA 3AVFA 2DFEA 1RDCA 4CJRA 3I0RA 3K5MA 4C8LA 3L2VA 4CERA 5CZ1A 1QS4A 1SL2A 4EZ6A 2X6NA 2OYQA 3MEGA 4DU3A 2VJ0A 1ZBLA 1NKCA 4W5NA 3DOKA 3SNNA 4FM1A 1YVUA 1JL1A 1JLFA 5J1EA 4B9VA 4C8OA 1KYDA 1KLMA 1SV5A 4DQPA 3LAKA 4FJ8A 4M42A 1HMVA 4O0IA 3MXIA 3ZT1A 4C8KA 3P5JA 2QXFA 3PX4A 4E7LA 4DSIA 4O5BA 4BDYA 4FJ7A 4DTUA 1VSMA 1FXXA 4F3TA 1SKSA 3NGZA 1NJZA 3TAQA 2O4IA 1EETA 2RPIA 2YKNA 2X74A 4GMJB 4RW4A 1VSDA 1XI1A 4DQQA 2P5OA 4KV8A 4DFPA 4B9SA 3HPOA 3HM9A 3T3FA 2G8HA 3SQ2A 1RT2A 4OPJA 3L2QA 4N56A 1BGXT 4N76A 2VWJA 2F96A 1HNVA 2YKMA 2KZZA 2DY4A 4M3WA 3C6TA 3VQDA 1L3SA 3DLBA 2G8WA 3LP3A 4K8XA 4R5PA 3IRXA 3OYGA 4ID5A 1Q8IA 4FZZA 3HO1A 1UA0A 1DLOA 1NOYA 2OPRA 2YV0X 3WNGA 3SQ4A 3EIKA 1IKWA 1UA1A 1L3UA 2HHQA 1YTAA 2Y1IA 4CIEA 3KKRA 4DLGA 3K5NA 4ZTJA 1VRTA 2PYLA 3P1GA 1VSLA 2IV9A 4EP5A 4JS4A 4JRPA 3SCXA 3VQ8A 2OA8A 2LSNA 1A5WA 4B0AA 3SZ2A 1LAWA 3ZT3A 4C8MA 4Y1DA 1WAFA 2KW4A 5KGXA 1TK0A 2GV9A 4N5SA 4KTQA 2YNFA 1QSYA 4QOZB 1VOLB 4DTXA 4CJFA 1TKDA 4FM2A 3RMBA 2FBYA 1BIUA 5HRNA 2XY5A 3ZT2A 4OLBA 4DF8A 1KFDA 4OLAA 4JS5A 4DU1A 3OYLA 1NK0A 1QN6A 1SKRA 3IAYA 2E6LA 3ZCMA 1HQUA 1X9MA 3HS9A 2HHUA 2KFNA 3ZSVA 3AVAA 4KI4A 3AVMA 1QE1A 3AVHA 2OPQA 3AO2A 4CF0A 4TSXA 1VSFA 4CEBA 4FLUA 1QNCA 1D5AA 1KFSA 3NF9A 5FRNA 4GVMA 2XHBA 1D8YA 3H1ZA 3VQ4A 4CGGA 3MEEA 5HP1A 4NCAA 3HK2A 1LW2A 3NAEA 4KPYA 4ROEB 2Z8UA 3V1OA 1X9SA 2A1RA 1RTIA 4DSJA 1NJXA 3AV9A 3DRPA 4LD0A 2HHVA 4E7IA 3LALA 4H4OA 1R4XA 1KY6A 1KVAA 1UOCA 4J2BA 2R7YA 4B08A 4ROCB 3ZSZA 1RDBA 3TAGA 5FDLA 3ITHA 2PYJA 3SUQA 4F2SA 3AA3A 4FXDA 2OZSA 1NKBA 3H08A 4FK4A 3L3VA 4IKFA 3AVLA 3V9ZA 4HUGA 3T19A 4LH4A 1C1BA 1BIZA 1FK9A 3AVBA 4AHCA 3MAQA 1TGOA 3OYKA 2KZMA 1A5VA 1QN5A 3QLHA 3M8RA 3K5LA 4AHSA 1J54A 1LWEA 1NH2A 3SQ0A 3U3GA 3RMCA 4KHNA 4Z0UA 1KRPA 3DI6A 4HUEA 4IBNA 1NK6A 4J2AA 3KD5E 2GBZA 4FJMA 1LWCA 1VRUA 3ALYA 3HL8A 5CY4A 3ZT4A 4B8AB 1HPZA 2EHGA 4I9LA 3KLEA 4BE0A 1S1TA 4E7HA 4NCBA 3CYMA 3VQ6A 3KK2A 3RR7A 4KI6A 3AVCA 4BDZA 1RT3A 2A1SA 2HNZA 3WNFA 4W5QA 3PV8A 3NBPA 1RT1A 1REVA 3S3NA 4CGDA 3P83D 1SL0A 2HVHA 4FZYA 2DFHA 1VSJA 3C95A 1TKZA 1IKXA 1JLCA 3PX6A 3AA5X 5KTQA 1NK9A 2XO7A 4FJXA 4KHSA 4ELTA 2D0BA 4HUFA 1G15A 4KB1A 1QNEA 2IS3A 1F21A 3AVNA 3QIOA 3OJSA 1BI4A 4CJUA 3VA3A 3TAFA 1PCZA 3NF6A 1SL1A 3S3OA 4M3ZA 4FW1A 4Z4CA 4Z4IA 4Z4GA 4CEFA 1S5JA 1CXUA 3V4IA 1CZ9A 3MXJA 3KLFA 3TAPA 2ETJA 4ELVA 4FCYA 4FJJA 1JL2A 1QHTA 1HYSA 4BWJA 1BQNA 4B3OA 5CYMA 2FC0A 1RT6A 4CHZA 1EKEA 1VTOA 1T7PA 1BL3A 1S6QA 3VN5A 1X1PA 3DYAA 3SUOA 3NHGA 4B8CA 4H8KA 3L2RA 1YTUA 4J2DA 4W5OA 4E89A 1NK5A 1Y97A 1C9BB 3SUPA 4DSKA 1HJRA 1KVBA 3OY9A 4EZ9A 4B9TA 2EX3A 4I9QA 3DLEA 1DTQA 3LPUA 2IC3A 4BDPA 2ZD1A 4FVMA 1FKPA 4QCLA 4IG0A 3QEIA 2WOMA 1C0UA 2ZQBA 3OS2A 1CLQA 1GOAA 4RODB 1TL3A 3MEDA 3NGYA 1E42A 3LWMA 1K6YA 3TR8A 1J9AA 1JLQA 4KHUA 5HLFA 1LAVA 1UAXA 3SUNA 1RT4A 5C42A 3SQ1A 1T8EA 3M8SA 4O55A 1KVCA 4FJLA 3G10A 4N47A 4ELUA 4OGCA 4AILC 5D3GA 3TI0A 1PZDA 4Y1CA 2XY8A 3NH0A 1TBAB 1C1AA 4CJSA 4YFUA 3V9XA 3K58A 1QQCA 4Q5VA 2VG6A 3UIQA 1MP9A 2JLEA 4K8ZA 4CJ4A 4DTOA 1QN3A 1QN9A 1MU2A 4IG3A 3OYJA 1Q9YA 1NKEA 4O0JA 1B9DA 4N41A 3HP9A 1GOBA 3DOLA 4CF8A 5CYQA 3VQQA 2FBXA 2MJ7A 2B6AA 4I7FA 1T03A 2GUIA 3RWUA 3NGIA 4CEEA 4KFBA 4OJRA 5C24A 1IKVA 2HNYA 1D3UA 3AO5A 3OYIA 3ASMA 2Z1GA 3VQAA 3BDPA 1D9DA 3PY8A 1B92A 1RNHA 2XRIA 4OVLA 1RBRA 1C0MA 3PUFA 3F9KA 4W5TA 4FLVA 1RTHA 1TV6A 2YHBA 5HBMA 4FLYA 4MQ3A 3OS0A 2ZE2A 3EYZA 4KHQA 1EX4A 2RKIA 1S1XA 4OKEA 3HT3A 2B5JA 2G8VA 1B9FA 3KLHA 3LZJA 1N6QA 1D9FA 4DG1A 3A2FA 4CJPA 4CHPA 1RTJA 1RILA 1QSLA 4FJIA 1U4BA 4AHRA 1J53A 5T7BA 4CFBA 4DQRA 1UWBA 3HPHA 3LP1A 1QNAA 3RTVA 1ASVA 2VG7A 3KKSA 4DTRA 2G8UA 1IO2A 3NDKA 1FKOA 1ASWA 4KTWA 4KO0A 4JRQA 4M3RA 4Z4HA 3L3UA 3NF7A 3DRRA 2HHSA 3AVJA 4M3YA 4KREA 4AHTA 4DWIA 1JXBA 4LSLA 4CEOA 3OYBA 1L3TA 3LDSA 4M3XA 1BCMA 1HYVA 3LWLA 2QK9A 1ASUA 2Z1JA 5FROA 1WLJA 3O3HA 1TKXA 3NE6A 1U45A 1IKYA 2HNDA 3V1QA 1C1CA 4JLHA 3RMDA 4RW8A 4RW9A 3FFIA 3K2PA 1QTPA 3ZSQA 3VQCA 1SKWA 4NYNA 3E01A 2Z1HA 3M8PA 2P1JA 1YTFA 4CF2A 1WSJA 2YNGA 3U6FA 1QN8A 3HJFA 2X78A 1ITGA 4RW6A 3KLIA 2IGIA 1S9EA 2D5RA 3NF8A 4CEDA 5KGWA 3KTQA 1JXEA 4RW7A 3VQEA 5JS2A 4ZTFA 4O4GA 4CCHA 3B6OA 3IG1A 1TVRA 4ZHRA 3I8DA 1ZYQA 4CEAA 2IDOA 4O44A 1X9WA 3QEPA 3HYFA 4DSLA 4BWMA 1W0HA 3V1RA 3EY1A 2W42A 3SYZA 5J2QA 1NK8A 2X6SA 2HVIA 4LSNA 3C6UA 4Z4FA 2HHWA 3HXMA 3OYNA 3T1AA 1RT5A 3OCIA 1QN7A 2NUBA 1RM1A 1JFIC 3LPTA 1S6PA 4CJQA 4E7KA 5IYBP 5SWMA 1WSIA 4CK3A 1TK5A 1YT3A 3I0SA 3KK3A 2G8FA 1LW0A 2Z1IA 5DMRA 1ZBHA 3JYTA 1VSHA 1EXQA 1WSGA 4CFDA 5HROA 3DLHA 4CHQA 1KY7A 1BI4B 1CXQA 3O3GA 1RTDA 3O4NA 5KI6A 1R0AA 4E19A 3QERA 1NK7A 1Z25A 1ZBFA 4HTUA 1B9KA 4OKKA 2BE2A 2E6MA 4DTPA 3AVGA 1ZBIA 4CEZA 3HSTB 2YNIA 4FYDA 2I5JA 3HS8A 1JLGA 3ISNC 1LV5A 5IYDP 3DLKA 1RBUA 3QNNA 1VSIA 3TANA 1QTMA 2G30A 1WSEA 5J2MA 2QKBA 2O4GA 1S1WA 4CGIA 2G8KA 2BDPA 4KB0A 4KHWA 2QKKA 4OGEA 1BQMA 3F73A 4WE1A 4CHOA 2KTQA 2IAJA 2F8TA 2D0AA 2KFZA 4KRFA 4CJEA 4CJVA 1DTTA 3AA4A 2RN2A 3K5OA 4CJ5A 3OYDA 3AO1A 4CJWA 4DQSA 2F8SA 1TAUA 4LH5A 4FW2A 1L5UA 1KCFA 4CJLA 4KHYA 2HHTA 1XHZA 4HCCA 3SPZA 1Q9XA 5DK5A 1S9GA 2JGUA 3LP2A 4FLZA 4GW6A 1QN4A 3V6DA 3EZ5A 4B9UA 3O3FA 2IV8A 4CIFA 1S1UA 3OS1A 4DFMA 4J2EA 4CHNA 4L8RB 4FM0A 3LZIA 4DSEA 4W5RA
chains in the Genus database with same CATH superfamily
1Z26A 2Q2RA 1JKHA 4PKHA 1ZXOA 1BHLA 5IT9O 3ZSYA 3HVTA 3SAGA 3I0XA 3CIPA 4CJKA 1ZBUA 4WCEL 2A41A 1I39A 4EHUA 5GIPA 3I8BA 2UUCK 1TAQA 4FWSA 1C0GA 1SAZA 3DRSA 3EZWA 4YNQA 3PO4A 2FBTA 1NJYA 3B6PA 3TABA 1WOQA 1XWLA 2ATQA 3MECA 4BR4A 3NH1A 1C6VA 3ZYYX 5GAEP 3DAWA 1HX1A 3VQ9A 4Q11A 4DV7K 4LC9B 3WQTA 3PO5A 3VESA 4FJGA 1MPGA 3N89A 4WQ5C 1YTBA 3VERA 1T6AA 3WXMB 3ULDA 1N39A 4EP4A 1C0TA 1HNIA 3JSMA 4KAZA 1I3AA 2NNWA 3EL2A 5JS1A 3U9ZA 1KXPA 5C10A 3TSUA 4IFVA 3J7YP 4BR7A 1S1VA 1NJIO 2O3OA 3AGKA 3AA2A 5HRRA 3L2WA 1M3HA 2ITGA 1W80A 2KQ2A 4EAHD 4PQUA 4DTMA 3C65A 2NRVA 1KTQA 3AVKA 1S22A 4CE9A 4DS4A 3L4IA 3ID8A 5FPDA 1YQLA 1P90A 1W9HA 3ZSWA 4M7YA 2Q3SA 4CFAA 1ATRA 1W97L 2Q36A 5EU7A 4CGFA 4F4KA 4JYAK 1BCOA 3TTDA 4FWKA 2FBVA 4PA1A 2LAEA 4YOTA 4B9MA 3CM5A 3SAFA 2OTLN 4YORA 5EXWA 4QG5A 4B9LA 4Q0BA 3V9WA 1MWMA 1IH7A 2XY6A 3OC3C 2YH5A 1WN7A 3T69A 3V9SA 3RRGA 2VG5A 3DXKA 1J5OA 4PY5A 3C7NA 2NOEA 5KQ8A 2YNHA 4ID1A 3VTIA 1PCMX 3V81A 3CWUA 3DMJA 4NO7A 4DFJA 1HYZA 3EEQA 3A8YA 3SLCA 3OYHA 1SUQA 4C8NA 2NOIA 3QBXA 1BA1A 1QVGM 1VTLE 3O9UA 3K5MA 4C8LA 1QS4A 4JD2A 4DU3A 5AQLA 5BN9A 1ZBLA 3CCRN 1NKCA 4FM1A 1JL1A 3BP8A 5J1EA 4C8OA 4AM6A 1JJ2M 2QWLA 3LAKA 4CJ7A 4XH1A 1YI2N 2QXFA 3PX4A 3VEYA 4E7LA 3THWA 4DSIA 4O5BA 4DV4K 4GKKK 4DTUA 1VSMA 4H5WA 2YHWA 2RE2A 1NJZA 2RPIA 2YKNA 4GV3A 4KV8A 4B9SA 3HM9A 1QZ6A 2JOIA 2OOYA 4BVOA 1RT2A 4OPJA 3ZETA 1HNVA 3G71N 3E9LA 2NOZA 1ATSA 1HNXK 4JKFA 3IRXA 3KWGA 3OYGA 3RSMA 1NGAA 5AZJA 5FPEA 4PKGA 1UA1A 2HHQA 2HL8A 3O1BA 1SS6A 2EHBD 3LDLA 4DLGA 1VRTA 3VEOA 4CBUA 2QA4N 2ITMA 4JS4A 2J4RA 4B0AA 1LAWA 1WAFA 5AQWA 4LF5K 1PCJX 1LWYA 5KGXA 4BG9A 4N5SA 1QSYA 3M5RA 1VOLB 5AZIA 1TKDA 3I0WA 4JS5A 3IAYA 4LF6K 2QWNA 4HJHA 4BC2A 3HS9A 3ULXA 3ENOA 2HHUA 3AVAA 4KI4A 3AVMA 4ILJA 3AVHA 2OPQA 4TSXA 1VSFA 5HOOA 3NF9A 2XHBA 3QDKA 2P9IA 5AQUA 1LW2A 2A1RA 4DUZK 3MCPA 5AQVA 2O8EA 2P9NA 3DRPA 4MLEA 1BU6O 3H3OB 3LDNA 1OH6A 3SUQA 4F2SA 1YIJN 4FXDA 4YOXA 1NKBA 2OZSA 3WXJA 4IKFA 3B8AX 3BEXA 3GL1A 3T19A 1C1BA 3MAQA 3MDQA 4DV0K 4NXNK 1RDUA 4C1NI 3TPQA 4H0YB 2KZMA 3E9PA 4JKEA 3M8RA 3K5LA 3RMCA 4FOIA 4KHNA 1VQNN 3TTFA 4IBNA 1XNQK 4M63C 4FJMA 2CGJA 3TU5A 1HPZA 4E7HA 2OCEA 1RT3A 3S3NA 4CGDA 4RTFD 3WT0A 3DXKB 4FZYA 3OH6A 3C7NB 4JI7K 1NK9A 4A57A 4HUFA 2YJEA 1QZ5A 3ULEB 2IS3A 2ASMA 3QIOA 3CJCA 2I7PA 1SL1A 2JHNA 2D1KA 4CEFA 1CXUA 1CZ9A 3I3WA 3MXJA 3TAPA 2KLAA 4F9OA 4UY8O 1HYSA 5CYMA 3S41A 2FC0A 1RT6A 1EKEA 1T7PA 1BL3A 3VN5A 2VCPA 3CPWM 3RSEA 4E89A 1NK5A 3A5LC 4DR1K 2Q97A 4D7QA 1HJRA 3MN9A 4JD2B 2EX3A 4BDPA 5DM7L 5AQRA 3EE9A 1E3MA 1C0UA 2ZQBA 3NGYA 1TL3A 4B3MK 3O5BA 1E42A 3VEWA 3TR8A 3THWB 1J9AA 5HLFA 1NBWA 5C42A 1T8EA 4JKHA 3M8SA 3AAQA 5TKWA 4QS9A 4EHTA 4AILC 4H0XB 2XY8A 1IBKK 3V9XA 3ZETB 1FJGK 1QN9A 1LXTA 2Z0FA 1LWWA 3HP9A 1GOBA 3DOLA 1NGFA 2HBKA 4CF8A 3A0IX 1T03A 3CJ1A 2DKDA 3NGIA 4OJRA 5C24A 3BDPA 3VQAA 1D9DA 1RNHA 2XRIA 3PUFA 3F9KA 1RTHA 2YHBA 5AZIB 4DB3A 3J7AP 1WUAA 5BPLA 2GELA 4K25A 1M3QA 1D9FA 4CHPA 3SK3A 4FJIA 5AR0A 5T7BA 3NVMA 1ASVA 4BROA 4CZFA 3DRRA 2HBJA 4LSLA 2P9IB 3OYBA 3OW2M 3J8AA 1HYVA 2QK9A 1QVFM 3IDHA 3O3HA 1U45A 2HNDA 1C1CA 3R8EA 1S3XA 3FFIA 2KHOA 4RW9A 4NYNA 2Z1HA 1YTFA 3MN7A 2NOFA 2NWVA 4CF2A 4JNEA 3VETA 5EPCA 3F0ZA 2VGNA 2D5RA 1MA9B 4CD1A 3OHRA 4ZTFA 4O4GA 3FLCO 1WJWA 1EWQA 4X62K 3CJ9A 5F1XA 3M3ZA 3D2FA 3QEPA 3FFKB 3EY1A 3SYZA 5J2QA 4LSNA 3H46O 4IFEA 4Z4FA 5JLFA 1YQRA 4EAGA 1RM1A 4EALA 5IYBP 3J81O 3R9PA 5HROA 4CHQA 1VQ7N 1CXQA 1ESVA 4E19A 4HTUA 1YHQN 4CEZA 3HSTB 5BREA 2YNIA 4FYDA 1NGBA 3QNNA 4A2AA 3TANA 2G30A 4B3RK 1WSEA 5F9CA 2BDPA 3QMLA 2G8KA 5EVZA 1U2VB 2QKKA 4CHOA 5BN8A 4DUYK 2KTQA 3MWPA 2D0AA 3ZLJA 3DJCA 3DXMB 1DTTA 3K5OA 4B1XB 4CJWA 3LDQA 1L5UA 2ZFDB 1Q86O 3PDKA 3SPZA 4JI5K 4GW6A 2F9WA 3IKMA 3NVKA 2IV8A 4L8RB 5AQFA 4H5TA 3LZIA 4DSEA 4CJTA 3K57A 4B9NA 3IS9A 3ZSRA 3CF5L 1RFQA 3P38A 2DTUA 2P51A 3F2KA 4FLXA 3C6AA 5C15A 3R1XA 3DM2A 3RVCA 4LFCK 3AO3A 4DCHA 3CQ8A 4CD3A 1U04A 5EX5A 5IYCP 5I42A 4A5AA 4JI8K 4ICLA 1NJWA 3HVRA 1QTSA 2BANA 2WONA 1YJ9N 1KLNA 4R79A 1RBVA 3OGDA 1YQKA 2XY7A 3O4QA 5C2DA 1HRHA 4A2BA 1U47A 3AARA 3CQXA 5JVHL 5K14A 1WAJA 3C6HA 1CZAN 4EAJA 3CI5A 3QEXA 1NM1A 3CFRA 2HMPA 3TAEA 4MFBA 4FK0A 4JI1K 1VQ9N 2OPSA 4CECA 2D0PA 4E0DA 1IG8A 4CHYA 2HSTA 4MO5A 5BRDA 4CGHA 3AAPA 5AQMA 3QNOA 4YOWA 1Z6RA 1Q18A 1JLAA 4B1YB 3K9KA 2O8BB 1NGMA 4E1MA 3HTVA 4JHDA 5AQIA 1VSEA 5E84A 5E41A 3CERA 1DT9A 3MXMA 2VWBA 3ENOC 5A2QO 3FGUA 3NH2A 5FPNA 3OVNA 3VA0A 4FK2A 3VENA 2VGMA 4NCGA 2PY5A 4DTJA 1TBPA 1C47A 4FWMA 3VMFB 1GLAG 1TL1A 4K43A 3WNHA 2RF2A 4AHUA 3VQ7A 3THVA 1N36K 1TK8A 1OH7A 4DR5K 4LY7A 2Y1JA 1RBSA 1U49A 1RT7A 3QEVA 2QRDA 4JKBA 1KYUA 1R59O 4JKDA 4CESA 4Z4EA 4LFBK 4CK2A 2IIRA 4FZXC 3HRGA 3LL3A 5CZ2A 3PLAA 4IDKA 1AISA 3QICA 1BA0A 3SV4A 4KKOA 1RGIA 5M1KA 3WEEB 1NK4A 4BR0A 2UXCK 3UKRA 3SV3A 1JLBA 4G1QA 4NLBA 3VQBA 1K9MO 3SI6A 3M8QA 4FJHA 1O1WA 4IXCA 2OZMA 1KO9A 3CG7A 1GLLO 4CF1A 3T1HK 1TKTA 4CFCA 1M90O 3KD5E 1VSKA 3WXIA 1J6ZA 2DFEA 4DR7K 4CERA 3IUCA 1SL2A 2VJ0A 2QM1A 2WC9A 3NA5A 3SNNA 4X66K 4DQPA 4FJ8A 4M42A 5EY4A 5AQOA 2P9LA 4BDYA 4FJ7A 1FXXA 2GWKA 4EFHA 1EETA 1VSDA 1XI1A 4DQQA 3O80A 2P5OA 5JLHA 3CCMN 3T3FA 5M1PA 2G8HA 3I55N 3L2QA 1BGXT 3NMUA 3CHWA 3MMVA 2QI2A 4M3WA 4C1NK 3HO1A 3WNGA 3SQ4A 1YTAA 2F7LA 3THXA 2E8AA 3OSTA 1SZ2A 2RHKA 3O4WA 4ZTJA 2IV9A 4EP5A 2NOLA 2OA8A 2V92A 1GLDG 3SZ2A 4CZHA 4Y1DA 2KW4A 3D6RA 2QWMA 4FM2A 3D2EA 2FBYA 1BIUA 5HRNA 2XY5A 3ZT2A 1KFDA 1NK0A 1QN6A 1SKRA 2E6LA 1T6CA 4FWLA 3AO2A 3H1VX 4JHDB 4DV1K 1KFSA 4IZ9A 4GVMA 4IDHA 3VQ4A 2UUAK 4YDUC 4BRIA 5HP1A 2QWOA 3V1OA 1X9SA 3UB5A 1RTIA 1M1KO 5ADXA 3UE5A 5CHIA 2HHVA 4E7IA 3LALA 1R4XA 2R7YA 2NLXA 4DQ8A 4B08A 4ROCB 4AQYK 3TAGA 1NGJA 3ITHA 2PYJA 3AA3A 3H08A 4K0KK 2FKMX 4LH4A 1BIZA 3AVBA 1DEJA 4AHCA 3CMAN 3CQYA 5BPNA 3R6MA 3OYKA 4FVUA 1A5VA 3QLHA 4AHSA 3P4IA 3SQ0A 1NH2A 4A5BA 4IOCL 4DKWA 1NNEA 3MN6A 2GBZA 1LWCA 3ALYA 2KFNA 4I9LA 3SAHA 1S1TA 1VQ6N 4NCBA 3CYMA 4KI6A 5KPZA 1XMQK 2A1SA 2HNZA 3PV8A 3GE1A 1REVA 3TDHA 2NOHA 3P83D 1YAGA 3P39A 2DFHA 4RCHA 1TKZA 3PX6A 3H6EA 3VTHA 2XO7A 2JWLA 4KB1A 1HKCA 1BI4A 1E4GT 4M3ZA 3UKRB 1S5JA 1NLVA 1K8AO 2WUSA 1FW6A 4FJJA 1QHTA 3GDQA 1OVYA 4CHZA 3CETA 1Q81O 2QREA 3DYAA 5F0XA 4B8CA 4H8KA 1YTUA 4BC5A 1VQ4N 3TTCA 4DSKA 1KVBA 3OY9A 4JEPA 2FLOA 1NGGA 5AQPA 2E2OA 4BR9A 1GOAA 2P9LB 2P9PA 1RT4A 3SQ1A 1KVCA 4FJLA 2W41A 3ZX0A 2NLVA 3KTUA 1KAXA 4WF9L 4YHHK 3TI0A 5D3GA 1VAZA 2A42A 1TBAB 3NH0A 3ZX2A 4BY9C 4Q5VA 2VG6A 1MP9A 2JLEA 3CJ7A 4CJ4A 1QN3A 2UYTA 1MU2A 4IG3A 4DV5K 4N41A 1B9DA 1K8KA 4RWTA 2E2PA 3EKSA 5CYQA 3QB0A 2MJ7A 2NOBA 4I7FA 4X65K 2GUIA 1Z05A 4CEEA 3AO5A 3UIQA 3ASMA 3ATUA 4IO8A 4FLVA 2GWJA 2R5XA 1TV6A 4FLYA 4WXAA 3OS0A 2ZE2A 4WFNL 1YUWA 1EX4A 2RKIA 1S1XA 1X3NA 4MO4A 2B5JA 3LDOA 4CZKA 2G8VA 3LZJA 1QSLA 3A2FA 2O8DA 4BREA 5JVGL 4AHRA 1P5GX 3TSPA 3LM9A 1UWBA 3HPHA 1Y64A 2G8UA 2VG7A 4QS8A 1YJNN 4KO0A 4KTWA 4JRQA 1Q82O 4Z4HA 3L3UA 3NF7A 5B8HA 4AHTA 4CEOA 1ASUA 5FROA 3CCQN 3OLPA 1TKXA 1J5EK 3V1QA 4MDBA 1SKWA 5C12A 3Q7BA 2ZM6K 2YHXA 3CCSN 2I5WA 2ZF5O 5AFUA 4HTLA 1TUOA 3HJFA 3KLIA 1S9EA 4CEDA 3U8XA 3VQEA 4JV5K 4X64K 5JS2A 4YOVA 4CCHA 2ZWHA 3B6OA 3I8DA 3PIOL 4JKCA 2QLVA 4WQ4A 2JPIA 4O8KA 4BRFA 4BWMA 1W0HA 2HVIA 1NK8A 4GKJK 3OYNA 2Y8QA 3OCIA 2FUVA 2NUBA 3LPTA 1JFIC 2V9JA 3T4NA 4F8RA 4CK3A 1YT3A 1LW0A 5DMRA 1VSHA 3DLHA 2E1ZA 2CH5A 1BI4B 1RTDA 3O4NA 1R0AA 1ZBFA 1B9KA 1V4SA 2E6MA 3AVGA 2QEXN 2I5JA 3D7QA 3ISNC 5IYDP 4K41A 4DV6K 1OKJA 1VSIA 1S1WA 4KHWA 4BRLA 4OGEA 3F73A 4WE1A 2IAJA 4TPSA 3J7ZO 4IEIA 5LMUK 3C0BA 2ZJQL 1TAUA 4FW2A 1HUXA 2HHTA 2YJFA 1Q9XA 3LP2A 3VEZA 4EJYA 4H0PA 3T7ZA 1QN4A 4B9UA 1S1UA 3OS1A 4CHNA 2IVOA 4BC3A 2HL9A 5JN5A 3A5OC 4PWDA 5BR9A 5KPRA 4WFAL 5AQYA 4RG8A 4DF4A 4MDAA 2V7ZA 5AZJB 2XHIA 3AY9A 3KLGA 4DLEA 3CCVN 3W3DA 4O8UA 2G8IA 3HOTA 3KIOA 1HJOA 4BE1A 1T3VA 4XIUA 4DS5A 4OPKA 1VQON 2FSJA 4F2RA 3G25A 1GLFO 1A5XA 1GLBG 4YDUA 1EUVA 2PWWA 3A5NC 4CZGA 4M3UA 1TGHA 3LANA 1JCFA 3PSFA 3CM6A 4M3TA 3VEXA 3L8BA 3QINA 1WBBA 4AM7A 2O8FA 3SMSA 1RDDA 5BMPA 2O8EB 2P9NB 3LP0A 1WSFA 2IOCA 4HVJA 2AJQA 1RDAA 3TAMA 3C04A 1T44A 3EKUA 1RCHA 3D0PA 1Q7YO 4FJNA 3QESA 3BUZB 4BRCA 4BACA 4JK9A 1CDWA 4DHYA 1KSPA 4BQZA 3VQPA 4FPAA 4DMNA 1W7AA 4HCBA 5CE3A 1NVPA 2E2QA 5AFUH 4CZIA 1GOCA 2E4LA 3HP6A 3CJAA 4JK8A 3OYEA 4HHTA 4E1NA 3ZT0A 1CZBA 1QSSA 3BGRA 1K35A 2WBNA 4LF7K 2VQEK 3PSIA 4M41A 4BGAA 5KRTA 2HB5A 2WTUA 3FZFA 4FLWA 1WSHA 2DKCA 1N32K 1UT4A 3D45A 3TARA 2O8CA 3KK7A 3VQ5A 2V7YA 4L3QA 5AQJA 3AO4A 2FF6A 4AHVA 2GTDA 4KTZA 3CMEN 3S9HA 3PX0A 4BR5A 5HRSA 3RSEB 3L2UA 4FLTA 3CFOA 5C25A 2VQFK 5AQSA 2JWKA 1U6ZA 1BISA 1HKGA 5AQGA 3FZLA 1J3MA 4B1ZA 4CK1A 3DLRA 3NCIA 4OX9K 1DIZA 1XC9A 3OBWA 3OYFA 2NRWA 1IG9A 3AVFA 4CJRA 3L2VA 1H1VA 3O9RA 3MEGA 1HNZK 2Q31A 2D4WA 3DOKA 1GLJO 1KLMA 1XUPO 4JN4A 3UKUA 2YHYA 4KHPK 1HMVA 1GLCG 4BG8A 3ZT1A 4C8KA 3P5JA 3U4LA 4H5RA 2ZJRL 4H0VB 4QS7A 4BR2A 4F3TA 4YOUA 2GEMA 3NGZA 1NG9A 3TAQA 2O4IA 2X74A 4GMJB 4LF4K 3WXLA 2QW9A 1BOTO 3CVTA 2VWJA 2AP1A 2YKMA 1DKGD 3GOIA 2KZZA 4BRNA 3FR0A 2G8WA 1IJJA 3LP3A 3VEVA 2AA4A 4ID5A 5KQDA 3CVSA 4FZZA 2HHHK 1DLOA 1NOYA 2OPRA 3EIKA 1IKWA 2PAVA 5BR8K 3O9TA 2HZSA 4JI4K 2PYLA 1VSLA 3L0QA 4JRPA 2LSNA 2MZ8A 3ZT3A 4C8MA 3CCUN 3EN9A 3EE8A 1TK0A 2GV9A 4KTQA 4QOZB 4OLBA 4DF8A 1YJWN 3QFPA 3ZCMA 1HNWK 4BJUA 1HQUA 2QWPA 5JMVD 5JICA 3ZSVA 5GADP 2QR1A 1QE1A 4FLUA 4CF0A 5FRNA 3H1ZA 4NCAA 3HK2A 4ROEB 2Z8UA 5AQNA 1VQMN 1HLUA 4H4OA 4BRGA 5LY3A 1KY6A 1UOCA 4ILGB 3D2FB 1RDBA 1EBMA 3DWLA 2QWRA 4XEIA 4OO1J 1QHAA 4FK4A 3L3VA 4OPHA 4FO0A 5LJVA 4HUGA 3CC4N 3SBTA 3Q7CA 1FN7A 1QN5A 3BF3A 1LWEA 3U3GA 2Q0RA 1KRPA 4HUEA 5TKYA 1NK6A 4J2AA 3GG4A 3KLEA 3ID6A 4B8AB 2EHGA 3ENHA 3VQ6A 3VPZA 3AVCA 4BDZA 1KAYA 1N5YA 4W5QA 1KD1O 3FZHA 1RT1A 3NBPA 2HVHA 2A6AA 2BH1A 3C95A 3ZEUA 1JLCA 3VF6A 3AA5X 2QRCA 4ELTA 4WQ4C 1QNEA 1F21A 3VA3A 1PCZA 4Z4IA 3S3OA 4FW1A 3V4IA 3TE5A 2E5LK 3KLFA 3H3NO 4ELVA 3LM2A 4H03B 1BQNA 4B3OA 4CZJA 3MWTA 4Y0WA 5C0YA 1X1PA 3SUOA 2YA3A 3NHGA 3L2RA 1Y97A 1C9BB 4IJNA 4B9TA 3DLEA 1DTQA 3LPUA 2IC3A 3D7EO 4FVMA 4IG0A 3UKUB 4EJZA 2PBDA 4RODB 3MEDA 1YXQA 3LWMA 1K6YA 5EOYA 2Q0UA 5GIOA 4KHUA 1LAVA 1UAXA 3SUNA 1ATNA 3CC2N 1P8ZA 3G10A 4N47A 4FWRA 4OGCA 4EIAA 1PZDA 1C1AA 5LMNK 4CJSA 3P31A 3K58A 4M3XA 4O0JA 2HBMA 4BRMA 1NGCA 2ASOA 4A61A 1I94K 4CZEA 1UL7A 2FBXA 2YX6A 2B6AA 5AQQA 1VQLN 4A62A 2KKZA 3MX2A 1N33K 5AQKA 2HNYA 1D3UA 3OYIA 1KC8O 2Z1GA 1B92A 4OVLA 3VGLA 2V51B 1RBRA 1NU0A 5H1SQ 1D4XA 2NZTA 3FZMA 4MQ3A 4OKEA 4IO9L 4D7RA 2OTJN 2UUBK 5GAHP 4DG1A 4CJPA 3QBWA 1RTJA 4CFBA 4DQRA 2DPNA 3RTVA 4FWOA 1YVNA 1ASWA 1GLEG 2HHSA 3AVJA 4DR4K 4DWIA 1L3TA 5LJWA 1BCMA 4M7XA 4NXMK 4DV2K 2Z1JA 1WLJA 3MK6A 2HF4A 3NE6A 3EAYA 4JLHA 3RMDA 4RW8A 5AJ3K 3K2PA 1QTPA 3HM8A 3M8PA 4BRDA 3E66A 1VKLA 5AQXA 5HL7L 1ITGA 4RW6A 2IGIA 3NF8A 4BRHA 5KGWA 3CPEA 1XSZA 3DLLL 1PVSA 1WB9A 3IG1A 4ZHRA 3L6QA 1NMNA 4B3TK 4I8OA 2FGTA 2IVPA 4JAXA 4CI6A 1X9WA 3HYFA 3JS6A 1KFIA 4JK7A 3V1RA 4DSLA 5JMVA 5AQZA 4KH5A 3C6UA 3ENBA 5AQHA 1KAZA 3T1AA 1RT5A 2NVMA 3ZEUB 2QWQA 2YCHA 4CJQA 4E7KA 5SWMA 2FSKA 2Z1IA 3VF2A 1ZBHA 3JYTA 2ASPA 1WSGA 2BTFA 3CJBA 2HF3A 2ZJPL 1KY7A 3A5MC 3QERA 1NK7A 3CCJN 3N4QA 1NGIA 3O9SA 1JLGA 1UT7A 2OOXA 3DLKA 1QTMA 5J2MA 2QKBA 4CGIA 1MWKA 5F2RA 1NGDA 2F8TA 3SNSA 1NGEA 3ULEA 2KFZA 4CJVA 1BUPA 2CGLA 5AQTA 2HZMA 1QQNA 2F8SA 5M1FA 1KCFA 4CJLA 4KHYA 1HR0K 4PL8A 2JGUA 5DK5A 1N34K 4BRQA 4J8FA 3FE1A 3HBTA 3EZ5A 3O3FA 4CIFA 4DFMA 4J2EA 3IH7A 4FM0A 3TSQA 4W5RA 3EO3A 4FPBA 5SZTA 4GNIA 3OYCA 1YITN 1KFQA 2NRTA 4DU4A 3HPGA 5AN4A 4PUOA 3V9UA 3O8MA 3SPYA 2HHXA 1P5DX 3ATVA 3THXB 3SMPA 1DGKN 3ZX3A 4I2PA 1JLEA 4OPAA 5I9EB 1QQOA 3VOVA 3DLGA 1EP4A 4LF9K 2E88A 4DTSA 2VWKA 4O5FA 2YHAA 3G4SN 3C94A 4NYFA 4CVNE 4B1VA 3CCLN 2BGGA 3HZ6A 3LAMA 1VHXA 2YI1A 5KRSA 3D2EB 4CF9A 4UQGA 2DFFA 4GV9A 2CGKA 1VOKA 3DPTA 3KVGA 3QIPA 3QETA 3QFUA 4AH9A 3TWHA 4FJ5A 3KJVA 4U7BA 3RMAA 1U48A 3K59A 2P9KA 4MLHA 4E7JA 3SJJA 5KL0A 3CFPA 2GUPA 5M1NA 5BRHA 3U3YA 3AVIA 3OSEA 3R3LA 3I56N 4E3SA 4OKJA 2W6LA 2JHJA 4DQIA 4QAGA 2UXBK 1K2YX 3WNEA 3OTOK 2P9UA 4G9ZA 1KYFA 4FSVA 3OYMA 1L3VA 4FJKA 2A40A 3G0ZA 4JI0K 4CIGA 4DULA 2OPPA 4FJ9A 1TUUA 5ADXH 5FRMA 4EAIA 4F3OA 1RDWX 3GBTA 1IBMK 3BZKA 2GX9A 1HQEA 2W6KA 2P5GA 4GY2B 5IWAK 4H5NA 3PMGA 5J2NA 1XHXA 1T05A 1VK0A 2P9SA 3RR8A 3KD1E 3ZSOA 4CZLA 3KK1A 3CWTA 3VF4A 3ZSXA 4CZMA 3RRHA 2D0CA 1QNBA 3CC7N 2H3GX 2Q1NA 4B9QA 2Y8LA 4K42A 3OJUA 2B4JA 1HU0A 3CWAA 1LWFA 1RBTA 4CBWA 5C2FA 3KRMA 4I2QA 4KH4A 4M45A 3CXCM 3OBYA 2PZSA 5I3UA 4IFYA 1VQKN 3OH9A 3D4VA 3KZBA 3G6EN 1NMDA 4CJ3A 4DTNA 4PL7A 1NOZA 4H4MA 4BE2A 1BG3A 5HRPA 4DFKA 3QO9A 3HI0A 3F10A 4WZSD 3NFAA 4B1UB 3OSMA 4CGJA 5BMNA 4CEQA 3S3MA 3CCEN 1BO5O 3WXKA 4JKGA 2HMIA 4WFBL 1LCUA 3PIPL 5J2PA 3QEWA 1WNSA 3OYAA 2P9PB 4DSFA 1RDCA 1WBDA 3I0RA 3KHYA 5CZ1A 1U2VA 1BWFO 4EZ6A 4ISFA 2X6NA 2OYQA 3BY5A 1KQSM 4W5NA 1YVUA 1JCGA 1JLFA 3DXMA 4YOYA 4B9VA 2F7TA 1KYDA 2A3ZA 1SV5A 4O0IA 1K8KB 3MX5A 3MXIA 4CW7B 3M6GA 3SBGA 1JCEA 1SKSA 2HOEA 3MN5A 4BRPA 1V5SA 4RW4A 3VGMA 4U67L 4LFAK 2ZGZA 4DFPA 3HPOA 2E20A 3SQ2A 4N76A 4N56A 2F96A 3H1QA 3FZKA 4WQ5A 2DY4A 4ILHA 3C6TA 3VQDA 1L3SA 3DLBA 4K8XA 4R5PA 3T1YK 1Q8IA 1UA0A 1N3AA 2NRHA 2YV0X 4BRAA 1L3UA 1XQSC 2BUPA 2Y1IA 2O8DB 4CIEA 2V8QA 3KKRA 4C23A 1XMOK 1TUYA 5MLCQ 2P9KB 3O08A 3K5NA 3P1GA 3SCXA 1OH8A 3VQ8A 1A5WA 4IL8A 2YNFA 4DTXA 1N3CA 4CJFA 3RMBA 5M1QA 3KWIA 4JI6K 4OLAA 4DU1A 3OYLA 2HBLA 1BDGA 1HKBA 2P9UB 1X9MA 3O6WA 4ISEA 1YF5L 2NRZA 1WQAA 3DPUA 2PFUA 1VQ8N 4B3SK 4CEBA 1QNCA 1D5AA 1D8YA 1ZBSA 4CGGA 3MEEA 3NAEA 5GAGP 4KPYA 2VYPA 4V19S 4DSJA 4FL9A 4ISGA 3AV9A 4LD0A 4PHTX 1KVAA 2W40A 4J2BA 3ZSZA 3JXUA 5FDLA 2O8BA 3UW2A 2P9SB 1TYQA 3CWSA 4YY3K 3AVLA 3V9ZA 1S72N 2QXLA 1FK9A 1TGOA 2E1YA 1IV0A 1NWKA 1K73O 1J54A 4Z0UA 3DI6A 5FPMA 3IMXA 2E2NA 2I7NA 3O9QA 1VRUA 3HL8A 5CY4A 3ZT4A 4BE0A 3VGKA 4HWIA 4DR3K 3KK2A 3I33A 3RR7A 3WNFA 1SL0A 2WFBA 2H5AX 3BKQX 1VSJA 4BC4A 4FWPA 2A5XA 1IKXA 5KTQA 4FJXA 4KHSA 2D0BA 1G15A 2OANA 3O1WA 3AVNA 4B1WB 4CJUA 4BGBA 3OJSA 3TAFA 3NF6A 4Z4GA 4Z4CA 5CR4A 3M1FA 4NLCA 4JKGB 2ETJA 1MDUB 2CH6A 4FCYA 1JL2A 3W0LA 4BWJA 5M1OA 4AF1A 2FKFA 4WYBA 1O13A 1VTOA 1S6QA 4I6MA 4DR2K 4J2DA 4W5OA 3SUPA 4I9QA 4EZ9A 2UXDK 1T6DA 3WEEA 2ZD1A 1FKPA 4QCLA 3BZCA 4IWVA 3QEIA 2WOMA 3WQUA 3OS2A 5BRFA 1CLQA 3E9OA 2NRXA 3WUHA 1JLQA 1ZC6A 1Q9UA 4O55A 2D0OA 2V52B 4ELUA 3THYA 3ENCA 4Y1CA 3U9DA 3K0SA 2H4LX 4GVEA 4YFUA 3J80O 1QQCA 4K8ZA 4DTOA 4JI2K 1Q9YA 3OYJA 1NKEA 3OA9A 1C0FA 1OH5A 4CBXA 4MRQA 4IOAL 3VQQA 1YQMA 2DKAA 1XC3A 1M5Q1 4KFBA 4H0OA 1IKVA 2UU9K 2HW3A 3PY8A 4Z94A 1C0MA 4W5TA 1XNRK 5HBMA 5LL6Z 3EYZA 1W2BM 4KHQA 4H0TB 2O8FB 2ZGYA 3HT3A 4GV6A 1B9FA 3KLHA 1X9JA 1N6QA 1RILA 4JKAA 4FWNA 1U4BA 1J53A 5BPMA 3RWUA 1C4GA 1QNAA 3LP1A 3KKSA 4A59A 4DTRA 5DM6L 1IO2A 2F9TA 3NDKA 1FKOA 4M3RA 4M3YA 4KREA 1JXBA 3H45C 3LDSA 5GINA 4JI3K 3LWLA 3JAMO 1IKYA 3ZSQA 3VQCA 2QTDA 3E01A 4IJAA 4BQLA 2P1JA 1OVQA 5ELZA 4DV3K 1WSJA 2YNGA 3CW7A 5E26A 1TYQB 1QN8A 3RPJA 3U6FA 1VQ5N 2FSNA 2X78A 2FXUA 1JXEA 4RW7A 3KTQA 2EWSA 2FF3B 2IVNA 1EQYA 3AGRA 3CD6N 1TVRA 5HSHA 4XH5A 1ZYQA 4CEAA 2O8CB 3SJHA 4FWQA 2IDOA 4O44A 5FLXO 3LDPA 2W42A 3L4QA 4IEEA 2X6SA 2HHWA 3HXMA 4CFFA 3IFRA 4LF8K 3K9JA 1QN7A 1S6PA 3N4PA 1WSIA 1TK5A 3KK3A 3I0SA 2G8FA 1EXQA 4CFDA 1G99A 3BF1A 2HKPA 1IBLK 4IOXA 3O3GA 1ILYA 5KI6A 4C7PA 4EAKA 1Z25A 1E4FT 4OKKA 1N8RO 2BE2A 4WX8A 4DTPA 1ZBIA 2F4VK 1QQMA 4BVPA 3HS8A 1LV5A 1RBUA 1JDYA 1LWVA 1LOTB 2O4GA 4I6MB 1SQKA 4KB0A 1BQMA 3MCAB 4DR6K 4XH4A 4BRKA 1X3MA 4KRFA 4CJEA 3E1YA 3AA4A 2RN2A 4CJ5A 3OYDA 4PKIA 1NGHA 3AO1A 4DQSA 1V4TA 4LH5A 1EWRA 5KPTA 4KBOA 1XHZA 4HCCA 3HOSA 4NB4A 2NRRA 1S9GA 4H5VA 4E1JA 4FLZA 1VQPN 3HSCA 3F9MA 3V6DA 4KH6A 4FOEA 1EO1A 3F5TA 1HPMA 3THYB 1NJXA
chains in the Genus database with same CATH topology
4CJTA 1Z26A 4PWDA 1JKHA 5SZTA 3K57A 3OYCA 4B9NA 3IS9A 3ZSRA 1BHLA 4RG8A 4DU4A 3ZSYA 2DTUA 2P51A 3HVTA 3HPGA 3I0XA 4FLXA 4DF4A 5AN4A 4PUOA 3V9UA 4CJKA 1ZBUA 2XHIA 3DM2A 3KLGA 3SPYA 1I39A 2HHXA 3AO3A 3CQ8A 4DLEA 1U04A 4I2PA 1JLEA 5IYCP 5I42A 1TAQA 2G8IA 3DLGA 1EP4A 3KIOA 3DRSA 4BE1A 4DTSA 2VWKA 4ICLA 1NJWA 4YNQA 3HVRA 2YHAA 1QTSA 2BANA 2FBTA 2WONA 3C94A 4XIUA 4NYFA 1NJYA 4DS5A 3PO4A 1KLNA 2BGGA 3B6PA 3LAMA 4OPKA 3TABA 2ATQA 1XWLA 3MECA 3NH1A 5KRSA 1C6VA 4CF9A 4F2RA 4UQGA 1RBVA 2DFFA 1VOKA 1YQKA 1A5XA 3O4QA 2XY7A 1HRHA 3DPTA 3QIPA 3VQ9A 3QETA 1U47A 4Q11A 4AH9A 5K14A 1WAJA 4M3UA 1TGHA 3LANA 3TWHA 4FJ5A 3KJVA 3RMAA 1U48A 3K59A 3PO5A 4FJGA 3SJJA 4E7JA 3N89A 3CM6A 3CFPA 1YTBA 4M3TA 3QEXA 3ULDA 1N39A 4EP4A 3L8BA 1C0TA 1HNIA 3JSMA 3CFRA 3U3YA 3AVIA 4KAZA 4E3SA 1I3AA 3QINA 3TAEA 4OKJA 5JS1A 4DQIA 4MFBA 4FK0A 4QAGA 2OPSA 4CECA 4E0DA 4IFVA 1RDDA 4CHYA 3LP0A 3WNEA 1S1VA 1WSFA 1KYFA 2IOCA 4CGHA 4HVJA 2O3OA 2AJQA 1RDAA 3TAMA 3QNOA 3AA2A 3OYMA 1L3VA 5HRRA 1JLAA 4FJKA 1RCHA 3D0PA 3L2WA 1M3HA 2ITGA 3G0ZA 1W80A 2KQ2A 1NGMA 4E1MA 4PQUA 4CIGA 4DTMA 4DULA 2OPPA 3QESA 4FJNA 1VSEA 5E41A 4BACA 4FJ9A 1N5YA 1CDWA 1KTQA 3AVKA 1KSPA 5FRMA 3MXMA 4CE9A 4F3OA 4DS4A 3VQPA 4DMNA 4HCBA 3NH2A 3OVNA 3VA0A 1HQEA 4FK2A 1NVPA 2P5GA 4NCGA 1YQLA 2PY5A 1W9HA 4DTJA 3ZSWA 1GOCA 2E4LA 2Q3SA 4CFAA 3HP6A 5J2NA 1XHXA 3OYEA 1TBPA 1T05A 1VK0A 4HHTA 5EU7A 4E1NA 3ZT0A 1CZBA 4CGFA 1QSSA 3BGRA 3RR8A 4F4KA 3KD1E 3ZSOA 1TL1A 3WNHA 3KK1A 4M41A 2RF2A 3ZSXA 4AHUA 3VQ7A 1BCOA 3RRHA 3THVA 2D0CA 1QNBA 5KRTA 2FBVA 2HB5A 1TK8A 4PA1A 4LY7A 3OJUA 4FLWA 2Y1JA 2B4JA 2LAEA 1HU0A 1WSHA 1RBSA 4B9MA 1LWFA 1RBTA 1UT4A 3CM5A 1U49A 1RT7A 3QEVA 3D45A 1KYUA 4CESA 4Z4EA 3KRMA 4I2QA 4M45A 3TARA 2PZSA 5I3UA 4IFYA 4B9LA 4Q0BA 3V9WA 3VQ5A 4CJ3A 1IH7A 2XY6A 4CK2A 4DTNA 3OC3C 1NOZA 4H4MA 2YH5A 3AO4A 1WN7A 4BE2A 4FLTA 4AHVA 5HRPA 4FZXC 3V9SA 3RRGA 5CZ2A 2VG5A 4KTZA 4DFKA 3S9HA 3PX0A 3QO9A 1J5OA 4IDKA 4PY5A 5HRSA 3F10A 2NOEA 3L2UA 4WZSD 2YNHA 1AISA 3CFOA 3NFAA 4ID1A 5C25A 2HW3A 3SV4A 4KKOA 3V81A 3OSMA 4CGJA 1BISA 3DMJA 1NK4A 4DFJA 4CEQA 3S3MA 4F8RA 1HYZA 3SV3A 1JLBA 2HMIA 4G1QA 4CK1A 3DLRA 3NCIA 3VQBA 3OYHA 5J2PA 3M8QA 3SI6A 1O1WA 1SUQA 1XC9A 4FJHA 3QEWA 4C8NA 2OZMA 3OYFA 1KO9A 2NOIA 3CG7A 1WNSA 3OYAA 4CF1A 1TKTA 4CFCA 4DSFA 1IG9A 1VTLE 1VSKA 3AVFA 2DFEA 1RDCA 4CJRA 3I0RA 3K5MA 4C8LA 3L2VA 4CERA 5CZ1A 1QS4A 1SL2A 4EZ6A 2X6NA 2OYQA 3MEGA 4DU3A 2VJ0A 1ZBLA 1NKCA 4W5NA 3DOKA 3SNNA 4FM1A 1YVUA 1JL1A 1JLFA 5J1EA 4B9VA 4C8OA 1KYDA 1KLMA 1SV5A 4DQPA 3LAKA 4FJ8A 4M42A 1HMVA 4O0IA 3MXIA 3ZT1A 4C8KA 3P5JA 2QXFA 3PX4A 4E7LA 4DSIA 4O5BA 4BDYA 4FJ7A 4DTUA 1VSMA 1FXXA 4F3TA 1SKSA 3NGZA 1NJZA 3TAQA 2O4IA 1EETA 2RPIA 2YKNA 2X74A 4GMJB 4RW4A 1VSDA 1XI1A 4DQQA 2P5OA 4KV8A 4DFPA 4B9SA 3HPOA 3HM9A 3T3FA 2G8HA 2JOIA 3SQ2A 1RT2A 4OPJA 3L2QA 4N56A 1BGXT 4N76A 2VWJA 2F96A 1HNVA 2YKMA 2NOZA 2KZZA 2DY4A 4M3WA 3C6TA 3VQDA 1L3SA 3DLBA 2G8WA 3LP3A 4K8XA 4R5PA 3IRXA 3OYGA 4ID5A 1Q8IA 4FZZA 3HO1A 1UA0A 1N3AA 1DLOA 2OPRA 2YV0X 3WNGA 3SQ4A 3EIKA 1IKWA 1UA1A 1L3UA 2HHQA 1YTAA 2Y1IA 4CIEA 3KKRA 3OSTA 4DLGA 2HZSA 3K5NA 4ZTJA 1VRTA 2PYLA 3P1GA 1VSLA 2IV9A 4EP5A 2NOLA 4JRPA 4JS4A 3VQ8A 3SCXA 2OA8A 2LSNA 1A5WA 4B0AA 2MZ8A 3SZ2A 1LAWA 3ZT3A 4C8MA 4Y1DA 1WAFA 2KW4A 1LWYA 5KGXA 1TK0A 2GV9A 4N5SA 4KTQA 2YNFA 1QSYA 4QOZB 1VOLB 4DTXA 1N3CA 4CJFA 1TKDA 4FM2A 3RMBA 2FBYA 1BIUA 3I0WA 5HRNA 2XY5A 3ZT2A 4OLBA 4DF8A 1KFDA 4OLAA 4JS5A 4DU1A 3OYLA 1NK0A 1QN6A 1SKRA 3IAYA 2E6LA 3ZCMA 1HQUA 1X9MA 3HS9A 3ULXA 2HHUA 2KFNA 3DPUA 3ZSVA 3AVAA 4KI4A 3AVMA 1QE1A 3AVHA 2OPQA 3AO2A 4CF0A 4TSXA 1VSFA 4CEBA 4FLUA 1QNCA 1D5AA 1KFSA 3NF9A 5FRNA 4GVMA 2XHBA 1D8YA 3H1ZA 3VQ4A 4CGGA 3MEEA 5HP1A 4NCAA 3HK2A 1LW2A 3NAEA 4KPYA 4ROEB 2Z8UA 3V1OA 1X9SA 2A1RA 1RTIA 4DSJA 1NJXA 3AV9A 3DRPA 4LD0A 2HHVA 4E7IA 3LALA 4H4OA 1R4XA 1KY6A 1KVAA 1UOCA 4J2BA 2R7YA 4B08A 4ROCB 3ZSZA 1RDBA 1EBMA 3TAGA 5FDLA 3ITHA 2PYJA 3SUQA 4F2SA 3AA3A 4FXDA 2OZSA 1NKBA 3H08A 4FK4A 3L3VA 4IKFA 3AVLA 3V9ZA 4HUGA 3T19A 4LH4A 1C1BA 1BIZA 1FK9A 3AVBA 4AHCA 3MAQA 1TGOA 3OYKA 2KZMA 1A5VA 1FN7A 1QN5A 3QLHA 3M8RA 3K5LA 4AHSA 1J54A 1LWEA 1NH2A 3SQ0A 3U3GA 3RMCA 4KHNA 4Z0UA 1KRPA 3DI6A 4HUEA 4IBNA 1NK6A 4J2AA 3KD5E 2GBZA 4FJMA 1LWCA 1VRUA 3ALYA 3HL8A 5CY4A 3ZT4A 4B8AB 1HPZA 2EHGA 4I9LA 3KLEA 4BE0A 1S1TA 4E7HA 4NCBA 3CYMA 3VQ6A 3KK2A 3RR7A 4KI6A 3AVCA 4BDZA 1RT3A 2A1SA 2HNZA 3WNFA 4W5QA 3PV8A 3NBPA 1RT1A 1REVA 3S3NA 2NOHA 3P83D 4CGDA 2HVHA 4FZYA 2DFHA 1VSJA 3C95A 1TKZA 1IKXA 1JLCA 3PX6A 3AA5X 5KTQA 1NK9A 2XO7A 4FJXA 4KHSA 4ELTA 2D0BA 4HUFA 1G15A 4KB1A 1QNEA 2IS3A 1F21A 3AVNA 3QIOA 3OJSA 1BI4A 4CJUA 3VA3A 3TAFA 1PCZA 3NF6A 1SL1A 3S3OA 4M3ZA 4FW1A 4Z4CA 4Z4IA 4Z4GA 4CEFA 1S5JA 1CXUA 3V4IA 1CZ9A 3MXJA 3KLFA 3TAPA 2ETJA 4ELVA 4FCYA 4FJJA 1JL2A 1QHTA 1HYSA 4BWJA 1BQNA 4B3OA 5CYMA 2FC0A 1RT6A 4CHZA 1EKEA 1VTOA 1T7PA 1BL3A 1S6QA 3VN5A 1X1PA 3DYAA 3SUOA 3NHGA 4B8CA 4H8KA 3L2RA 1YTUA 4J2DA 4W5OA 4E89A 1NK5A 1Y97A 1C9BB 3SUPA 4DSKA 1HJRA 1KVBA 3OY9A 4EZ9A 4B9TA 2EX3A 4I9QA 3DLEA 1DTQA 3LPUA 2IC3A 4BDPA 2ZD1A 4FVMA 1FKPA 4QCLA 4IG0A 3QEIA 2WOMA 1C0UA 2ZQBA 4EJZA 3OS2A 1CLQA 1GOAA 4RODB 1TL3A 3MEDA 3NGYA 1E42A 3LWMA 1K6YA 3TR8A 1J9AA 1JLQA 4KHUA 5HLFA 1LAVA 1UAXA 3SUNA 1RT4A 5C42A 3SQ1A 1T8EA 3M8SA 4O55A 1KVCA 4FJLA 3G10A 4N47A 4ELUA 4OGCA 4AILC 3KTUA 5D3GA 3TI0A 1PZDA 4Y1CA 2XY8A 3NH0A 1TBAB 1C1AA 4CJSA 4YFUA 3V9XA 3K58A 1QQCA 4Q5VA 2VG6A 3UIQA 1MP9A 2JLEA 4K8ZA 4CJ4A 4DTOA 1QN3A 1QN9A 1MU2A 4IG3A 3OYJA 1Q9YA 1NKEA 1LWWA 1B9DA 4O0JA 4N41A 3HP9A 1GOBA 3DOLA 4CF8A 5CYQA 3VQQA 2FBXA 1YQMA 2MJ7A 2NOBA 2B6AA 4I7FA 1T03A 2GUIA 3RWUA 3NGIA 4CEEA 4KFBA 4OJRA 5C24A 1IKVA 2HNYA 1D3UA 3AO5A 3OYIA 3ASMA 2Z1GA 3VQAA 3BDPA 1D9DA 3PY8A 1B92A 1RNHA 2XRIA 4OVLA 1RBRA 1C0MA 3PUFA 3F9KA 4W5TA 4FLVA 1RTHA 1TV6A 2YHBA 5HBMA 4FLYA 4MQ3A 3OS0A 2ZE2A 3EYZA 4KHQA 1EX4A 2RKIA 1S1XA 4OKEA 3HT3A 2B5JA 2G8VA 1M3QA 1B9FA 3KLHA 3LZJA 1N6QA 1D9FA 4DG1A 3A2FA 4CJPA 4CHPA 1RTJA 1RILA 1QSLA 4FJIA 1U4BA 4AHRA 1J53A 5T7BA 4CFBA 4DQRA 1UWBA 3HPHA 3LP1A 1QNAA 3RTVA 1ASVA 2VG7A 3KKSA 4DTRA 2G8UA 1IO2A 3NDKA 1FKOA 1ASWA 4KTWA 4KO0A 4JRQA 4M3RA 4Z4HA 3L3UA 3NF7A 3DRRA 2HHSA 3AVJA 4M3YA 4KREA 4AHTA 4DWIA 1JXBA 4LSLA 4CEOA 3OYBA 1L3TA 3LDSA 4M3XA 1BCMA 1HYVA 3LWLA 2QK9A 1ASUA 2Z1JA 5FROA 1WLJA 3O3HA 1TKXA 3NE6A 1U45A 1IKYA 2HNDA 3V1QA 1C1CA 4JLHA 3RMDA 4RW8A 4RW9A 3FFIA 3K2PA 1QTPA 3ZSQA 3VQCA 1SKWA 4NYNA 3E01A 2Z1HA 3M8PA 2P1JA 2I5WA 1YTFA 2NOFA 4CF2A 1WSJA 2YNGA 3U6FA 1QN8A 3RPJA 3HJFA 2X78A 1ITGA 3F0ZA 3KLIA 4RW6A 2IGIA 1S9EA 2D5RA 3NF8A 4CEDA 5KGWA 3KTQA 1JXEA 4RW7A 3VQEA 5JS2A 4ZTFA 4O4GA 4CCHA 3B6OA 3IG1A 1TVRA 4ZHRA 3I8DA 1ZYQA 4CEAA 4I8OA 2FGTA 2IDOA 4O44A 1X9WA 3QEPA 3HYFA 4DSLA 4BWMA 1W0HA 3V1RA 3EY1A 2W42A 3SYZA 5J2QA 1NK8A 2X6SA 2HVIA 4LSNA 3C6UA 4Z4FA 2HHWA 3HXMA 3OYNA 3T1AA 1YQRA 1RT5A 3OCIA 1QN7A 2NUBA 1RM1A 1JFIC 3LPTA 1S6PA 4CJQA 4E7KA 5IYBP 5SWMA 1WSIA 4CK3A 1TK5A 1YT3A 3I0SA 3KK3A 2G8FA 1LW0A 2Z1IA 5DMRA 1ZBHA 3JYTA 1VSHA 1EXQA 1WSGA 4CFDA 5HROA 3DLHA 4CHQA 1NOYA 1KY7A 1BI4B 1CXQA 3O3GA 1RTDA 3O4NA 5KI6A 1R0AA 4E19A 3QERA 1NK7A 1Z25A 1ZBFA 4HTUA 1B9KA 4OKKA 2BE2A 2E6MA 4DTPA 3AVGA 1ZBIA 4CEZA 3HSTB 2YNIA 4FYDA 2I5JA 3HS8A 1JLGA 3ISNC 1LV5A 5IYDP 1UT7A 3DLKA 1RBUA 3QNNA 1VSIA 3TANA 1LWVA 2G30A 1QTMA 1WSEA 5J2MA 2QKBA 2O4GA 1S1WA 4CGIA 2G8KA 2BDPA 4KB0A 4KHWA 1SL0A 2QKKA 4OGEA 1BQMA 3F73A 4WE1A 4CHOA 2KTQA 2IAJA 4TPSA 3SNSA 2F8TA 2D0AA 2KFZA 4KRFA 4CJEA 4CJVA 1DTTA 3AA4A 2HZMA 2RN2A 3K5OA 4CJ5A 3OYDA 3AO1A 4CJWA 4DQSA 2F8SA 1TAUA 4LH5A 4FW2A 1L5UA 1KCFA 4CJLA 4KHYA 2HHTA 1XHZA 4HCCA 3SPZA 1Q9XA 5DK5A 1S9GA 2JGUA 3LP2A 4EJYA 4FLZA 4GW6A 1QN4A 3V6DA 3EZ5A 4B9UA 3O3FA 2IV8A 4CIFA 1S1UA 3OS1A 4DFMA 4J2EA 3IH7A 4CHNA 4L8RB 4FM0A 3LZIA 4DSEA 4W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJT A;  1Z26 A;  4PWD A;  1JKH A;  5SZT A;  3K57 A;  3OYC A;  4B9N A;  3IS9 A;  3ZSR A;  1BHL A;  4RG8 A;  4DU4 A;  3ZSY A;  2DTU A;  2P51 A;  3HVT A;  3HPG A;  4FLX A;  4DF4 A;  4PUO A;  3V9U A;  4CJK A;  1ZBU A;  3DM2 A;  3KLG A;  3SPY A;  1I39 A;  2HHX A;  3AO3 A;  3CQ8 A;  4DLE A;  1U04 A;  4I2P A;  1JLE A;  5IYC P;  5I42 A;  1TAQ A;  2G8I A;  3DLG A;  1EP4 A;  3KIO A;  3DRS A;  4BE1 A;  4DTS A;  2VWK A;  4ICL A;  1NJW A;  4YNQ A;  3HVR A;  2YHA A;  1QTS A;  2BAN A;  2FBT A;  2WON A;  3C94 A;  4XIU A;  4NYF A;  1NJY A;  4DS5 A;  3PO4 A;  1KLN A;  2BGG A;  3B6P A;  3LAM A;  4OPK A;  3TAB A;  2ATQ A;  1XWL A;  3MEC A;  3NH1 A;  5KRS A;  1C6V A;  4CF9 A;  4F2R A;  4UQG A;  1RBV A;  2DFF A;  1VOK A;  1A5X A;  2XY7 A;  3O4Q A;  1HRH A;  3VQ9 A;  3QIP A;  3QET A;  1U47 A;  4AH9 A;  5K14 A;  1WAJ A;  4M3U A;  1TGH A;  3LAN A;  3TWH A;  4FJ5 A;  3KJV A;  3RMA A;  1U48 A;  3K59 A;  3PO5 A;  4FJG A;  3SJJ A;  4E7J A;  3CM6 A;  3CFP A;  1YTB A;  4M3T A;  3QEX A;  3ULD A;  4EP4 A;  3L8B A;  1C0T A;  1HNI A;  3JSM A;  3CFR A;  3U3Y A;  3AVI A;  4KAZ A;  4E3S A;  1I3A A;  3QIN A;  3TAE A;  4OKJ A;  5JS1 A;  4DQI A;  4MFB A;  4FK0 A;  4QAG A;  2OPS A;  4CEC A;  4E0D A;  4IFV A;  1RDD A;  4CHY A;  3LP0 A;  3WNE A;  1S1V A;  1WSF A;  1KYF A;  2IOC A;  4CGH A;  4HVJ A;  2AJQ A;  1RDA A;  3TAM A;  3QNO A;  3AA2 A;  3OYM A;  1L3V A;  5HRR A;  1JLA A;  4FJK A;  1RCH A;  3D0P A;  3L2W A;  2ITG A;  3G0Z A;  1W80 A;  2KQ2 A;  1NGM A;  4E1M A;  4PQU A;  4CIG A;  4DTM A;  2OPP A;  4FJN A;  3QES A;  4FJ9 A;  1VSE A;  5E41 A;  4BAC A;  1N5Y A;  1CDW A;  1KTQ A;  3AVK A;  1KSP A;  5FRM A;  3MXM A;  4CE9 A;  4F3O A;  4DS4 A;  3VQP A;  4DMN A;  4HCB A;  3NH2 A;  3OVN A;  3VA0 A;  1HQE A;  4FK2 A;  1NVP A;  2P5G A;  4NCG A;  2PY5 A;  1W9H A;  4DTJ A;  3ZSW A;  1GOC A;  2E4L A;  2Q3S A;  4CFA A;  3HP6 A;  5J2N A;  1XHX A;  3OYE A;  1TBP A;  1T05 A;  1VK0 A;  4HHT A;  5EU7 A;  4E1N A;  3ZT0 A;  1CZB A;  4CGF A;  1QSS A;  3BGR A;  3RR8 A;  4F4K A;  3KD1 E;  3ZSO A;  1TL1 A;  3WNH A;  3KK1 A;  4M41 A;  2RF2 A;  3ZSX A;  4AHU A;  3VQ7 A;  1BCO A;  3RRH A;  3THV A;  2D0C A;  1QNB A;  5KRT A;  2FBV A;  2HB5 A;  1TK8 A;  4PA1 A;  4LY7 A;  3OJU A;  4FLW A;  2Y1J A;  2B4J A;  1WSH A;  4B9M A;  1RBS A;  1LWF A;  1RBT A;  3CM5 A;  1U49 A;  1RT7 A;  3QEV A;  3D45 A;  1KYU A;  4CES A;  4Z4E A;  4I2Q A;  4M45 A;  3TAR A;  2PZS A;  5I3U A;  4IFY A;  4B9L A;  4Q0B A;  3V9W A;  3VQ5 A;  4CJ3 A;  1IH7 A;  2XY6 A;  4CK2 A;  4DTN A;  3OC3 C;  1NOZ A;  4H4M A;  3AO4 A;  4BE2 A;  1WN7 A;  4FZX C;  4AHV A;  5HRP A;  3V9S A;  3RRG A;  5CZ2 A;  2VG5 A;  4KTZ A;  4DFK A;  3S9H A;  3PX0 A;  3QO9 A;  1J5O A;  4IDK A;  4PY5 A;  5HRS A;  3L2U A;  4FLT A;  4WZS D;  2YNH A;  1AIS A;  3CFO A;  3NFA A;  4ID1 A;  5C25 A;  2HW3 A;  3SV4 A;  4KKO A;  3V81 A;  4CGJ A;  1BIS A;  3DMJ A;  1NK4 A;  4DFJ A;  4CEQ A;  3S3M A;  4F8R A;  1HYZ A;  3SV3 A;  1JLB A;  2HMI A;  4G1Q A;  4CK1 A;  3DLR A;  3NCI A;  3VQB A;  3OYH A;  5J2P A;  3M8Q A;  3SI6 A;  1O1W A;  1SUQ A;  1XC9 A;  4FJH A;  3QEW A;  4C8N A;  2OZM A;  3OYF A;  3CG7 A;  1WNS A;  3OYA A;  4CF1 A;  1TKT A;  4CFC A;  4DSF A;  1IG9 A;  1VTL E;  1VSK A;  3AVF A;  2DFE A;  1RDC A;  4CJR A;  3I0R A;  3K5M A;  4C8L A;  3L2V A;  4CER A;  5CZ1 A;  1QS4 A;  1SL2 A;  4EZ6 A;  2X6N A;  2OYQ A;  3MEG A;  4DU3 A;  2VJ0 A;  1ZBL A;  1NKC A;  4W5N A;  3DOK A;  3SNN A;  4FM1 A;  1YVU A;  1JL1 A;  1JLF A;  5J1E A;  4B9V A;  4C8O A;  1KYD A;  1KLM A;  1SV5 A;  4DQP A;  3LAK A;  4FJ8 A;  4M42 A;  1HMV A;  4O0I A;  3MXI A;  3ZT1 A;  4C8K A;  3P5J A;  2QXF A;  3PX4 A;  4E7L A;  4DSI A;  4O5B A;  4BDY A;  4FJ7 A;  4DTU A;  1VSM A;  1FXX A;  4F3T A;  1SKS A;  3NGZ A;  1NJZ A;  3TAQ A;  2O4I A;  1EET A;  2RPI A;  2YKN A;  2X74 A;  4GMJ B;  4RW4 A;  1VSD A;  1XI1 A;  4DQQ A;  2P5O A;  4KV8 A;  4DFP A;  4B9S A;  3HPO A;  3HM9 A;  3T3F A;  2G8H A;  3SQ2 A;  1RT2 A;  4OPJ A;  3L2Q A;  4N56 A;  1BGX T;  4N76 A;  2VWJ A;  2F96 A;  1HNV A;  2YKM A;  2KZZ A;  2DY4 A;  4M3W A;  3C6T A;  3VQD A;  1L3S A;  3DLB A;  2G8W A;  3LP3 A;  4K8X A;  4R5P A;  3IRX A;  3OYG A;  4ID5 A;  1Q8I A;  4FZZ A;  3HO1 A;  1UA0 A;  1DLO A;  1NOY A;  2OPR A;  2YV0 X;  3WNG A;  3SQ4 A;  3EIK A;  1IKW A;  1UA1 A;  1L3U A;  2HHQ A;  1YTA A;  2Y1I A;  4CIE A;  3KKR A;  4DLG A;  3K5N A;  4ZTJ A;  1VRT A;  2PYL A;  3P1G A;  1VSL A;  2IV9 A;  4EP5 A;  4JS4 A;  4JRP A;  3SCX A;  3VQ8 A;  2OA8 A;  2LSN A;  1A5W A;  4B0A A;  3SZ2 A;  1LAW A;  3ZT3 A;  4C8M A;  4Y1D A;  1WAF A;  2KW4 A;  5KGX A;  1TK0 A;  2GV9 A;  4N5S A;  4KTQ A;  2YNF A;  1QSY A;  4QOZ B;  1VOL B;  4DTX A;  4CJF A;  1TKD A;  4FM2 A;  3RMB A;  2FBY A;  1BIU A;  5HRN A;  2XY5 A;  3ZT2 A;  4OLB A;  4DF8 A;  1KFD A;  4OLA A;  4JS5 A;  4DU1 A;  3OYL A;  1NK0 A;  1QN6 A;  1SKR A;  3IAY A;  2E6L A;  3ZCM A;  1HQU A;  1X9M A;  3HS9 A;  2HHU A;  2KFN A;  3ZSV A;  3AVA A;  4KI4 A;  3AVM A;  1QE1 A;  3AVH A;  2OPQ A;  3AO2 A;  4CF0 A;  4TSX A;  1VSF A;  4CEB A;  4FLU A;  1QNC A;  1D5A A;  1KFS A;  3NF9 A;  5FRN A;  4GVM A;  2XHB A;  1D8Y A;  3H1Z A;  3VQ4 A;  4CGG A;  3MEE A;  5HP1 A;  4NCA A;  3HK2 A;  1LW2 A;  3NAE A;  4KPY A;  4ROE B;  2Z8U A;  3V1O A;  1X9S A;  2A1R A;  1RTI A;  4DSJ A;  1NJX A;  3AV9 A;  3DRP A;  4LD0 A;  2HHV A;  4E7I A;  3LAL A;  4H4O A;  1R4X A;  1KY6 A;  1KVA A;  1UOC A;  4J2B A;  2R7Y A;  4B08 A;  4ROC B;  3ZSZ A;  1RDB A;  3TAG A;  5FDL A;  3ITH A;  2PYJ A;  3SUQ A;  4F2S A;  3AA3 A;  4FXD A;  2OZS A;  1NKB A;  3H08 A;  4FK4 A;  3L3V A;  4IKF A;  3AVL A;  3V9Z A;  4HUG A;  3T19 A;  4LH4 A;  1C1B A;  1BIZ A;  1FK9 A;  3AVB A;  4AHC A;  3MAQ A;  1TGO A;  3OYK A;  2KZM A;  1A5V A;  1QN5 A;  3QLH A;  3M8R A;  3K5L A;  4AHS A;  1J54 A;  1LWE A;  1NH2 A;  3SQ0 A;  3U3G A;  3RMC A;  4KHN A;  4Z0U A;  1KRP A;  3DI6 A;  4HUE A;  4IBN A;  1NK6 A;  4J2A A;  3KD5 E;  2GBZ A;  4FJM A;  1LWC A;  1VRU A;  3ALY A;  3HL8 A;  5CY4 A;  3ZT4 A;  4B8A B;  1HPZ A;  2EHG A;  4I9L A;  3KLE A;  4BE0 A;  1S1T A;  4E7H A;  4NCB A;  3CYM A;  3VQ6 A;  3KK2 A;  3RR7 A;  4KI6 A;  3AVC A;  4BDZ A;  1RT3 A;  2A1S A;  2HNZ A;  3WNF A;  4W5Q A;  3PV8 A;  3NBP A;  1RT1 A;  1REV A;  3S3N A;  4CGD A;  3P83 D;  1SL0 A;  2HVH A;  4FZY A;  2DFH A;  1VSJ A;  3C95 A;  1TKZ A;  1IKX A;  1JLC A;  3PX6 A;  3AA5 X;  5KTQ A;  1NK9 A;  2XO7 A;  4FJX A;  4KHS A;  4ELT A;  2D0B A;  4HUF A;  1G15 A;  4KB1 A;  1QNE A;  2IS3 A;  1F21 A;  3AVN A;  3QIO A;  3OJS A;  1BI4 A;  4CJU A;  3VA3 A;  3TAF A;  1PCZ A;  3NF6 A;  1SL1 A;  3S3O A;  4M3Z A;  4FW1 A;  4Z4C A;  4Z4I A;  4Z4G A;  4CEF A;  1S5J A;  1CXU A;  3V4I A;  1CZ9 A;  3MXJ A;  3KLF A;  3TAP A;  2ETJ A;  4ELV A;  4FCY A;  4FJJ A;  1JL2 A;  1QHT A;  1HYS A;  4BWJ A;  1BQN A;  4B3O A;  5CYM A;  2FC0 A;  1RT6 A;  4CHZ A;  1EKE A;  1VTO A;  1T7P A;  1BL3 A;  1S6Q A;  3VN5 A;  1X1P A;  3DYA A;  3SUO A;  3NHG A;  4B8C A;  4H8K A;  3L2R A;  1YTU A;  4J2D A;  4W5O A;  4E89 A;  1NK5 A;  1Y97 A;  1C9B B;  3SUP A;  4DSK A;  1HJR A;  1KVB A;  3OY9 A;  4EZ9 A;  4B9T A;  2EX3 A;  4I9Q A;  3DLE A;  1DTQ A;  3LPU A;  2IC3 A;  4BDP A;  2ZD1 A;  4FVM A;  1FKP A;  4QCL A;  4IG0 A;  3QEI A;  2WOM A;  1C0U A;  2ZQB A;  3OS2 A;  1CLQ A;  1GOA A;  4ROD B;  1TL3 A;  3MED A;  3NGY A;  1E42 A;  3LWM A;  1K6Y A;  3TR8 A;  1J9A A;  1JLQ A;  4KHU A;  5HLF A;  1LAV A;  1UAX A;  3SUN A;  1RT4 A;  5C42 A;  3SQ1 A;  1T8E A;  3M8S A;  4O55 A;  1KVC A;  4FJL A;  3G10 A;  4N47 A;  4ELU A;  4OGC A;  4AIL C;  5D3G A;  3TI0 A;  1PZD A;  4Y1C A;  2XY8 A;  3NH0 A;  1TBA B;  1C1A A;  4CJS A;  4YFU A;  3V9X A;  3K58 A;  1QQC A;  4Q5V A;  2VG6 A;  3UIQ A;  1MP9 A;  2JLE A;  4K8Z A;  4CJ4 A;  4DTO A;  1QN3 A;  1QN9 A;  1MU2 A;  4IG3 A;  3OYJ A;  1Q9Y A;  1NKE A;  4O0J A;  1B9D A;  4N41 A;  3HP9 A;  1GOB A;  3DOL A;  4CF8 A;  5CYQ A;  3VQQ A;  2FBX A;  2MJ7 A;  2B6A A;  4I7F A;  1T03 A;  2GUI A;  3RWU A;  3NGI A;  4CEE A;  4KFB A;  4OJR A;  5C24 A;  1IKV A;  2HNY A;  1D3U A;  3AO5 A;  3OYI A;  3ASM A;  2Z1G A;  3VQA A;  3BDP A;  1D9D A;  3PY8 A;  1B92 A;  1RNH A;  2XRI A;  4OVL A;  1RBR A;  1C0M A;  3PUF A;  3F9K A;  4W5T A;  4FLV A;  1RTH A;  1TV6 A;  2YHB A;  5HBM A;  4FLY A;  4MQ3 A;  3OS0 A;  2ZE2 A;  3EYZ A;  4KHQ A;  1EX4 A;  2RKI A;  1S1X A;  4OKE A;  3HT3 A;  2B5J A;  2G8V A;  1B9F A;  3KLH A;  3LZJ A;  1N6Q A;  1D9F A;  4DG1 A;  3A2F A;  4CJP A;  4CHP A;  1RTJ A;  1RIL A;  1QSL A;  4FJI A;  1U4B A;  4AHR A;  1J53 A;  5T7B A;  4CFB A;  4DQR A;  1UWB A;  3HPH A;  3LP1 A;  1QNA A;  3RTV A;  1ASV A;  2VG7 A;  3KKS A;  4DTR A;  2G8U A;  1IO2 A;  3NDK A;  1FKO A;  1ASW A;  4KTW A;  4KO0 A;  4JRQ A;  4M3R A;  4Z4H A;  3L3U A;  3NF7 A;  3DRR A;  2HHS A;  3AVJ A;  4M3Y A;  4KRE A;  4AHT A;  4DWI A;  1JXB A;  4LSL A;  4CEO A;  3OYB A;  1L3T A;  3LDS A;  4M3X A;  1BCM A;  1HYV A;  3LWL A;  2QK9 A;  1ASU A;  2Z1J A;  5FRO A;  1WLJ A;  3O3H A;  1TKX A;  3NE6 A;  1U45 A;  1IKY A;  2HND A;  3V1Q A;  1C1C A;  4JLH A;  3RMD A;  4RW8 A;  4RW9 A;  3FFI A;  3K2P A;  1QTP A;  3ZSQ A;  3VQC A;  1SKW A;  4NYN A;  3E01 A;  2Z1H A;  3M8P A;  2P1J A;  1YTF A;  4CF2 A;  1WSJ A;  2YNG A;  3U6F A;  1QN8 A;  3HJF A;  2X78 A;  1ITG A;  4RW6 A;  3KLI A;  2IGI A;  1S9E A;  2D5R A;  3NF8 A;  4CED A;  5KGW A;  3KTQ A;  1JXE A;  4RW7 A;  3VQE A;  5JS2 A;  4ZTF A;  4O4G A;  4CCH A;  3B6O A;  3IG1 A;  1TVR A;  4ZHR A;  3I8D A;  1ZYQ A;  4CEA A;  2IDO A;  4O44 A;  1X9W A;  3QEP A;  3HYF A;  4DSL A;  4BWM A;  1W0H A;  3V1R A;  3EY1 A;  2W42 A;  3SYZ A;  5J2Q A;  1NK8 A;  2X6S A;  2HVI A;  4LSN A;  3C6U A;  4Z4F A;  2HHW A;  3HXM A;  3OYN A;  3T1A A;  1RT5 A;  3OCI A;  1QN7 A;  2NUB A;  1RM1 A;  1JFI C;  3LPT A;  1S6P A;  4CJQ A;  4E7K A;  5IYB P;  5SWM A;  1WSI A;  4CK3 A;  1TK5 A;  1YT3 A;  3I0S A;  3KK3 A;  2G8F A;  1LW0 A;  2Z1I A;  5DMR A;  1ZBH A;  3JYT A;  1VSH A;  1EXQ A;  1WSG A;  4CFD A;  5HRO A;  3DLH A;  4CHQ A;  1KY7 A;  1BI4 B;  1CXQ A;  3O3G A;  1RTD A;  3O4N A;  5KI6 A;  1R0A A;  4E19 A;  3QER A;  1NK7 A;  1Z25 A;  1ZBF A;  4HTU A;  1B9K A;  4OKK A;  2BE2 A;  2E6M A;  4DTP A;  3AVG A;  1ZBI A;  4CEZ A;  3HST B;  2YNI A;  4FYD A;  2I5J A;  3HS8 A;  1JLG A;  3ISN C;  1LV5 A;  5IYD P;  3DLK A;  1RBU A;  3QNN A;  1VSI A;  3TAN A;  1QTM A;  2G30 A;  1WSE A;  5J2M A;  2QKB A;  2O4G A;  1S1W A;  4CGI A;  2G8K A;  2BDP A;  4KB0 A;  4KHW A;  2QKK A;  4OGE A;  1BQM A;  3F73 A;  4WE1 A;  4CHO A;  2KTQ A;  2IAJ A;  2F8T A;  2D0A A;  2KFZ A;  4KRF A;  4CJE A;  4CJV A;  1DTT A;  3AA4 A;  2RN2 A;  3K5O A;  4CJ5 A;  3OYD A;  3AO1 A;  4CJW A;  4DQS A;  2F8S A;  1TAU A;  4LH5 A;  4FW2 A;  1L5U A;  1KCF A;  4CJL A;  4KHY A;  2HHT A;  1XHZ A;  4HCC A;  3SPZ A;  1Q9X A;  5DK5 A;  1S9G A;  2JGU A;  3LP2 A;  4FLZ A;  4GW6 A;  1QN4 A;  3V6D A;  3EZ5 A;  4B9U A;  3O3F A;  2IV8 A;  4CIF A;  1S1U A;  3OS1 A;  4DFM A;  4J2E A;  4CHN A;  4L8R B;  4FM0 A;  3LZI A;  4DSE A;  4W5R A; 
#chains in the Genus database with same CATH topology
 1Z26 A;  2Q2R A;  1JKH A;  4PKH A;  1ZXO A;  1BHL A;  5IT9 O;  3ZSY A;  3HVT A;  3SAG A;  3I0X A;  3CIP A;  4CJK A;  1ZBU A;  4WCE L;  2A41 A;  1I39 A;  4EHU A;  5GIP A;  3I8B A;  2UUC K;  1TAQ A;  4FWS A;  1C0G A;  1SAZ A;  3DRS A;  3EZW A;  4YNQ A;  3PO4 A;  2FBT A;  1NJY A;  3B6P A;  3TAB A;  1WOQ A;  1XWL A;  2ATQ A;  3MEC A;  4BR4 A;  3NH1 A;  1C6V A;  3ZYY X;  5GAE P;  3DAW A;  1HX1 A;  3VQ9 A;  4Q11 A;  4DV7 K;  4LC9 B;  3WQT A;  3PO5 A;  3VES A;  4FJG A;  1MPG A;  3N89 A;  4WQ5 C;  1YTB A;  3VER A;  1T6A A;  3WXM B;  3ULD A;  1N39 A;  4EP4 A;  1C0T A;  1HNI A;  3JSM A;  4KAZ A;  1I3A A;  2NNW A;  3EL2 A;  5JS1 A;  3U9Z A;  1KXP A;  5C10 A;  3TSU A;  4IFV A;  3J7Y P;  4BR7 A;  1S1V A;  1NJI O;  2O3O A;  3AGK A;  3AA2 A;  5HRR A;  3L2W A;  1M3H A;  2ITG A;  1W80 A;  2KQ2 A;  4EAH D;  4PQU A;  4DTM A;  3C65 A;  2NRV A;  1KTQ A;  3AVK A;  1S22 A;  4CE9 A;  4DS4 A;  3L4I A;  3ID8 A;  5FPD A;  1YQL A;  1P90 A;  1W9H A;  3ZSW A;  4M7Y A;  2Q3S A;  4CFA A;  1ATR A;  1W97 L;  2Q36 A;  5EU7 A;  4CGF A;  4F4K A;  4JYA K;  1BCO A;  3TTD A;  4FWK A;  2FBV A;  4PA1 A;  2LAE A;  4YOT A;  4B9M A;  3CM5 A;  3SAF A;  2OTL N;  4YOR A;  5EXW A;  4QG5 A;  4B9L A;  4Q0B A;  3V9W A;  1MWM A;  1IH7 A;  2XY6 A;  3OC3 C;  2YH5 A;  1WN7 A;  3T69 A;  3V9S A;  3RRG A;  2VG5 A;  3DXK A;  1J5O A;  4PY5 A;  3C7N A;  2NOE A;  5KQ8 A;  2YNH A;  4ID1 A;  3VTI A;  1PCM X;  3V81 A;  3CWU A;  3DMJ A;  4NO7 A;  4DFJ A;  1HYZ A;  3EEQ A;  3A8Y A;  3SLC A;  3OYH A;  1SUQ A;  4C8N A;  2NOI A;  3QBX A;  1BA1 A;  1QVG M;  1VTL E;  3O9U A;  3K5M A;  4C8L A;  1QS4 A;  4JD2 A;  4DU3 A;  5AQL A;  5BN9 A;  1ZBL A;  3CCR N;  1NKC A;  4FM1 A;  1JL1 A;  3BP8 A;  5J1E A;  4C8O A;  4AM6 A;  1JJ2 M;  2QWL A;  3LAK A;  4CJ7 A;  4XH1 A;  1YI2 N;  2QXF A;  3PX4 A;  3VEY A;  4E7L A;  3THW A;  4DSI A;  4O5B A;  4DV4 K;  4GKK K;  4DTU A;  1VSM A;  4H5W A;  2YHW A;  2RE2 A;  1NJZ A;  2RPI A;  2YKN A;  4GV3 A;  4KV8 A;  4B9S A;  3HM9 A;  1QZ6 A;  2JOI A;  2OOY A;  4BVO A;  1RT2 A;  4OPJ A;  3ZET A;  1HNV A;  3G71 N;  3E9L A;  2NOZ A;  1ATS A;  1HNX K;  4JKF A;  3IRX A;  3KWG A;  3OYG A;  3RSM A;  1NGA A;  5AZJ A;  5FPE A;  4PKG A;  1UA1 A;  2HHQ A;  2HL8 A;  3O1B A;  1SS6 A;  2EHB D;  3LDL A;  4DLG A;  1VRT A;  3VEO A;  4CBU A;  2QA4 N;  2ITM A;  4JS4 A;  2J4R A;  4B0A A;  1LAW A;  1WAF A;  5AQW A;  4LF5 K;  1PCJ X;  1LWY A;  5KGX A;  4BG9 A;  4N5S A;  1QSY A;  3M5R A;  1VOL B;  5AZI A;  1TKD A;  3I0W A;  4JS5 A;  3IAY A;  4LF6 K;  2QWN A;  4HJH A;  4BC2 A;  3HS9 A;  3ULX A;  3ENO A;  2HHU A;  3AVA A;  4KI4 A;  3AVM A;  4ILJ A;  3AVH A;  2OPQ A;  4TSX A;  1VSF A;  5HOO A;  3NF9 A;  2XHB A;  3QDK A;  2P9I A;  5AQU A;  1LW2 A;  2A1R A;  4DUZ K;  3MCP A;  5AQV A;  2O8E A;  2P9N A;  3DRP A;  4MLE A;  1BU6 O;  3H3O B;  3LDN A;  1OH6 A;  3SUQ A;  4F2S A;  1YIJ N;  4FXD A;  4YOX A;  1NKB A;  2OZS A;  3WXJ A;  4IKF A;  3B8A X;  3BEX A;  3GL1 A;  3T19 A;  1C1B A;  3MAQ A;  3MDQ A;  4DV0 K;  4NXN K;  1RDU A;  4C1N I;  3TPQ A;  4H0Y B;  2KZM A;  3E9P A;  4JKE A;  3M8R A;  3K5L A;  3RMC A;  4FOI A;  4KHN A;  1VQN N;  3TTF A;  4IBN A;  1XNQ K;  4M63 C;  4FJM A;  2CGJ A;  3TU5 A;  1HPZ A;  4E7H A;  2OCE A;  1RT3 A;  3S3N A;  4CGD A;  4RTF D;  3WT0 A;  3DXK B;  4FZY A;  3OH6 A;  3C7N B;  4JI7 K;  1NK9 A;  4A57 A;  4HUF A;  2YJE A;  1QZ5 A;  3ULE B;  2IS3 A;  2ASM A;  3QIO A;  3CJC A;  2I7P A;  1SL1 A;  2JHN A;  2D1K A;  4CEF A;  1CXU A;  1CZ9 A;  3I3W A;  3MXJ A;  3TAP A;  2KLA A;  4F9O A;  4UY8 O;  1HYS A;  5CYM A;  3S41 A;  2FC0 A;  1RT6 A;  1EKE A;  1T7P A;  1BL3 A;  3VN5 A;  2VCP A;  3CPW M;  3RSE A;  4E89 A;  1NK5 A;  3A5L C;  4DR1 K;  2Q97 A;  4D7Q A;  1HJR A;  3MN9 A;  4JD2 B;  2EX3 A;  4BDP A;  5DM7 L;  5AQR A;  3EE9 A;  1E3M A;  1C0U A;  2ZQB A;  3NGY A;  1TL3 A;  4B3M K;  3O5B A;  1E42 A;  3VEW A;  3TR8 A;  3THW B;  1J9A A;  5HLF A;  1NBW A;  5C42 A;  1T8E A;  4JKH A;  3M8S A;  3AAQ A;  5TKW A;  4QS9 A;  4EHT A;  4AIL C;  4H0X B;  2XY8 A;  1IBK K;  3V9X A;  3ZET B;  1FJG K;  1QN9 A;  1LXT A;  2Z0F A;  1LWW A;  3HP9 A;  1GOB A;  3DOL A;  1NGF A;  2HBK A;  4CF8 A;  3A0I X;  1T03 A;  3CJ1 A;  2DKD A;  3NGI A;  4OJR A;  5C24 A;  3BDP A;  3VQA A;  1D9D A;  1RNH A;  2XRI A;  3PUF A;  3F9K A;  1RTH A;  2YHB A;  5AZI B;  4DB3 A;  3J7A P;  1WUA A;  5BPL A;  2GEL A;  4K25 A;  1M3Q A;  1D9F A;  4CHP A;  3SK3 A;  4FJI A;  5AR0 A;  5T7B A;  3NVM A;  1ASV A;  4BRO A;  4CZF A;  3DRR A;  2HBJ A;  4LSL A;  2P9I B;  3OYB A;  3OW2 M;  3J8A A;  1HYV A;  2QK9 A;  1QVF M;  3IDH A;  3O3H A;  1U45 A;  2HND A;  1C1C A;  3R8E A;  1S3X A;  3FFI A;  2KHO A;  4RW9 A;  4NYN A;  2Z1H A;  1YTF A;  3MN7 A;  2NOF A;  2NWV A;  4CF2 A;  4JNE A;  3VET A;  5EPC A;  3F0Z A;  2VGN A;  2D5R A;  1MA9 B;  4CD1 A;  3OHR A;  4ZTF A;  4O4G A;  3FLC O;  1WJW A;  1EWQ A;  4X62 K;  3CJ9 A;  5F1X A;  3M3Z A;  3D2F A;  3QEP A;  3FFK B;  3EY1 A;  3SYZ A;  5J2Q A;  4LSN A;  3H46 O;  4IFE A;  4Z4F A;  5JLF A;  1YQR A;  4EAG A;  1RM1 A;  4EAL A;  5IYB P;  3J81 O;  3R9P A;  5HRO A;  4CHQ A;  1VQ7 N;  1CXQ A;  1ESV A;  4E19 A;  4HTU A;  1YHQ N;  4CEZ A;  3HST B;  5BRE A;  2YNI A;  4FYD A;  1NGB A;  3QNN A;  4A2A A;  3TAN A;  2G30 A;  4B3R K;  1WSE A;  5F9C A;  2BDP A;  3QML A;  2G8K A;  5EVZ A;  1U2V B;  2QKK A;  4CHO A;  5BN8 A;  4DUY K;  2KTQ A;  3MWP A;  2D0A A;  3ZLJ A;  3DJC A;  3DXM B;  1DTT A;  3K5O A;  4B1X B;  4CJW A;  3LDQ A;  1L5U A;  2ZFD B;  1Q86 O;  3PDK A;  3SPZ A;  4JI5 K;  4GW6 A;  2F9W A;  3IKM A;  3NVK A;  2IV8 A;  4L8R B;  5AQF A;  4H5T A;  3LZI A;  4DSE A;  4CJT A;  3K57 A;  4B9N A;  3IS9 A;  3ZSR A;  3CF5 L;  1RFQ A;  3P38 A;  2DTU A;  2P51 A;  3F2K A;  4FLX A;  3C6A A;  5C15 A;  3R1X A;  3DM2 A;  3RVC A;  4LFC K;  3AO3 A;  4DCH A;  3CQ8 A;  4CD3 A;  1U04 A;  5EX5 A;  5IYC P;  5I42 A;  4A5A A;  4JI8 K;  4ICL A;  1NJW A;  3HVR A;  1QTS A;  2BAN A;  2WON A;  1YJ9 N;  1KLN A;  4R79 A;  1RBV A;  3OGD A;  1YQK A;  2XY7 A;  3O4Q A;  5C2D A;  1HRH A;  4A2B A;  1U47 A;  3AAR A;  3CQX A;  5JVH L;  5K14 A;  1WAJ A;  3C6H A;  1CZA N;  4EAJ A;  3CI5 A;  3QEX A;  1NM1 A;  3CFR A;  2HMP A;  3TAE A;  4MFB A;  4FK0 A;  4JI1 K;  1VQ9 N;  2OPS A;  4CEC A;  2D0P A;  4E0D A;  1IG8 A;  4CHY A;  2HST A;  4MO5 A;  5BRD A;  4CGH A;  3AAP A;  5AQM A;  3QNO A;  4YOW A;  1Z6R A;  1Q18 A;  1JLA A;  4B1Y B;  3K9K A;  2O8B B;  1NGM A;  4E1M A;  3HTV A;  4JHD A;  5AQI A;  1VSE A;  5E84 A;  5E41 A;  3CER A;  1DT9 A;  3MXM A;  2VWB A;  3ENO C;  5A2Q O;  3FGU A;  3NH2 A;  5FPN A;  3OVN A;  3VA0 A;  4FK2 A;  3VEN A;  2VGM A;  4NCG A;  2PY5 A;  4DTJ A;  1TBP A;  1C47 A;  4FWM A;  3VMF B;  1GLA G;  1TL1 A;  4K43 A;  3WNH A;  2RF2 A;  4AHU A;  3VQ7 A;  3THV A;  1N36 K;  1TK8 A;  1OH7 A;  4DR5 K;  4LY7 A;  2Y1J A;  1RBS A;  1U49 A;  1RT7 A;  3QEV A;  2QRD A;  4JKB A;  1KYU A;  1R59 O;  4JKD A;  4CES A;  4Z4E A;  4LFB K;  4CK2 A;  2IIR A;  4FZX C;  3HRG A;  3LL3 A;  5CZ2 A;  3PLA A;  4IDK A;  1AIS A;  3QIC A;  1BA0 A;  3SV4 A;  4KKO A;  1RGI A;  5M1K A;  3WEE B;  1NK4 A;  4BR0 A;  2UXC K;  3UKR A;  3SV3 A;  1JLB A;  4G1Q A;  4NLB A;  3VQB A;  1K9M O;  3SI6 A;  3M8Q A;  4FJH A;  1O1W A;  4IXC A;  2OZM A;  1KO9 A;  3CG7 A;  1GLL O;  4CF1 A;  3T1H K;  1TKT A;  4CFC A;  1M90 O;  3KD5 E;  1VSK A;  3WXI A;  1J6Z A;  2DFE A;  4DR7 K;  4CER A;  3IUC A;  1SL2 A;  2VJ0 A;  2QM1 A;  2WC9 A;  3NA5 A;  3SNN A;  4X66 K;  4DQP A;  4FJ8 A;  4M42 A;  5EY4 A;  5AQO A;  2P9L A;  4BDY A;  4FJ7 A;  1FXX A;  2GWK A;  4EFH A;  1EET A;  1VSD A;  1XI1 A;  4DQQ A;  3O80 A;  2P5O A;  5JLH A;  3CCM N;  3T3F A;  5M1P A;  2G8H A;  3I55 N;  3L2Q A;  1BGX T;  3NMU A;  3CHW A;  3MMV A;  2QI2 A;  4M3W A;  4C1N K;  3HO1 A;  3WNG A;  3SQ4 A;  1YTA A;  2F7L A;  3THX A;  2E8A A;  3OST A;  1SZ2 A;  2RHK A;  3O4W A;  4ZTJ A;  2IV9 A;  4EP5 A;  2NOL A;  2OA8 A;  2V92 A;  1GLD G;  3SZ2 A;  4CZH A;  4Y1D A;  2KW4 A;  3D6R A;  2QWM A;  4FM2 A;  3D2E A;  2FBY A;  1BIU A;  5HRN A;  2XY5 A;  3ZT2 A;  1KFD A;  1NK0 A;  1QN6 A;  1SKR A;  2E6L A;  1T6C A;  4FWL A;  3AO2 A;  3H1V X;  4JHD B;  4DV1 K;  1KFS A;  4IZ9 A;  4GVM A;  4IDH A;  3VQ4 A;  2UUA K;  4YDU C;  4BRI A;  5HP1 A;  2QWO A;  3V1O A;  1X9S A;  3UB5 A;  1RTI A;  1M1K O;  5ADX A;  3UE5 A;  5CHI A;  2HHV A;  4E7I A;  3LAL A;  1R4X A;  2R7Y A;  2NLX A;  4DQ8 A;  4B08 A;  4ROC B;  4AQY K;  3TAG A;  1NGJ A;  3ITH A;  2PYJ A;  3AA3 A;  3H08 A;  4K0K K;  2FKM X;  4LH4 A;  1BIZ A;  3AVB A;  1DEJ A;  4AHC A;  3CMA N;  3CQY A;  5BPN A;  3R6M A;  3OYK A;  4FVU A;  1A5V A;  3QLH A;  4AHS A;  3P4I A;  3SQ0 A;  1NH2 A;  4A5B A;  4IOC L;  4DKW A;  1NNE A;  3MN6 A;  2GBZ A;  1LWC A;  3ALY A;  2KFN A;  4I9L A;  3SAH A;  1S1T A;  1VQ6 N;  4NCB A;  3CYM A;  4KI6 A;  5KPZ A;  1XMQ K;  2A1S A;  2HNZ A;  3PV8 A;  3GE1 A;  1REV A;  3TDH A;  2NOH A;  3P83 D;  1YAG A;  3P39 A;  2DFH A;  4RCH A;  1TKZ A;  3PX6 A;  3H6E A;  3VTH A;  2XO7 A;  2JWL A;  4KB1 A;  1HKC A;  1BI4 A;  1E4G T;  4M3Z A;  3UKR B;  1S5J A;  1NLV A;  1K8A O;  2WUS A;  1FW6 A;  4FJJ A;  1QHT A;  3GDQ A;  1OVY A;  4CHZ A;  3CET A;  1Q81 O;  2QRE A;  3DYA A;  5F0X A;  4B8C A;  4H8K A;  1YTU A;  4BC5 A;  1VQ4 N;  3TTC A;  4DSK A;  1KVB A;  3OY9 A;  4JEP A;  2FLO A;  1NGG A;  5AQP A;  2E2O A;  4BR9 A;  1GOA A;  2P9L B;  2P9P A;  1RT4 A;  3SQ1 A;  1KVC A;  4FJL A;  2W41 A;  3ZX0 A;  2NLV A;  3KTU A;  1KAX A;  4WF9 L;  4YHH K;  3TI0 A;  5D3G A;  1VAZ A;  2A42 A;  1TBA B;  3NH0 A;  3ZX2 A;  4BY9 C;  4Q5V A;  2VG6 A;  1MP9 A;  2JLE A;  3CJ7 A;  4CJ4 A;  1QN3 A;  2UYT A;  1MU2 A;  4IG3 A;  4DV5 K;  4N41 A;  1B9D A;  1K8K A;  4RWT A;  2E2P A;  3EKS A;  5CYQ A;  3QB0 A;  2MJ7 A;  2NOB A;  4I7F A;  4X65 K;  2GUI A;  1Z05 A;  4CEE A;  3AO5 A;  3UIQ A;  3ASM A;  3ATU A;  4IO8 A;  4FLV A;  2GWJ A;  2R5X A;  1TV6 A;  4FLY A;  4WXA A;  3OS0 A;  2ZE2 A;  4WFN L;  1YUW A;  1EX4 A;  2RKI A;  1S1X A;  1X3N A;  4MO4 A;  2B5J A;  3LDO A;  4CZK A;  2G8V A;  3LZJ A;  1QSL A;  3A2F A;  2O8D A;  4BRE A;  5JVG L;  4AHR A;  1P5G X;  3TSP A;  3LM9 A;  1UWB A;  3HPH A;  1Y64 A;  2G8U A;  2VG7 A;  4QS8 A;  1YJN N;  4KO0 A;  4KTW A;  4JRQ A;  1Q82 O;  4Z4H A;  3L3U A;  3NF7 A;  5B8H A;  4AHT A;  4CEO A;  1ASU A;  5FRO A;  3CCQ N;  3OLP A;  1TKX A;  1J5E K;  3V1Q A;  4MDB A;  1SKW A;  5C12 A;  3Q7B A;  2ZM6 K;  2YHX A;  3CCS N;  2I5W A;  2ZF5 O;  5AFU A;  4HTL A;  1TUO A;  3HJF A;  3KLI A;  1S9E A;  4CED A;  3U8X A;  3VQE A;  4JV5 K;  4X64 K;  5JS2 A;  4YOV A;  4CCH A;  2ZWH A;  3B6O A;  3I8D A;  3PIO L;  4JKC A;  2QLV A;  4WQ4 A;  2JPI A;  4O8K A;  4BRF A;  4BWM A;  1W0H A;  2HVI A;  1NK8 A;  4GKJ K;  3OYN A;  2Y8Q A;  3OCI A;  2FUV A;  2NUB A;  3LPT A;  1JFI C;  2V9J A;  3T4N A;  4F8R A;  4CK3 A;  1YT3 A;  1LW0 A;  5DMR A;  1VSH A;  3DLH A;  2E1Z A;  2CH5 A;  1BI4 B;  1RTD A;  3O4N A;  1R0A A;  1ZBF A;  1B9K A;  1V4S A;  2E6M A;  3AVG A;  2QEX N;  2I5J A;  3D7Q A;  3ISN C;  5IYD P;  4K41 A;  4DV6 K;  1OKJ A;  1VSI A;  1S1W A;  4KHW A;  4BRL A;  4OGE A;  3F73 A;  4WE1 A;  2IAJ A;  4TPS A;  3J7Z O;  4IEI A;  5LMU K;  3C0B A;  2ZJQ L;  1TAU A;  4FW2 A;  1HUX A;  2HHT A;  2YJF A;  1Q9X A;  3LP2 A;  3VEZ A;  4EJY A;  4H0P A;  3T7Z A;  1QN4 A;  4B9U A;  1S1U A;  3OS1 A;  4CHN A;  2IVO A;  4BC3 A;  2HL9 A;  5JN5 A;  3A5O C;  4PWD A;  5BR9 A;  5KPR A;  4WFA L;  5AQY A;  4RG8 A;  4DF4 A;  4MDA A;  2V7Z A;  5AZJ B;  2XHI A;  3AY9 A;  3KLG A;  4DLE A;  3CCV N;  3W3D A;  4O8U A;  2G8I A;  3HOT A;  3KIO A;  1HJO A;  4BE1 A;  1T3V A;  4XIU A;  4DS5 A;  4OPK A;  1VQO N;  2FSJ A;  4F2R A;  3G25 A;  1GLF O;  1A5X A;  1GLB G;  4YDU A;  1EUV A;  2PWW A;  3A5N C;  4CZG A;  4M3U A;  1TGH A;  3LAN A;  1JCF A;  3PSF A;  3CM6 A;  4M3T A;  3VEX A;  3L8B A;  3QIN A;  1WBB A;  4AM7 A;  2O8F A;  3SMS A;  1RDD A;  5BMP A;  2O8E B;  2P9N B;  3LP0 A;  1WSF A;  2IOC A;  4HVJ A;  2AJQ A;  1RDA A;  3TAM A;  3C04 A;  1T44 A;  3EKU A;  1RCH A;  3D0P A;  1Q7Y O;  4FJN A;  3QES A;  3BUZ B;  4BRC A;  4BAC A;  4JK9 A;  1CDW A;  4DHY A;  1KSP A;  4BQZ A;  3VQP A;  4FPA A;  4DMN A;  1W7A A;  4HCB A;  5CE3 A;  1NVP A;  2E2Q A;  5AFU H;  4CZI A;  1GOC A;  2E4L A;  3HP6 A;  3CJA A;  4JK8 A;  3OYE A;  4HHT A;  4E1N A;  3ZT0 A;  1CZB A;  1QSS A;  3BGR A;  1K35 A;  2WBN A;  4LF7 K;  2VQE K;  3PSI A;  4M41 A;  4BGA A;  5KRT A;  2HB5 A;  2WTU A;  3FZF A;  4FLW A;  1WSH A;  2DKC A;  1N32 K;  1UT4 A;  3D45 A;  3TAR A;  2O8C A;  3KK7 A;  3VQ5 A;  2V7Y A;  4L3Q A;  5AQJ A;  3AO4 A;  2FF6 A;  4AHV A;  2GTD A;  4KTZ A;  3CME N;  3S9H A;  3PX0 A;  4BR5 A;  5HRS A;  3RSE B;  3L2U A;  4FLT A;  3CFO A;  5C25 A;  2VQF K;  5AQS A;  2JWK A;  1U6Z A;  1BIS A;  1HKG A;  5AQG A;  3FZL A;  1J3M A;  4B1Z A;  4CK1 A;  3DLR A;  3NCI A;  4OX9 K;  1DIZ A;  1XC9 A;  3OBW A;  3OYF A;  2NRW A;  1IG9 A;  3AVF A;  4CJR A;  3L2V A;  1H1V A;  3O9R A;  3MEG A;  1HNZ K;  2Q31 A;  2D4W A;  3DOK A;  1GLJ O;  1KLM A;  1XUP O;  4JN4 A;  3UKU A;  2YHY A;  4KHP K;  1HMV A;  1GLC G;  4BG8 A;  3ZT1 A;  4C8K A;  3P5J A;  3U4L A;  4H5R A;  2ZJR L;  4H0V B;  4QS7 A;  4BR2 A;  4F3T A;  4YOU A;  2GEM A;  3NGZ A;  1NG9 A;  3TAQ A;  2O4I A;  2X74 A;  4GMJ B;  4LF4 K;  3WXL A;  2QW9 A;  1BOT O;  3CVT A;  2VWJ A;  2AP1 A;  2YKM A;  1DKG D;  3GOI A;  2KZZ A;  4BRN A;  3FR0 A;  2G8W A;  1IJJ A;  3LP3 A;  3VEV A;  2AA4 A;  4ID5 A;  5KQD A;  3CVS A;  4FZZ A;  2HHH K;  1DLO A;  1NOY A;  2OPR A;  3EIK A;  1IKW A;  2PAV A;  5BR8 K;  3O9T A;  2HZS A;  4JI4 K;  2PYL A;  1VSL A;  3L0Q A;  4JRP A;  2LSN A;  2MZ8 A;  3ZT3 A;  4C8M A;  3CCU N;  3EN9 A;  3EE8 A;  1TK0 A;  2GV9 A;  4KTQ A;  4QOZ B;  4OLB A;  4DF8 A;  1YJW N;  3QFP A;  3ZCM A;  1HNW K;  4BJU A;  1HQU A;  2QWP A;  5JMV D;  5JIC A;  3ZSV A;  5GAD P;  2QR1 A;  1QE1 A;  4FLU A;  4CF0 A;  5FRN A;  3H1Z A;  4NCA A;  3HK2 A;  4ROE B;  2Z8U A;  5AQN A;  1VQM N;  1HLU A;  4H4O A;  4BRG A;  5LY3 A;  1KY6 A;  1UOC A;  4ILG B;  3D2F B;  1RDB A;  1EBM A;  3DWL A;  2QWR A;  4XEI A;  4OO1 J;  1QHA A;  4FK4 A;  3L3V A;  4OPH A;  4FO0 A;  5LJV A;  4HUG A;  3CC4 N;  3SBT A;  3Q7C A;  1FN7 A;  1QN5 A;  3BF3 A;  1LWE A;  3U3G A;  2Q0R A;  1KRP A;  4HUE A;  5TKY A;  1NK6 A;  4J2A A;  3GG4 A;  3KLE A;  3ID6 A;  4B8A B;  2EHG A;  3ENH A;  3VQ6 A;  3VPZ A;  3AVC A;  4BDZ A;  1KAY A;  1N5Y A;  4W5Q A;  1KD1 O;  3FZH A;  1RT1 A;  3NBP A;  2HVH A;  2A6A A;  2BH1 A;  3C95 A;  3ZEU A;  1JLC A;  3VF6 A;  3AA5 X;  2QRC A;  4ELT A;  4WQ4 C;  1QNE A;  1F21 A;  3VA3 A;  1PCZ A;  4Z4I A;  3S3O A;  4FW1 A;  3V4I A;  3TE5 A;  2E5L K;  3KLF A;  3H3N O;  4ELV A;  3LM2 A;  4H03 B;  1BQN A;  4B3O A;  4CZJ A;  3MWT A;  4Y0W A;  5C0Y A;  1X1P A;  3SUO A;  2YA3 A;  3NHG A;  3L2R A;  1Y97 A;  1C9B B;  4IJN A;  4B9T A;  3DLE A;  1DTQ A;  3LPU A;  2IC3 A;  3D7E O;  4FVM A;  4IG0 A;  3UKU B;  4EJZ A;  2PBD A;  4ROD B;  3MED A;  1YXQ A;  3LWM A;  1K6Y A;  5EOY A;  2Q0U A;  5GIO A;  4KHU A;  1LAV A;  1UAX A;  3SUN A;  1ATN A;  3CC2 N;  1P8Z A;  3G10 A;  4N47 A;  4FWR A;  4OGC A;  4EIA A;  1PZD A;  1C1A A;  5LMN K;  4CJS A;  3P31 A;  3K58 A;  4M3X A;  4O0J A;  2HBM A;  4BRM A;  1NGC A;  2ASO A;  4A61 A;  1I94 K;  4CZE A;  1UL7 A;  2FBX A;  2YX6 A;  2B6A A;  5AQQ A;  1VQL N;  4A62 A;  2KKZ A;  3MX2 A;  1N33 K;  5AQK A;  2HNY A;  1D3U A;  3OYI A;  1KC8 O;  2Z1G A;  1B92 A;  4OVL A;  3VGL A;  2V51 B;  1RBR A;  1NU0 A;  5H1S Q;  1D4X A;  2NZT A;  3FZM A;  4MQ3 A;  4OKE A;  4IO9 L;  4D7R A;  2OTJ N;  2UUB K;  5GAH P;  4DG1 A;  4CJP A;  3QBW A;  1RTJ A;  4CFB A;  4DQR A;  2DPN A;  3RTV A;  4FWO A;  1YVN A;  1ASW A;  1GLE G;  2HHS A;  3AVJ A;  4DR4 K;  4DWI A;  1L3T A;  5LJW A;  1BCM A;  4M7X A;  4NXM K;  4DV2 K;  2Z1J A;  1WLJ A;  3MK6 A;  2HF4 A;  3NE6 A;  3EAY A;  4JLH A;  3RMD A;  4RW8 A;  5AJ3 K;  3K2P A;  1QTP A;  3HM8 A;  3M8P A;  4BRD A;  3E66 A;  1VKL A;  5AQX A;  5HL7 L;  1ITG A;  4RW6 A;  2IGI A;  3NF8 A;  4BRH A;  5KGW A;  3CPE A;  1XSZ A;  3DLL L;  1PVS A;  1WB9 A;  3IG1 A;  4ZHR A;  3L6Q A;  1NMN A;  4B3T K;  4I8O A;  2FGT A;  2IVP A;  4JAX A;  4CI6 A;  1X9W A;  3HYF A;  3JS6 A;  1KFI A;  4JK7 A;  3V1R A;  4DSL A;  5JMV A;  5AQZ A;  4KH5 A;  3C6U A;  3ENB A;  5AQH A;  1KAZ A;  3T1A A;  1RT5 A;  2NVM A;  3ZEU B;  2QWQ A;  2YCH A;  4CJQ A;  4E7K A;  5SWM A;  2FSK A;  2Z1I A;  3VF2 A;  1ZBH A;  3JYT A;  2ASP A;  1WSG A;  2BTF A;  3CJB A;  2HF3 A;  2ZJP L;  1KY7 A;  3A5M C;  3QER A;  1NK7 A;  3CCJ N;  3N4Q A;  1NGI A;  3O9S A;  1JLG A;  1UT7 A;  2OOX A;  3DLK A;  1QTM A;  5J2M A;  2QKB A;  4CGI A;  1MWK A;  5F2R A;  1NGD A;  2F8T A;  3SNS A;  1NGE A;  3ULE A;  2KFZ A;  4CJV A;  1BUP A;  2CGL A;  5AQT A;  2HZM A;  1QQN A;  2F8S A;  5M1F A;  1KCF A;  4CJL A;  4KHY A;  1HR0 K;  4PL8 A;  2JGU A;  5DK5 A;  1N34 K;  4BRQ A;  4J8F A;  3FE1 A;  3HBT A;  3EZ5 A;  3O3F A;  4CIF A;  4DFM A;  4J2E A;  3IH7 A;  4FM0 A;  3TSQ A;  4W5R A;  3EO3 A;  4FPB A;  5SZT A;  4GNI A;  3OYC A;  1YIT N;  1KFQ A;  2NRT A;  4DU4 A;  3HPG A;  5AN4 A;  4PUO A;  3V9U A;  3O8M A;  3SPY A;  2HHX A;  1P5D X;  3ATV A;  3THX B;  3SMP A;  1DGK N;  3ZX3 A;  4I2P A;  1JLE A;  4OPA A;  5I9E B;  1QQO A;  3VOV A;  3DLG A;  1EP4 A;  4LF9 K;  2E88 A;  4DTS A;  2VWK A;  4O5F A;  2YHA A;  3G4S N;  3C94 A;  4NYF A;  4CVN E;  4B1V A;  3CCL N;  2BGG A;  3HZ6 A;  3LAM A;  1VHX A;  2YI1 A;  5KRS A;  3D2E B;  4CF9 A;  4UQG A;  2DFF A;  4GV9 A;  2CGK A;  1VOK A;  3DPT A;  3KVG A;  3QIP A;  3QET A;  3QFU A;  4AH9 A;  3TWH A;  4FJ5 A;  3KJV A;  4U7B A;  3RMA A;  1U48 A;  3K59 A;  2P9K A;  4MLH A;  4E7J A;  3SJJ A;  5KL0 A;  3CFP A;  2GUP A;  5M1N A;  5BRH A;  3U3Y A;  3AVI A;  3OSE A;  3R3L A;  3I56 N;  4E3S A;  4OKJ A;  2W6L A;  2JHJ A;  4DQI A;  4QAG A;  2UXB K;  1K2Y X;  3WNE A;  3OTO K;  2P9U A;  4G9Z A;  1KYF A;  4FSV A;  3OYM A;  1L3V A;  4FJK A;  2A40 A;  3G0Z A;  4JI0 K;  4CIG A;  4DUL A;  2OPP A;  4FJ9 A;  1TUU A;  5ADX H;  5FRM A;  4EAI A;  4F3O A;  1RDW X;  3GBT A;  1IBM K;  3BZK A;  2GX9 A;  1HQE A;  2W6K A;  2P5G A;  4GY2 B;  5IWA K;  4H5N A;  3PMG A;  5J2N A;  1XHX A;  1T05 A;  1VK0 A;  2P9S A;  3RR8 A;  3KD1 E;  3ZSO A;  4CZL A;  3KK1 A;  3CWT A;  3VF4 A;  3ZSX A;  4CZM A;  3RRH A;  2D0C A;  1QNB A;  3CC7 N;  2H3G X;  2Q1N A;  4B9Q A;  2Y8L A;  4K42 A;  3OJU A;  2B4J A;  1HU0 A;  3CWA A;  1LWF A;  1RBT A;  4CBW A;  5C2F A;  3KRM A;  4I2Q A;  4KH4 A;  4M45 A;  3CXC M;  3OBY A;  2PZS A;  5I3U A;  4IFY A;  1VQK N;  3OH9 A;  3D4V A;  3KZB A;  3G6E N;  1NMD A;  4CJ3 A;  4DTN A;  4PL7 A;  1NOZ A;  4H4M A;  4BE2 A;  1BG3 A;  5HRP A;  4DFK A;  3QO9 A;  3HI0 A;  3F10 A;  4WZS D;  3NFA A;  4B1U B;  3OSM A;  4CGJ A;  5BMN A;  4CEQ A;  3S3M A;  3CCE N;  1BO5 O;  3WXK A;  4JKG A;  2HMI A;  4WFB L;  1LCU A;  3PIP L;  5J2P A;  3QEW A;  1WNS A;  3OYA A;  2P9P B;  4DSF A;  1RDC A;  1WBD A;  3I0R A;  3KHY A;  5CZ1 A;  1U2V A;  1BWF O;  4EZ6 A;  4ISF A;  2X6N A;  2OYQ A;  3BY5 A;  1KQS M;  4W5N A;  1YVU A;  1JCG A;  1JLF A;  3DXM A;  4YOY A;  4B9V A;  2F7T A;  1KYD A;  2A3Z A;  1SV5 A;  4O0I A;  1K8K B;  3MX5 A;  3MXI A;  4CW7 B;  3M6G A;  3SBG A;  1JCE A;  1SKS A;  2HOE A;  3MN5 A;  4BRP A;  1V5S A;  4RW4 A;  3VGM A;  4U67 L;  4LFA K;  2ZGZ A;  4DFP A;  3HPO A;  2E20 A;  3SQ2 A;  4N76 A;  4N56 A;  2F96 A;  3H1Q A;  3FZK A;  4WQ5 A;  2DY4 A;  4ILH A;  3C6T A;  3VQD A;  1L3S A;  3DLB A;  4K8X A;  4R5P A;  3T1Y K;  1Q8I A;  1UA0 A;  1N3A A;  2NRH A;  2YV0 X;  4BRA A;  1L3U A;  1XQS C;  2BUP A;  2Y1I A;  2O8D B;  4CIE A;  2V8Q A;  3KKR A;  4C23 A;  1XMO K;  1TUY A;  5MLC Q;  2P9K B;  3O08 A;  3K5N A;  3P1G A;  3SCX A;  1OH8 A;  3VQ8 A;  1A5W A;  4IL8 A;  2YNF A;  4DTX A;  1N3C A;  4CJF A;  3RMB A;  5M1Q A;  3KWI A;  4JI6 K;  4OLA A;  4DU1 A;  3OYL A;  2HBL A;  1BDG A;  1HKB A;  2P9U B;  1X9M A;  3O6W A;  4ISE A;  1YF5 L;  2NRZ A;  1WQA A;  3DPU A;  2PFU A;  1VQ8 N;  4B3S K;  4CEB A;  1QNC A;  1D5A A;  1D8Y A;  1ZBS A;  4CGG A;  3MEE A;  3NAE A;  5GAG P;  4KPY A;  2VYP A;  4V19 S;  4DSJ A;  4FL9 A;  4ISG A;  3AV9 A;  4LD0 A;  4PHT X;  1KVA A;  2W40 A;  4J2B A;  3ZSZ A;  3JXU A;  5FDL A;  2O8B A;  3UW2 A;  2P9S B;  1TYQ A;  3CWS A;  4YY3 K;  3AVL A;  3V9Z A;  1S72 N;  2QXL A;  1FK9 A;  1TGO A;  2E1Y A;  1IV0 A;  1NWK A;  1K73 O;  1J54 A;  4Z0U A;  3DI6 A;  5FPM A;  3IMX A;  2E2N A;  2I7N A;  3O9Q A;  1VRU A;  3HL8 A;  5CY4 A;  3ZT4 A;  4BE0 A;  3VGK A;  4HWI A;  4DR3 K;  3KK2 A;  3I33 A;  3RR7 A;  3WNF A;  1SL0 A;  2WFB A;  2H5A X;  3BKQ X;  1VSJ A;  4BC4 A;  4FWP A;  2A5X A;  1IKX A;  5KTQ A;  4FJX A;  4KHS A;  2D0B A;  1G15 A;  2OAN A;  3O1W A;  3AVN A;  4B1W B;  4CJU A;  4BGB A;  3OJS A;  3TAF A;  3NF6 A;  4Z4G A;  4Z4C A;  5CR4 A;  3M1F A;  4NLC A;  4JKG B;  2ETJ A;  1MDU B;  2CH6 A;  4FCY A;  1JL2 A;  3W0L A;  4BWJ A;  5M1O A;  4AF1 A;  2FKF A;  4WYB A;  1O13 A;  1VTO A;  1S6Q A;  4I6M A;  4DR2 K;  4J2D A;  4W5O A;  3SUP A;  4I9Q A;  4EZ9 A;  2UXD K;  1T6D A;  3WEE A;  2ZD1 A;  1FKP A;  4QCL A;  3BZC A;  4IWV A;  3QEI A;  2WOM A;  3WQU A;  3OS2 A;  5BRF A;  1CLQ A;  3E9O A;  2NRX A;  3WUH A;  1JLQ A;  1ZC6 A;  1Q9U A;  4O55 A;  2D0O A;  2V52 B;  4ELU A;  3THY A;  3ENC A;  4Y1C A;  3U9D A;  3K0S A;  2H4L X;  4GVE A;  4YFU A;  3J80 O;  1QQC A;  4K8Z A;  4DTO A;  4JI2 K;  1Q9Y A;  3OYJ A;  1NKE A;  3OA9 A;  1C0F A;  1OH5 A;  4CBX A;  4MRQ A;  4IOA L;  3VQQ A;  1YQM A;  2DKA A;  1XC3 A;  1M5Q 1;  4KFB A;  4H0O A;  1IKV A;  2UU9 K;  2HW3 A;  3PY8 A;  4Z94 A;  1C0M A;  4W5T A;  1XNR K;  5HBM A;  5LL6 Z;  3EYZ A;  1W2B M;  4KHQ A;  4H0T B;  2O8F B;  2ZGY A;  3HT3 A;  4GV6 A;  1B9F A;  3KLH A;  1X9J A;  1N6Q A;  1RIL A;  4JKA A;  4FWN A;  1U4B A;  1J53 A;  5BPM A;  3RWU A;  1C4G A;  1QNA A;  3LP1 A;  3KKS A;  4A59 A;  4DTR A;  5DM6 L;  1IO2 A;  2F9T A;  3NDK A;  1FKO A;  4M3R A;  4M3Y A;  4KRE A;  1JXB A;  3H45 C;  3LDS A;  5GIN A;  4JI3 K;  3LWL A;  3JAM O;  1IKY A;  3ZSQ A;  3VQC A;  2QTD A;  3E01 A;  4IJA A;  4BQL A;  2P1J A;  1OVQ A;  5ELZ A;  4DV3 K;  1WSJ A;  2YNG A;  3CW7 A;  5E26 A;  1TYQ B;  1QN8 A;  3RPJ A;  3U6F A;  1VQ5 N;  2FSN A;  2X78 A;  2FXU A;  1JXE A;  4RW7 A;  3KTQ A;  2EWS A;  2FF3 B;  2IVN A;  1EQY A;  3AGR A;  3CD6 N;  1TVR A;  5HSH A;  4XH5 A;  1ZYQ A;  4CEA A;  2O8C B;  3SJH A;  4FWQ A;  2IDO A;  4O44 A;  5FLX O;  3LDP A;  2W42 A;  3L4Q A;  4IEE A;  2X6S A;  2HHW A;  3HXM A;  4CFF A;  3IFR A;  4LF8 K;  3K9J A;  1QN7 A;  1S6P A;  3N4P A;  1WSI A;  1TK5 A;  3KK3 A;  3I0S A;  2G8F A;  1EXQ A;  4CFD A;  1G99 A;  3BF1 A;  2HKP A;  1IBL K;  4IOX A;  3O3G A;  1ILY A;  5KI6 A;  4C7P A;  4EAK A;  1Z25 A;  1E4F T;  4OKK A;  1N8R O;  2BE2 A;  4WX8 A;  4DTP A;  1ZBI A;  2F4V K;  1QQM A;  4BVP A;  3HS8 A;  1LV5 A;  1RBU A;  1JDY A;  1LWV A;  1LOT B;  2O4G A;  4I6M B;  1SQK A;  4KB0 A;  1BQM A;  3MCA B;  4DR6 K;  4XH4 A;  4BRK A;  1X3M A;  4KRF A;  4CJE A;  3E1Y A;  3AA4 A;  2RN2 A;  4CJ5 A;  3OYD A;  4PKI A;  1NGH A;  3AO1 A;  4DQS A;  1V4T A;  4LH5 A;  1EWR A;  5KPT A;  4KBO A;  1XHZ A;  4HCC A;  3HOS A;  4NB4 A;  2NRR A;  1S9G A;  4H5V A;  4E1J A;  4FLZ A;  1VQP N;  3HSC A;  3F9M A;  3V6D A;  4KH6 A;  4FOE A;  1EO1 A;  3F5T A;  1HPM A;  3THY B;  1NJX A; 
#chains in the Genus database with same CATH homology
 4CJT A;  1Z26 A;  4PWD A;  1JKH A;  5SZT A;  3K57 A;  3OYC A;  4B9N A;  3IS9 A;  3ZSR A;  1BHL A;  4RG8 A;  4DU4 A;  3ZSY A;  2DTU A;  2P51 A;  3HVT A;  3HPG A;  3I0X A;  4FLX A;  4DF4 A;  5AN4 A;  4PUO A;  3V9U A;  4CJK A;  1ZBU A;  2XHI A;  3DM2 A;  3KLG A;  3SPY A;  1I39 A;  2HHX A;  3AO3 A;  3CQ8 A;  4DLE A;  1U04 A;  4I2P A;  1JLE A;  5IYC P;  5I42 A;  1TAQ A;  2G8I A;  3DLG A;  1EP4 A;  3KIO A;  3DRS A;  4BE1 A;  4DTS A;  2VWK A;  4ICL A;  1NJW A;  4YNQ A;  3HVR A;  2YHA A;  1QTS A;  2BAN A;  2FBT A;  2WON A;  3C94 A;  4XIU A;  4NYF A;  1NJY A;  4DS5 A;  3PO4 A;  1KLN A;  2BGG A;  3B6P A;  3LAM A;  4OPK A;  3TAB A;  2ATQ A;  1XWL A;  3MEC A;  3NH1 A;  5KRS A;  1C6V A;  4CF9 A;  4F2R A;  4UQG A;  1RBV A;  2DFF A;  1VOK A;  1YQK A;  1A5X A;  3O4Q A;  2XY7 A;  1HRH A;  3DPT A;  3QIP A;  3VQ9 A;  3QET A;  1U47 A;  4Q11 A;  4AH9 A;  5K14 A;  1WAJ A;  4M3U A;  1TGH A;  3LAN A;  3TWH A;  4FJ5 A;  3KJV A;  3RMA A;  1U48 A;  3K59 A;  3PO5 A;  4FJG A;  3SJJ A;  4E7J A;  3N89 A;  3CM6 A;  3CFP A;  1YTB A;  4M3T A;  3QEX A;  3ULD A;  1N39 A;  4EP4 A;  3L8B A;  1C0T A;  1HNI A;  3JSM A;  3CFR A;  3U3Y A;  3AVI A;  4KAZ A;  4E3S A;  1I3A A;  3QIN A;  3TAE A;  4OKJ A;  5JS1 A;  4DQI A;  4MFB A;  4FK0 A;  4QAG A;  2OPS A;  4CEC A;  4E0D A;  4IFV A;  1RDD A;  4CHY A;  3LP0 A;  3WNE A;  1S1V A;  1WSF A;  1KYF A;  2IOC A;  4CGH A;  4HVJ A;  2O3O A;  2AJQ A;  1RDA A;  3TAM A;  3QNO A;  3AA2 A;  3OYM A;  1L3V A;  5HRR A;  1JLA A;  4FJK A;  1RCH A;  3D0P A;  3L2W A;  1M3H A;  2ITG A;  3G0Z A;  1W80 A;  2KQ2 A;  1NGM A;  4E1M A;  4PQU A;  4CIG A;  4DTM A;  4DUL A;  2OPP A;  3QES A;  4FJN A;  1VSE A;  5E41 A;  4BAC A;  4FJ9 A;  1N5Y A;  1CDW A;  1KTQ A;  3AVK A;  1KSP A;  5FRM A;  3MXM A;  4CE9 A;  4F3O A;  4DS4 A;  3VQP A;  4DMN A;  4HCB A;  3NH2 A;  3OVN A;  3VA0 A;  1HQE A;  4FK2 A;  1NVP A;  2P5G A;  4NCG A;  1YQL A;  2PY5 A;  1W9H A;  4DTJ A;  3ZSW A;  1GOC A;  2E4L A;  2Q3S A;  4CFA A;  3HP6 A;  5J2N A;  1XHX A;  3OYE A;  1TBP A;  1T05 A;  1VK0 A;  4HHT A;  5EU7 A;  4E1N A;  3ZT0 A;  1CZB A;  4CGF A;  1QSS A;  3BGR A;  3RR8 A;  4F4K A;  3KD1 E;  3ZSO A;  1TL1 A;  3WNH A;  3KK1 A;  4M41 A;  2RF2 A;  3ZSX A;  4AHU A;  3VQ7 A;  1BCO A;  3RRH A;  3THV A;  2D0C A;  1QNB A;  5KRT A;  2FBV A;  2HB5 A;  1TK8 A;  4PA1 A;  4LY7 A;  3OJU A;  4FLW A;  2Y1J A;  2B4J A;  2LAE A;  1HU0 A;  1WSH A;  1RBS A;  4B9M A;  1LWF A;  1RBT A;  1UT4 A;  3CM5 A;  1U49 A;  1RT7 A;  3QEV A;  3D45 A;  1KYU A;  4CES A;  4Z4E A;  3KRM A;  4I2Q A;  4M45 A;  3TAR A;  2PZS A;  5I3U A;  4IFY A;  4B9L A;  4Q0B A;  3V9W A;  3VQ5 A;  4CJ3 A;  1IH7 A;  2XY6 A;  4CK2 A;  4DTN A;  3OC3 C;  1NOZ A;  4H4M A;  2YH5 A;  3AO4 A;  1WN7 A;  4BE2 A;  4FLT A;  4AHV A;  5HRP A;  4FZX C;  3V9S A;  3RRG A;  5CZ2 A;  2VG5 A;  4KTZ A;  4DFK A;  3S9H A;  3PX0 A;  3QO9 A;  1J5O A;  4IDK A;  4PY5 A;  5HRS A;  3F10 A;  2NOE A;  3L2U A;  4WZS D;  2YNH A;  1AIS A;  3CFO A;  3NFA A;  4ID1 A;  5C25 A;  2HW3 A;  3SV4 A;  4KKO A;  3V81 A;  3OSM A;  4CGJ A;  1BIS A;  3DMJ A;  1NK4 A;  4DFJ A;  4CEQ A;  3S3M A;  4F8R A;  1HYZ A;  3SV3 A;  1JLB A;  2HMI A;  4G1Q A;  4CK1 A;  3DLR A;  3NCI A;  3VQB A;  3OYH A;  5J2P A;  3M8Q A;  3SI6 A;  1O1W A;  1SUQ A;  1XC9 A;  4FJH A;  3QEW A;  4C8N A;  2OZM A;  3OYF A;  1KO9 A;  2NOI A;  3CG7 A;  1WNS A;  3OYA A;  4CF1 A;  1TKT A;  4CFC A;  4DSF A;  1IG9 A;  1VTL E;  1VSK A;  3AVF A;  2DFE A;  1RDC A;  4CJR A;  3I0R A;  3K5M A;  4C8L A;  3L2V A;  4CER A;  5CZ1 A;  1QS4 A;  1SL2 A;  4EZ6 A;  2X6N A;  2OYQ A;  3MEG A;  4DU3 A;  2VJ0 A;  1ZBL A;  1NKC A;  4W5N A;  3DOK A;  3SNN A;  4FM1 A;  1YVU A;  1JL1 A;  1JLF A;  5J1E A;  4B9V A;  4C8O A;  1KYD A;  1KLM A;  1SV5 A;  4DQP A;  3LAK A;  4FJ8 A;  4M42 A;  1HMV A;  4O0I A;  3MXI A;  3ZT1 A;  4C8K A;  3P5J A;  2QXF A;  3PX4 A;  4E7L A;  4DSI A;  4O5B A;  4BDY A;  4FJ7 A;  4DTU A;  1VSM A;  1FXX A;  4F3T A;  1SKS A;  3NGZ A;  1NJZ A;  3TAQ A;  2O4I A;  1EET A;  2RPI A;  2YKN A;  2X74 A;  4GMJ B;  4RW4 A;  1VSD A;  1XI1 A;  4DQQ A;  2P5O A;  4KV8 A;  4DFP A;  4B9S A;  3HPO A;  3HM9 A;  3T3F A;  2G8H A;  2JOI A;  3SQ2 A;  1RT2 A;  4OPJ A;  3L2Q A;  4N56 A;  1BGX T;  4N76 A;  2VWJ A;  2F96 A;  1HNV A;  2YKM A;  2NOZ A;  2KZZ A;  2DY4 A;  4M3W A;  3C6T A;  3VQD A;  1L3S A;  3DLB A;  2G8W A;  3LP3 A;  4K8X A;  4R5P A;  3IRX A;  3OYG A;  4ID5 A;  1Q8I A;  4FZZ A;  3HO1 A;  1UA0 A;  1N3A A;  1DLO A;  2OPR A;  2YV0 X;  3WNG A;  3SQ4 A;  3EIK A;  1IKW A;  1UA1 A;  1L3U A;  2HHQ A;  1YTA A;  2Y1I A;  4CIE A;  3KKR A;  3OST A;  4DLG A;  2HZS A;  3K5N A;  4ZTJ A;  1VRT A;  2PYL A;  3P1G A;  1VSL A;  2IV9 A;  4EP5 A;  2NOL A;  4JRP A;  4JS4 A;  3VQ8 A;  3SCX A;  2OA8 A;  2LSN A;  1A5W A;  4B0A A;  2MZ8 A;  3SZ2 A;  1LAW A;  3ZT3 A;  4C8M A;  4Y1D A;  1WAF A;  2KW4 A;  1LWY A;  5KGX A;  1TK0 A;  2GV9 A;  4N5S A;  4KTQ A;  2YNF A;  1QSY A;  4QOZ B;  1VOL B;  4DTX A;  1N3C A;  4CJF A;  1TKD A;  4FM2 A;  3RMB A;  2FBY A;  1BIU A;  3I0W A;  5HRN A;  2XY5 A;  3ZT2 A;  4OLB A;  4DF8 A;  1KFD A;  4OLA A;  4JS5 A;  4DU1 A;  3OYL A;  1NK0 A;  1QN6 A;  1SKR A;  3IAY A;  2E6L A;  3ZCM A;  1HQU A;  1X9M A;  3HS9 A;  3ULX A;  2HHU A;  2KFN A;  3DPU A;  3ZSV A;  3AVA A;  4KI4 A;  3AVM A;  1QE1 A;  3AVH A;  2OPQ A;  3AO2 A;  4CF0 A;  4TSX A;  1VSF A;  4CEB A;  4FLU A;  1QNC A;  1D5A A;  1KFS A;  3NF9 A;  5FRN A;  4GVM A;  2XHB A;  1D8Y A;  3H1Z A;  3VQ4 A;  4CGG A;  3MEE A;  5HP1 A;  4NCA A;  3HK2 A;  1LW2 A;  3NAE A;  4KPY A;  4ROE B;  2Z8U A;  3V1O A;  1X9S A;  2A1R A;  1RTI A;  4DSJ A;  1NJX A;  3AV9 A;  3DRP A;  4LD0 A;  2HHV A;  4E7I A;  3LAL A;  4H4O A;  1R4X A;  1KY6 A;  1KVA A;  1UOC A;  4J2B A;  2R7Y A;  4B08 A;  4ROC B;  3ZSZ A;  1RDB A;  1EBM A;  3TAG A;  5FDL A;  3ITH A;  2PYJ A;  3SUQ A;  4F2S A;  3AA3 A;  4FXD A;  2OZS A;  1NKB A;  3H08 A;  4FK4 A;  3L3V A;  4IKF A;  3AVL A;  3V9Z A;  4HUG A;  3T19 A;  4LH4 A;  1C1B A;  1BIZ A;  1FK9 A;  3AVB A;  4AHC A;  3MAQ A;  1TGO A;  3OYK A;  2KZM A;  1A5V A;  1FN7 A;  1QN5 A;  3QLH A;  3M8R A;  3K5L A;  4AHS A;  1J54 A;  1LWE A;  1NH2 A;  3SQ0 A;  3U3G A;  3RMC A;  4KHN A;  4Z0U A;  1KRP A;  3DI6 A;  4HUE A;  4IBN A;  1NK6 A;  4J2A A;  3KD5 E;  2GBZ A;  4FJM A;  1LWC A;  1VRU A;  3ALY A;  3HL8 A;  5CY4 A;  3ZT4 A;  4B8A B;  1HPZ A;  2EHG A;  4I9L A;  3KLE A;  4BE0 A;  1S1T A;  4E7H A;  4NCB A;  3CYM A;  3VQ6 A;  3KK2 A;  3RR7 A;  4KI6 A;  3AVC A;  4BDZ A;  1RT3 A;  2A1S A;  2HNZ A;  3WNF A;  4W5Q A;  3PV8 A;  3NBP A;  1RT1 A;  1REV A;  3S3N A;  2NOH A;  3P83 D;  4CGD A;  2HVH A;  4FZY A;  2DFH A;  1VSJ A;  3C95 A;  1TKZ A;  1IKX A;  1JLC A;  3PX6 A;  3AA5 X;  5KTQ A;  1NK9 A;  2XO7 A;  4FJX A;  4KHS A;  4ELT A;  2D0B A;  4HUF A;  1G15 A;  4KB1 A;  1QNE A;  2IS3 A;  1F21 A;  3AVN A;  3QIO A;  3OJS A;  1BI4 A;  4CJU A;  3VA3 A;  3TAF A;  1PCZ A;  3NF6 A;  1SL1 A;  3S3O A;  4M3Z A;  4FW1 A;  4Z4C A;  4Z4I A;  4Z4G A;  4CEF A;  1S5J A;  1CXU A;  3V4I A;  1CZ9 A;  3MXJ A;  3KLF A;  3TAP A;  2ETJ A;  4ELV A;  4FCY A;  4FJJ A;  1JL2 A;  1QHT A;  1HYS A;  4BWJ A;  1BQN A;  4B3O A;  5CYM A;  2FC0 A;  1RT6 A;  4CHZ A;  1EKE A;  1VTO A;  1T7P A;  1BL3 A;  1S6Q A;  3VN5 A;  1X1P A;  3DYA A;  3SUO A;  3NHG A;  4B8C A;  4H8K A;  3L2R A;  1YTU A;  4J2D A;  4W5O A;  4E89 A;  1NK5 A;  1Y97 A;  1C9B B;  3SUP A;  4DSK A;  1HJR A;  1KVB A;  3OY9 A;  4EZ9 A;  4B9T A;  2EX3 A;  4I9Q A;  3DLE A;  1DTQ A;  3LPU A;  2IC3 A;  4BDP A;  2ZD1 A;  4FVM A;  1FKP A;  4QCL A;  4IG0 A;  3QEI A;  2WOM A;  1C0U A;  2ZQB A;  4EJZ A;  3OS2 A;  1CLQ A;  1GOA A;  4ROD B;  1TL3 A;  3MED A;  3NGY A;  1E42 A;  3LWM A;  1K6Y A;  3TR8 A;  1J9A A;  1JLQ A;  4KHU A;  5HLF A;  1LAV A;  1UAX A;  3SUN A;  1RT4 A;  5C42 A;  3SQ1 A;  1T8E A;  3M8S A;  4O55 A;  1KVC A;  4FJL A;  3G10 A;  4N47 A;  4ELU A;  4OGC A;  4AIL C;  3KTU A;  5D3G A;  3TI0 A;  1PZD A;  4Y1C A;  2XY8 A;  3NH0 A;  1TBA B;  1C1A A;  4CJS A;  4YFU A;  3V9X A;  3K58 A;  1QQC A;  4Q5V A;  2VG6 A;  3UIQ A;  1MP9 A;  2JLE A;  4K8Z A;  4CJ4 A;  4DTO A;  1QN3 A;  1QN9 A;  1MU2 A;  4IG3 A;  3OYJ A;  1Q9Y A;  1NKE A;  1LWW A;  1B9D A;  4O0J A;  4N41 A;  3HP9 A;  1GOB A;  3DOL A;  4CF8 A;  5CYQ A;  3VQQ A;  2FBX A;  1YQM A;  2MJ7 A;  2NOB A;  2B6A A;  4I7F A;  1T03 A;  2GUI A;  3RWU A;  3NGI A;  4CEE A;  4KFB A;  4OJR A;  5C24 A;  1IKV A;  2HNY A;  1D3U A;  3AO5 A;  3OYI A;  3ASM A;  2Z1G A;  3VQA A;  3BDP A;  1D9D A;  3PY8 A;  1B92 A;  1RNH A;  2XRI A;  4OVL A;  1RBR A;  1C0M A;  3PUF A;  3F9K A;  4W5T A;  4FLV A;  1RTH A;  1TV6 A;  2YHB A;  5HBM A;  4FLY A;  4MQ3 A;  3OS0 A;  2ZE2 A;  3EYZ A;  4KHQ A;  1EX4 A;  2RKI A;  1S1X A;  4OKE A;  3HT3 A;  2B5J A;  2G8V A;  1M3Q A;  1B9F A;  3KLH A;  3LZJ A;  1N6Q A;  1D9F A;  4DG1 A;  3A2F A;  4CJP A;  4CHP A;  1RTJ A;  1RIL A;  1QSL A;  4FJI A;  1U4B A;  4AHR A;  1J53 A;  5T7B A;  4CFB A;  4DQR A;  1UWB A;  3HPH A;  3LP1 A;  1QNA A;  3RTV A;  1ASV A;  2VG7 A;  3KKS A;  4DTR A;  2G8U A;  1IO2 A;  3NDK A;  1FKO A;  1ASW A;  4KTW A;  4KO0 A;  4JRQ A;  4M3R A;  4Z4H A;  3L3U A;  3NF7 A;  3DRR A;  2HHS A;  3AVJ A;  4M3Y A;  4KRE A;  4AHT A;  4DWI A;  1JXB A;  4LSL A;  4CEO A;  3OYB A;  1L3T A;  3LDS A;  4M3X A;  1BCM A;  1HYV A;  3LWL A;  2QK9 A;  1ASU A;  2Z1J A;  5FRO A;  1WLJ A;  3O3H A;  1TKX A;  3NE6 A;  1U45 A;  1IKY A;  2HND A;  3V1Q A;  1C1C A;  4JLH A;  3RMD A;  4RW8 A;  4RW9 A;  3FFI A;  3K2P A;  1QTP A;  3ZSQ A;  3VQC A;  1SKW A;  4NYN A;  3E01 A;  2Z1H A;  3M8P A;  2P1J A;  2I5W A;  1YTF A;  2NOF A;  4CF2 A;  1WSJ A;  2YNG A;  3U6F A;  1QN8 A;  3RPJ A;  3HJF A;  2X78 A;  1ITG A;  3F0Z A;  3KLI A;  4RW6 A;  2IGI A;  1S9E A;  2D5R A;  3NF8 A;  4CED A;  5KGW A;  3KTQ A;  1JXE A;  4RW7 A;  3VQE A;  5JS2 A;  4ZTF A;  4O4G A;  4CCH A;  3B6O A;  3IG1 A;  1TVR A;  4ZHR A;  3I8D A;  1ZYQ A;  4CEA A;  4I8O A;  2FGT A;  2IDO A;  4O44 A;  1X9W A;  3QEP A;  3HYF A;  4DSL A;  4BWM A;  1W0H A;  3V1R A;  3EY1 A;  2W42 A;  3SYZ A;  5J2Q A;  1NK8 A;  2X6S A;  2HVI A;  4LSN A;  3C6U A;  4Z4F A;  2HHW A;  3HXM A;  3OYN A;  3T1A A;  1YQR A;  1RT5 A;  3OCI A;  1QN7 A;  2NUB A;  1RM1 A;  1JFI C;  3LPT A;  1S6P A;  4CJQ A;  4E7K A;  5IYB P;  5SWM A;  1WSI A;  4CK3 A;  1TK5 A;  1YT3 A;  3I0S A;  3KK3 A;  2G8F A;  1LW0 A;  2Z1I A;  5DMR A;  1ZBH A;  3JYT A;  1VSH A;  1EXQ A;  1WSG A;  4CFD A;  5HRO A;  3DLH A;  4CHQ A;  1NOY A;  1KY7 A;  1BI4 B;  1CXQ A;  3O3G A;  1RTD A;  3O4N A;  5KI6 A;  1R0A A;  4E19 A;  3QER A;  1NK7 A;  1Z25 A;  1ZBF A;  4HTU A;  1B9K A;  4OKK A;  2BE2 A;  2E6M A;  4DTP A;  3AVG A;  1ZBI A;  4CEZ A;  3HST B;  2YNI A;  4FYD A;  2I5J A;  3HS8 A;  1JLG A;  3ISN C;  1LV5 A;  5IYD P;  1UT7 A;  3DLK A;  1RBU A;  3QNN A;  1VSI A;  3TAN A;  1LWV A;  2G30 A;  1QTM A;  1WSE A;  5J2M A;  2QKB A;  2O4G A;  1S1W A;  4CGI A;  2G8K A;  2BDP A;  4KB0 A;  4KHW A;  1SL0 A;  2QKK A;  4OGE A;  1BQM A;  3F73 A;  4WE1 A;  4CHO A;  2KTQ A;  2IAJ A;  4TPS A;  3SNS A;  2F8T A;  2D0A A;  2KFZ A;  4KRF A;  4CJE A;  4CJV A;  1DTT A;  3AA4 A;  2HZM A;  2RN2 A;  3K5O A;  4CJ5 A;  3OYD A;  3AO1 A;  4CJW A;  4DQS A;  2F8S A;  1TAU A;  4LH5 A;  4FW2 A;  1L5U A;  1KCF A;  4CJL A;  4KHY A;  2HHT A;  1XHZ A;  4HCC A;  3SPZ A;  1Q9X A;  5DK5 A;  1S9G A;  2JGU A;  3LP2 A;  4EJY A;  4FLZ A;  4GW6 A;  1QN4 A;  3V6D A;  3EZ5 A;  4B9U A;  3O3F A;  2IV8 A;  4CIF A;  1S1U A;  3OS1 A;  4DFM A;  4J2E A;  3IH7 A;  4CHN A;  4L8R B;  4FM0 A;  3LZI A;  4DSE A;  4W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...