2D0BA

Crystal structure of bst-rnase hiii in complex with mg2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0bA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0bA02
3NF6A 3AO5A 4KO0A 4CFCA 3M8SA 2VWJA 1WNSA 4N56A 1X9WA 4FYDA 4DTNA 1VSHA 1NK0A 3LPTA 3OYFA 1VTLE 4FJMA 4AHRA 4O0IA 5HP1A 1T05A 1LV5A 3V4IA 3CFOA 3ZSRA 3NHGA 1QTMA 3HSTB 1L3UA 2G8VA 3T1AA 2D0CA 4I2QA 3VQEA 3OYMA 1TAUA 4WE1A 3NE6A 4W5NA 1NKBA 4DQPA 4W5RA 1VSKA 5HRSA 2XO7A 3S3OA 1W9HA 4CEBA 4E0DA 1NH2A 4C8NA 1U48A 4KHUA 4E19A 4ZHRA 4OPJA 4DQSA 4HUEA 2IC3A 1IG9A 3KLFA 2Y1JA 3ZSXA 4FJNA 3P5JA 2WONA 1YVUA 1TV6A 3AA5X 3DLEA 4HTUA 2Z1JA 1C6VA 1J54A 1JXEA 3TAEA 1IKYA 2ATQA 4E1MA 4CF2A 4DSFA 3QEXA 4F3OA 1QN3A 2G8WA 1GOAA 5CY4A 4FJ7A 4PWDA 5KGXA 4DSKA 2Z1HA 4OLBA 3WNEA 4E7KA 3SV4A 2OPRA 3RTVA 3OYNA 3KK1A 4KKOA 4KTQA 3T19A 2QK9A 5EU7A 1C1CA 2KTQA 4IG3A 1EXQA 4CF0A 4Q5VA 1NK5A 4H4MA 4CGIA 1G15A 4BE1A 4CHZA 1NJYA 4CHQA 1HRHA 4ZTJA 3HVRA 1QNCA 3AVGA 1TKTA 2RPIA 2PZSA 2KW4A 4RW6A 3DLHA 4CCHA 4J2BA 3ZSZA 1J5OA 1JXBA 3K5OA 4HVJA 1KYUA 2DFEA 3OYIA 1VSEA 5I42A 3VQQA 3QEPA 4FJGA 2A1SA 1RCHA 1SUQA 2E6LA 3U6FA 3OYGA 3ISNC 4H8KA 4DU1A 3TANA 1TK5A 4M41A 3D0PA 1LAWA 2O4GA 3AVBA 3V1QA 1WAJA 3MEGA 3K5LA 3V81A 3HJFA 4E7JA 5T7BA 3RR8A 4FJHA 4I7FA 5FRNA 1YTFA 3AVHA 3WNGA 4RG8A 1CDWA 3PO4A 1LWEA 4DQRA 4CHPA 4Z4EA 4CGDA 1R4XA 5KGWA 2W42A 4CF8A 3NFAA 4M42A 4DLGA 2G8FA 3DOLA 4FZXC 3RMCA 3HS9A 4B0AA 1JLGA 4CJUA 4DFJA 1NK6A 3TARA 2HHQA 4AHVA 1SKRA 4B9VA 3G10A 4CHYA 1IO2A 2D0BA 2YHAA 3AVJA 3OS1A 4FZYA 5K14A 4IDKA 4CK2A 1D9FA 1X1PA 4BWMA 1UOCA 4GW6A 4E89A 5FDLA 2XRIA 1KVCA 1QQCA 3MXMA 1SL2A 4C8OA 3LWMA 4DTSA 2E4LA 1C1BA 1CZBA 4W5OA 2KZMA 1QN8A 5KRTA 4FLWA 3KK3A 3M8QA 4FZZA 4CJEA 4DU4A 2HHSA 4ICLA 3L3VA 4OJRA 4CJLA 4F2SA 1BCOA 4DFPA 1EKEA 3V9ZA 4I9QA 4Z4GA 4FXDA 2O4IA 1B9KA 1EETA 4CE9A 1VTOA 1D5AA 3CFRA 2KFZA 3O3GA 1RBUA 4BE2A 3SQ4A 4OKKA 4G1QA 3I0SA 1QS4A 4FLVA 4CJKA 3KK2A 3MXJA 3NGYA 1WLJA 4IBNA 4W5QA 2G8KA 4K8ZA 1FXXA 5CZ1A 3RR7A 4HHTA 4B8AB 1VSJA 1SKSA 1TGHA 2EHGA 2IV8A 1HMVA 1B92A 1S1TA 1R0AA 3QIPA 1UWBA 4ROCB 4RW4A 1KFSA 4EZ6A 4DG1A 3K59A 4LH5A 5HRRA 2B6AA 4Z4CA 3NF9A 4CIFA 4JRQA 5J2PA 2BGGA 5JS2A 4B8CA 1RT5A 1KLMA 3QETA 2QXFA 2ZD1A 3KJVA 3T3FA 3HPHA 3AVFA 4CJSA 4B9UA 4B3OA 1X9MA 3C6UA 3VQCA 3SV3A 2GV9A 3L3UA 4M3ZA 1HYZA 4IG0A 4NCBA 5C42A 3WNFA 4EP5A 4CFAA 4KB0A 4WZSD 1SKWA 1EP4A 4OKJA 3QEIA 1MU2A 4ID1A 1K6YA 4CEOA 1NK9A 4M3TA 3F9KA 4KRFA 2VG5A 1NJXA 4KTZA 1MP9A 2IOCA 2YNIA 3P1GA 5E41A 1HQUA 3LWLA 3NF8A 1KY7A 1S1WA 1VK0A 4IFVA 1RM1A 4YNQA 3OYBA 3F73A 4KHQA 3OJUA 1D3UA 2Z1GA 3AO1A 1IKWA 3K5MA 2Y1IA 3MECA 1NVPA 4BDYA 4K8XA 3ZSWA 4BDZA 3THVA 4RW7A 1KSPA 4CEQA 1FKOA 1WSIA 1YTBA 1O1WA 2F8TA 1BHLA 1NK4A 3RMAA 1N6QA 2ITGA 2FBVA 4OKEA 2R7YA 1S5JA 3HXMA 2OYQA 4ROEB 3LAMA 3M8RA 3L8BA 3E01A 1BIZA 3IG1A 3V9SA 4BE0A 3QO9A 2FBXA 1RT1A 3B6OA 2G8IA 4FLUA 4FJLA 3DRSA 1BI4A 1DLOA 4CF1A 5SWMA 2PYJA 3L2VA 3LP3A 2Z1IA 3AO4A 3VA3A 4OLAA 4E3SA 1N5YA 1TGOA 3P83D 4CJ5A 2XY7A 3TAQA 5IYDP 4FJJA 1WAFA 1RT6A 4NYNA 1DTQA 1Z25A 2HMIA 4H4OA 3H1ZA 3EZ5A 1ZBUA 2KZZA 1Y97A 3QERA 4JS5A 1NJZA 1TL1A 2XY8A 4OGEA 1KYFA 1YT3A 3DLBA 1QN9A 2HB5A 4B9TA 3V1OA 1KLNA 2P5OA 3L2QA 1REVA 4KHYA 2IGIA 5KRSA 4FCYA 4N5SA 3RMBA 1NJWA 2JLEA 4N41A 1TKZA 5FROA 2YKNA 4FK2A 4PQUA 4KTWA 2FBTA 1CXUA 3OS0A 3QEWA 4DSIA 1X9SA 3RWUA 4DLEA 2AJQA 3NGIA 4CJ4A 4B9MA 2OPQA 1RT7A 1ZBFA 4FK4A 4JLHA 4O44A 5C25A 2E6MA 3RMDA 4CF9A 1VSLA 2GBZA 2X6NA 5I3UA 1DTTA 4CEFA 1CLQA 1U47A 4Z4IA 4KI6A 4B08A 4FM0A 3QEVA 1I39A 1HNVA 3TAMA 1RBVA 3AA3A 3D45A 3KIOA 3QLHA 3AVMA 2B4JA 3SQ2A 3MAQA 4HCBA 4LD0A 3NH0A 3HP6A 1QSYA 4F3TA 3S3NA 5JS1A 3VQ6A 1RT2A 4ELUA 4Y1CA 2KFNA 3ALYA 4OGCA 1NKCA 3NDKA 1RT3A 3ZCMA 1U49A 1HYSA 4RODB 1GOBA 1KYDA 2DTUA 4HUGA 4FLXA 1RBSA 1TBPA 1JFIC 3C95A 3LP0A 1WSHA 1TKDA 1TAQA 1ZBIA 1KTQA 1RTJA 1FKPA 1Z26A 3AVCA 4DTUA 4DSJA 3HK2A 3OYAA 1LWFA 3G0ZA 1A5VA 3CQ8A 1HQEA 1QSSA 3SYZA 3U3YA 3HL8A 4DTXA 1XHXA 3IRXA 1Q9YA 2VG7A 4GMJB 1KRPA 2YNFA 4J2EA 1QN6A 3LALA 1T03A 4O5BA 3PY8A 1S6PA 3V9XA 1WSGA 4FJKA 5J2MA 5IYBP 4ZTFA 3B6PA 4EZ9A 4PA1A 1VOKA 1XC9A 1QTPA 2Z8UA 4I9LA 1IH7A 3NH1A 3JSMA 3PV8A 1Q9XA 3LDSA 1QHTA 3RRHA 4DQQA 3S3MA 4FJIA 3K2PA 4TSXA 4CEAA 3HT3A 1RDDA 1NK7A 1TL3A 2JGUA 1VRTA 3ZSVA 4L8RB 3OYLA 1BQNA 5SZTA 5IYCP 4IKFA 2IS3A 4DQIA 3AO3A 1KVAA 1JLQA 2HHUA 3EY1A 4B9LA 4FJXA 1UA1A 2MJ7A 1BIUA 1C1AA 3HM9A 2RN2A 4I2PA 3SUNA 4KPYA 4DTOA 3A2FA 3HVTA 3L2WA 1BISA 2WOMA 3DOKA 5CYQA 4FLYA 2B5JA 3BGRA 4KFBA 4DMNA 4CJRA 3SI6A 3KD5E 4FK0A 3HP9A 5FRMA 3HO1A 4MQ3A 5HRNA 1JLBA 4FM1A 3DLGA 4DS4A 3V9WA 3AO2A 1JLAA 3KTQA 4Z4FA 3NH2A 1HNIA 3EYZA 3DRRA 3I0RA 3TAGA 3PX0A 2HNZA 3ZT2A 4FJ5A 1ITGA 4C8KA 4M3WA 2HHXA 3KLHA 1VSDA 1HJRA 1NOYA 4FVMA 2PY5A 1FK9A 1TKXA 1C0TA 1QN5A 1VSIA 4BDPA 3OCIA 4B9SA 3EIKA 1I3AA 1RT4A 1QTSA 4F4KA 4DF4A 4FW2A 3OYKA 3V1RA 2YV0X 3U3GA 3AVIA 1C0MA 3PX4A 5CYMA 3QESA 5DMRA 3CM6A 1BCMA 3AA2A 1LW2A 3OYCA 1TK8A 3MXIA 1JLEA 2F96A 4CHNA 1F21A 1C9BB 3SJJA 1KVBA 1D9DA 4KAZA 2HNYA 3WNHA 1B9DA 2VWKA 2G8UA 3ASMA 4CJTA 2F8SA 1JLFA 1A5WA 4C8MA 3VQ9A 3SUOA 1L3SA 1YTUA 3CM5A 2HHTA 4LSNA 1RTIA 4LH4A 3MEDA 5J1EA 4FLZA 1L5UA 1HYVA 2DFFA 1A5XA 4CERA 4KHSA 1PZDA 1L3VA 4DTPA 3KKSA 3K5NA 4C8LA 3SPZA 1XWLA 4CJQA 4KHNA 1ZYQA 4E1NA 4HUFA 4CGHA 3S9HA 4CEDA 5KTQA 4QCLA 3KD1E 1UAXA 3O3FA 1YTAA 1RDAA 1HPZA 2OPPA 4DF8A 2P5GA 2YHBA 4CJPA 1S1VA 3VQDA 2DY4A 3VQ5A 1ZBLA 3V6DA 3AVAA 2G30A 2ETJA 1JLCA 1ASVA 3ZSQA 3TI0A 4DFKA 3KKRA 3DI6A 4FM2A 3ITHA 4RW9A 1J9AA 1PCZA 4ELVA 2FC0A 4MFBA 5DK5A 1WSEA 3OC3C 1NKEA 3VA0A 3I8DA 4DWIA 4FJ9A 2IAJA 4ID5A 4EP4A 2BDPA 3FFIA 5KI6A 4CJ3A 4CFDA 3K57A 2D5RA 2X74A 3ULDA 1IKXA 5J2NA 4QAGA 2RF2A 4N76A 4O0JA 1C0UA 3OYEA 4CEEA 4UQGA 4OPKA 1EX4A 3DYAA 4M3RA 1KFDA 3MEEA 3SZ2A 4KB1A 3LPUA 2HVIA 4JS4A 3C94A 4AHCA 3SUPA 1RILA 1RDBA 2DFHA 3ZT4A 3TR8A 1S6QA 1S1XA 1WSFA 2EX3A 4E7IA 1QNEA 1VOLB 4BACA 3DLKA 4FW1A 4CJWA 3SCXA 1D8YA 4AHTA 3LAKA 2XY6A 3SQ0A 2HNDA 1U45A 5D3GA 3AA4A 3KLGA 3TWHA 2YNGA 4AILC 1SL0A 1W80A 4O55A 3VQPA 2P1JA 2HVHA 3QINA 4KHWA 2XHBA 1TBAB 1BGXT 3O4QA 2BANA 2PYLA 1ASUA 3SNNA 2D0AA 4CEZA 3BDPA 2OZMA 1WN7A 3TAFA 1L3TA 1QNAA 4Z0UA 3NAEA 4Z4HA 3NCIA 1KY6A 4CECA 1CXQA 1TVRA 4CGGA 5HRPA 3DM2A 4HCCA 1GOCA 4R5PA 3LP1A 4RW8A 4J2AA 1XI1A 2ZE2A 4CJFA 4YFUA 4F8RA 3QIOA 1LWCA 3SPYA 3SUQA 4DSEA 4OVLA 1AISA 3KLEA 1E42A 4JRPA 3VQ7A 2FBYA 3PUFA 3NGZA 4CGFA 2VG6A 2Q3SA 3LANA 3OVNA 1T7PA 1QNBA 2NUBA 1QSLA 4KI4A 4AH9A 4CESA 3VQ4A 3HS8A 3UIQA 1ZBHA 4M3XA 1JKHA 1LW0A 2VJ0A 1RNHA 4CIGA 1WSJA 1VSMA 2KQ2A 1IKVA 1CZ9A 3AVKA 3TAPA 1BL3A 3DLRA 5HLFA 2I5JA 1RTDA 4Q0BA 3L2RA 1LAVA 4DS5A 3ZSOA 4DTRA 4LSLA 3LZIA 3TABA 4B9NA 1U04A 5C24A 3CYMA 4KV8A 3HPOA 2OA8A 1RBTA 3CG7A 1QN4A 3AVNA 4CHOA 3DMJA 2YKMA 3PO5A 4E7HA 1KCFA 1VRUA 3VQAA 3LZJA 3DRPA 2X6SA 4AHUA 3OY9A 3L2UA 4E7LA 4DFMA 2XY5A 1U4BA 1BI4B 3O4NA 2RKIA 2HHWA 1RBRA 4CFBA 3OYDA 4FJ8A 2P51A 2OZSA 4M3YA 3RRGA 4AHSA 1JL2A 3IS9A 1J53A 2HW3A 2HHVA 1Q8IA 2BE2A 2ZQBA 1S9GA 3PX6A 1SL1A 4CGJA 4PUOA 4NYFA 3NF7A 2OPSA 3AV9A 1BQMA 2QKKA 4IFYA 1NGMA 1QN7A 1RTHA 4DTJA 1XHZA 3O3HA 4ELTA 1S1UA 3K58A 4DTMA 1QE1A 3NBPA 4QOZB 3QNNA 5HROA 3H08A 4GVMA 1B9FA 4O4GA 3V9UA 3KLIA 3OYHA 1JL1A 5J2QA 4NCAA 2QKBA 3AVLA 4M3UA 3C6TA 2G8HA 1SV5A 3JYTA 5HBMA 4KREA 4J2DA 2A1RA 4BWJA 1S9EA 3ZT1A 4PY5A 1RDCA 4CK3A 3HYFA 4LY7A 4XIUA 3VQ8A 1UA0A 2GUIA 3OJSA 3ZT0A 2IV9A 1TK0A 3VN5A 4FLTA 4F2RA 4CIEA 1W0HA 2IDOA 3IAYA 3OS2A 2X78A 4DU3A 3LP2A 3M8PA 4Y1DA 3OYJA 3SQ1A 3ZSYA 1NOZA 2YNHA 4CK1A 4W5TA 4M45A 4CJVA 1NK8A 1T8EA 1ASWA 3ZT3A 3CFPA 1VSFA 3VQBA 5CZ2A 4NCGA 2LSNA 4DSLA 4N47A 3HPGA 3QNOA
chains in the Genus database with same CATH superfamily
3NF6A 3AO5A 4CFCA 2D4WA 4FYDA 1VSHA 3LPTA 3OYFA 1LV5A 4DR5K 5CHIA 3UE5A 2D0CA 2E1ZA 3VQEA 3OYMA 4WE1A 3NE6A 4BR7A 1WBBA 3QFPA 4PKHA 4ZHRA 4DQSA 1TUUA 5GIPA 2IC3A 1E4FT 4B1XB 3CERA 1IBLK 4CZEA 1UL7A 1R59O 3DLEA 3CMAN 1C6VA 3P31A 5M1NA 1RFQA 2G8WA 3E9OA 4DSKA 1VQ6N 2QK9A 3VF2A 5EU7A 1C1CA 4KHPK 4BY9C 4B1WB 3J8AA 1NK5A 4WFNL 4H4MA 2O8CB 1HRHA 3GE1A 1VAZA 3BF1A 4CCHA 3J7ZO 3VQQA 5LJVA 3QEPA 1SUQA 2HHHK 3CCSN 2HL9A 3WEEB 1VQ4N 5IT9O 3RR8A 4FJHA 1JDYA 1YTFA 3AVHA 1NG9A 1X3MA 4Z4EA 4CGDA 3L4QA 1R4XA 4CF8A 3NFAA 4M42A 4FZXC 3HS9A 4B0AA 4DFJA 5AQNA 3TARA 2HHQA 3VTHA 2Q36A 5ADXA 1SKRA 3G10A 4BRKA 3HTVA 2YHAA 3AVJA 1Z05A 5K14A 4HWIA 4GW6A 4E89A 4IWVA 5AZJB 4JHDA 4C8OA 1CZBA 4W5OA 1QN8A 4FLWA 4BG8A 2I7PA 4DU4A 3D6RA 2CH5A 1HJOA 4F2SA 1EKEA 3L6QA 4BC3A 3V9ZA 4FXDA 4M63C 5AR0A 4IO9L 3HBTA 1QS4A 4CJKA 2HHUA 4BRHA 5CZ1A 4GV3A 3RR7A 3A5LC 1VSJA 3ATUA 4EAJA 1NBWA 1HMVA 1S1TA 1P5GX 1B92A 3OW2M 1TYQA 4EZ6A 4DG1A 1VQON 3J7YP 2KLAA 2B6AA 3SAGA 4CIFA 1S3XA 2BGGA 3QETA 2QXFA 1UT7A 1PVSA 3C6UA 2LAEA 3SV3A 3CCQN 1HYZA 4IG0A 5C42A 4WZSD 4OKJA 1MU2A 4ID1A 1K6YA 1NJXA 4KTZA 3P1GA 2IOCA 1CZAN 1X3NA 4YNQA 3F73A 2QW9A 2Z1GA 4JKAA 4BC4A 3D7EO 3C0BA 4O8KA 1WSIA 2JWLA 2F8TA 2XHIA 1BHLA 3D7QA 5I9EB 1NK4A 1N6QA 4OKEA 3M8RA 3PMGA 1VHXA 3WXKA 5CE3A 4BE0A 1RT1A 1BI4A 5LMNK 2W6LA 5KPRA 3AO4A 3VA3A 4MRQA 2XY7A 3CCUN 5IYDP 1Z6RA 1G99A 2ZWHA 1IBKK 3P39A 1DTQA 3H1ZA 4B3SK 1XUPO 4JS5A 4CFFA 3EEQA 3H3NO 4CW7B 1KYFA 1ZC6A 1KD1O 4B9TA 2YI1A 1KLNA 1N34K 3LDLA 1EO1A 1KC8O 4N5SA 2Q0UA 1NJWA 2JLEA 3CMEN 1TKZA 5FROA 1QQMA 4N41A 4KTWA 3E1YA 3QEWA 2J4RA 3CQXA 1X9SA 2AJQA 1RT7A 2ITMA 5C25A 3RMDA 2GUPA 3I33A 5MLCQ 1Q7YO 3O8MA 4ISEA 4FWKA 1DTTA 1IJJA 4IL8A 4Z4IA 4KI6A 1I39A 1HNVA 3TAMA 3CHWA 3KIOA 5AQKA 3SQ2A 3PLAA 1FW6A 4EAGA 3S3NA 3C7NA 4LFAK 5JS1A 1RT2A 4PL7A 4Y1CA 3LDPA 1RT3A 3SNSA 4RODB 4HUGA 3VGMA 4FLXA 1TBPA 1TKDA 1QZ5A 1ESVA 2JHJA 1KTQA 1RTJA 1TAQA 1ZBIA 1VQ5N 3OSMA 3CQ8A 5AZIA 5BPNA 1QSSA 3U3YA 2V52B 2HSTA 3W0LA 1Q9YA 2VG7A 4J2EA 1QN6A 4E1JA 1OKJA 1BU6O 3PY8A 3B6PA 4EZ9A 4PA1A 1VOKA 2NRWA 3NH1A 2QLVA 4L3QA 5AQYA 4NXMK 4TSXA 4CD1A 3VEWA 1NK7A 1TL3A 2JGUA 3GOIA 1VRTA 3H6EA 5SZTA 4OPAA 5IYCP 1KVAA 1XQSC 3EY1A 2MJ7A 2RN2A 4I2PA 2OCEA 4JAXA 3HVTA 3CJAA 1BISA 2NRRA 1QZ6A 4DMNA 4NXNK 3HP9A 4FM1A 2Q31A 4DS4A 2ASMA 2DKAA 1T6AA 3TDHA 1M3HA 1KXPA 2F4VK 3J80O 1JLAA 1MWKA 4Z4FA 3UKUA 3ZT2A 3T1YK 1ITGA 4M3WA 2UUAK 1TKXA 1QN5A 4YOYA 1I3AA 3IUCA 1IBMK 2YV0X 4H5WA 3SMSA 3QESA 3CM6A 3AA2A 3LM2A 3OYCA 3NA5A 3SJJA 1KVBA 2E88A 3S41A 4CJTA 1JLFA 3DPUA 2HHTA 3CM5A 4LSNA 3M6GA 1NGEA 4JEPA 4A2AA 4KHSA 4CERA 1A5XA 2GX9A 4MDAA 2QWMA 3K5NA 3KTUA 3SPZA 1OH8A 1NMDA 1ZYQA 1XMQK 3S9HA 3VQDA 3I56N 5AQSA 2G30A 1ASVA 4BQLA 1J9AA 3FR0A 4YDUC 3QDKA 3OC3C 3VA0A 5EXWA 1K2YX 4CFDA 3K57A 1U2VA 5J2NA 4QAGA 4N76A 1C0UA 1HR0K 3QFUA 1VQLN 3FZHA 5AQRA 2E8AA 5M1OA 3LPUA 4JS4A 4JHDB 4EIAA 4JD2A 3C94A 4A2BA 3VF6A 3OSEA 5GAEP 1RILA 4DV2K 2W6KA 1S1XA 5AQIA 1WSFA 4U7BA 2EX3A 4CBUA 1QNEA 3GL1A 4BACA 4A59A 1YJNN 4AHTA 1W80A 2AP1A 4KHWA 1TBAB 3O4QA 2BANA 2BUPA 4FWNA 2D0AA 3N4PA 3C6AA 2PFUA 3NAEA 4BRDA 4Z4HA 2IVNA 1TVRA 1SZ2A 4R5PA 5JMVD 3SK3A 2ZE2A 3A8YA 4DSEA 3CJ9A 5BMPA 1AISA 4JRPA 5EY4A 3VQ7A 2VG6A 4IOAL 4FWQA 2FSKA 4HTLA 4AH9A 3EE8A 4JI3K 3CPWM 1ZBHA 5FPEA 2VJ0A 2P9IB 1WSJA 3OGDA 1VSMA 1HLUA 1IKVA 4FWSA 1CZ9A 2A42A 2F7LA 1EBMA 3MX5A 2I5JA 4DS5A 1LWVA 1DIZA 1U04A 4KV8A 2OA8A 2HZSA 3VMFB 2YKMA 2IVOA 4DFMA 4H5TA 3WEEA 1BI4B 1RBRA 3OYDA 3I55N 3OA9A 3CWTA 2Q2RA 3IS9A 2HW3A 1JCEA 3DAWA 3OBWA 1N3AA 4IEIA 4CGJA 4DR4K 4NYFA 3NF7A 1K8AO 2NOFA 2DPNA 4IFYA 2NLXA 1OH6A 1XHZA 3ZX3A 4ELTA 4DTMA 5AQOA 1I94K 4JKGA 3WUHA 3VGLA 3VETA 1T6CA 3VEXA 1BDGA 1SV5A 5HBMA 3CJ1A 3KRMA 1S9EA 3ZT1A 4C7PA 1RDCA 4CK3A 3HYFA 4XIUA 2GUIA 5AN4A 4CIEA 1W0HA 2WUSA 3R6MA 5BRFA 5JMVA 4JN4A 5ADXH 4ISGA 3CFPA 5CZ2A 3QNOA 4KO0A 3ENHA 2VWJA 4N56A 1T6DA 1X9WA 2QWRA 4DTNA 3WXMB 1NK0A 3C7NB 4BRLA 4CZHA 4FJMA 4O0IA 1T05A 3NHGA 1SS6A 1J3MA 1QVGM 4BGAA 1NGJA 1W9HA 1U48A 2FUVA 5GAHP 2QRDA 4XH5A 3FZFA 4DV0K 5JLFA 4LF7K 1TV6A 3LL3A 4JK8A 1LWWA 4DSFA 1QN3A 4EAHD 5CY4A 4FJ7A 1VKLA 5KGXA 4GKJK 3M3ZA 4OLBA 4E7KA 3FGUA 1YAGA 4KKOA 4M7XA 4CF0A 1WJWA 4A57A 1SAZA 2O8DA 4BE1A 1NJYA 1P8ZA 3HVRA 1EWQA 4WQ5A 2PZSA 2RPIA 2E2NA 2O8EA 1NNEA 4RW6A 4WYBA 2D1KA 3K5OA 4HVJA 2DFEA 1VSEA 1N8RO 2NOLA 3T7ZA 2FKFA 3E66A 3DJCA 3OYGA 1S72N 3D0PA 2O4GA 3K5LA 1WAJA 3MEGA 5T7BA 1TUOA 4IDHA 1CDWA 4DQRA 4JNEA 3WT0A 3ENOC 4DLGA 3TSUA 3RMCA 1BA1A 4D7QA 1NK6A 4GV9A 3TPQA 1IO2A 3OS1A 3CWAA 1NWKA 1X1PA 1KVCA 1MDUB 1QQCA 2H3GX 4GNIA 2OTLN 1SL2A 4B1VA 4DTSA 1C1BA 2KZMA 5KL0A 3TSPA 2P5GA 5HL7L 3HOTA 2HHSA 4DFPA 1RDUA 5C2FA 4KH5A 4Z4GA 1EETA 4KBOA 4H03B 4OKKA 3I0SA 4FLVA 3AAPA 1WLJA 3MDQA 4W5QA 1FXXA 4B8AB 1SKSA 2IVPA 2IV8A 4LF5K 3LDNA 2QTDA 5B8HA 3K59A 5HRRA 3NF9A 1RT5A 1KLMA 2CGKA 4WQ4C 3KJVA 3T3FA 4B3OA 3TE5A 3VQCA 3UW2A 3L3UA 1U2VB 4H0OA 3FLCO 5BPLA 1QHAA 1NK9A 3F9KA 3VTIA 5E41A 1D4XA 3NF8A 4A62A 4AQYK 1S1WA 3EE9A 4IFVA 1RM1A 2P9NA 1D3UA 3AO1A 2HMPA 1FN7A 4BDYA 5M1QA 4DKWA 3THVA 2JPIA 1KSPA 1YTBA 2V92A 3RMAA 4QS9A 5AQTA 4BC5A 4QG5A 2V51B 4A5AA 3HXMA 2R7YA 3CVTA 1BIZA 3V9SA 3QBWA 4FLUA 4FJLA 3DRSA 3ZYYX 3G6EN 2BH1A 5C0YA 1GLDG 4OLAA 4E3SA 1TGOA 4CJ5A 3TAQA 3O1BA 3KWIA 1WAFA 4NYNA 3MWPA 1XSZA 1ZBUA 3DXMA 1Y97A 3QERA 4AF1A 1NJZA 5AQVA 5FPDA 3I8BA 2HB5A 1TUYA 1HNXK 4FCYA 3RMBA 4PQUA 1CXUA 4D7RA 4CJ4A 4B9MA 1ZBFA 5AFUH 1WUAA 2FGTA 2GBZA 2X6NA 1CLQA 2FSNA 4FWPA 1RBVA 3QLHA 3MAQA 4LD0A 5BN8A 3BF3A 3VQ6A 4ELUA 2KFNA 3ALYA 4OGCA 1NKCA 3NDKA 1U49A 1HYSA 3MN6A 1KYDA 1NJIO 3CWUA 1WSHA 5AQPA 1Z26A 3BZCA 1YHQN 1A5VA 3A0IX 4A61A 5BRHA 4GMJB 4JKGB 2YNFA 3THWA 3SAFA 2O8FA 1S6PA 4FJKA 4ILGB 1OVYA 5M1PA 1XC9A 4DR7K 1QTPA 2Z8UA 2A3ZA 1Q9XA 1N33K 4DR2K 4CEAA 4IKFA 2IIRA 4B9LA 1BIUA 3HM9A 3A2FA 5CYQA 2QEXN 2B5JA 3BGRA 4KFBA 4OPHA 4CJRA 3HM8A 3HSCA 5HRNA 1JLBA 3V9WA 2OOXA 3T1HK 1NGCA 3NH2A 1YQRA 4DV7K 3I0RA 2A6AA 3TAGA 2HNZA 4FJ5A 2HBMA 4C8KA 4K25A 3VEVA 4CZIA 2F9WA 1KAYA 2HHXA 4FVMA 1FK9A 1O13A 1C0TA 4B9SA 4DR3K 4F4KA 2P9IA 4DF4A 4GKKK 1YF5L 3OYKA 4H0TB 5JVGL 1W7AA 3V1RA 3AVIA 1C0MA 5CYMA 4XH1A 3HZ6A 2V8QA 3EL2A 3ENCA 1W2BM 3MXIA 3CC7N 3R9PA 2F8SA 4C8MA 3SUOA 2O8DB 3EN9A 3MEDA 3VOVA 1VQPN 1HYVA 2DFFA 3K9JA 2O8EB 4C8LA 1XWLA 4CJQA 4KHNA 4C1NI 3U9DA 3MWTA 4E1NA 1IG8A 4CEDA 4DV5K 5EX5A 3CC2N 3KD1E 4LF6K 2ZJQL 1EUVA 2P9LA 4A5BA 2YHBA 3AARA 3QMLA 4DF8A 1S1VA 4JKFA 2FLOA 5DM7L 3MN7A 4LF4K 3K9KA 2NLVA 1ILYA 1NGAA 2ASOA 1MA9B 3AVAA 2ETJA 3EKSA 2NRXA 1YQKA 3F5TA 3KKRA 3CPEA 4JKDA 3THXA 4RW9A 1VQ9N 4NB4A 4B1UB 4MFBA 3G4SN 1C0GA 3H45C 4DWIA 2Y8QA 4FJ9A 4EP4A 2BDPA 5GINA 5KI6A 3T69A 1IKXA 2RF2A 4OPKA 3MEEA 4BRNA 4JI6K 1S6QA 1M1KO 3AGRA 3O5BA 4CJWA 1NM1A 3LAKA 3SQ0A 4H5NA 2W41A 1U45A 5D3GA 4B3MK 3VPZA 4O55A 4JI7K 4H5RA 2BTFA 3CCEN 3TAFA 1L3TA 4CZFA 2W40A 4CECA 3GBTA 4JYAK 1JJ2M 4RW8A 4PKIA 3WQTA 4J2AA 1Q18A 4F8RA 1HKCA 2MZ8A 3SUQA 3KLEA 4JKBA 3I0WA 2FBYA 3MMVA 2VQEK 2Q3SA 3LANA 1QNBA 2NUBA 2FF3B 4ILJA 3CCJN 4M3XA 4Q11A 2KQ2A 4IJNA 4YOTA 3DLRA 3IFRA 4MO5A 2P9NB 5HLFA 1RTDA 3O9RA 4GY2B 5BREA 1LAVA 1GLLO 4B9NA 3D2EB 3CYMA 3H46O 3O4WA 4CHOA 3DMJA 3VQAA 3L2UA 2XY5A 3F2KA 4CFBA 1JCGA 2QWQA 1J53A 2HHVA 2NOIA 2QREA 1YQMA 5AFUA 4PUOA 3PDKA 3IMXA 3DXMB 3BZKA 3O3HA 2CH6A 1S1UA 3ZETB 2G8HA 3BY5A 3MN9A 2A1RA 4BWJA 2ZJRL 4PY5A 3VQ8A 3ZT0A 4WFBL 4FLTA 4FOEA 4G9ZA 3CWSA 3MK6A 1T3VA 4FL9A 3GDQA 5AQQA 2NOEA 4CK1A 5C2DA 1S22A 1T8EA 1ASWA 3ZT3A 4X65K 4HUEA 4FWRA 3ID6A 4N47A 4DSLA 1LWYA 2AA4A 1VTLE 4AHRA 5HP1A 1KAZA 3DXKA 3V4IA 3CFOA 1QTMA 1SQKA 3MN5A 3HSTB 1L3UA 2G8VA 3C04A 4H5VA 3T1AA 4I2QA 2EWSA 2JOIA 1J6ZA 1XC3A 4DQPA 2FSJA 1VSKA 3S3OA 4E0DA 3W3DA 4TPSA 2O8BB 4FJNA 3P5JA 1KFQA 3THWB 1YVUA 1KFIA 3AA5X 1J54A 4FPBA 3TAEA 1IKYA 5AQLA 2O8FB 1GOAA 2NRHA 5BMNA 2Z1HA 2P9KA 1KAXA 3SV4A 4FWLA 1RDWX 1YXQA 3OYNA 3T19A 1GLEG 1BG3A 5AQWA 3M5RA 2KTQA 4IG3A 1EXQA 4C23A 4Q5VA 1ZXOA 1NU0A 2WFBA 4CGIA 2H5AX 4CI6A 3IDHA 4CVNE 1TKTA 3SBTA 3DLHA 1J5OA 1JXBA 3U8XA 5I42A 4FJGA 4DB3A 2A1SA 5AQZA 4KH4A 5DM6L 1TK5A 1PCMX 4M41A 4CD3A 3V1QA 3HJFA 3AVBA 3V81A 4E7JA 3F10A 5FRNA 4BR9A 3WNGA 4RG8A 2VCPA 1JCFA 2KKZA 4CHPA 2NRTA 5KGWA 2G8FA 3DOLA 1V4SA 4CJUA 1JLGA 3OHRA 4GV6A 4AHVA 4X64K 4CHYA 4IDKA 4CK2A 4DHYA 2JWKA 4K42A 2YCHA 1UOCA 4DUYK 4DR6K 2A5XA 3MXMA 5KPTA 5AJ3K 3LWMA 2E4LA 4EFHA 3KK3A 3M8QA 2NOBA 2D0PA 5AQGA 4ICLA 4FSVA 3WQUA 4CJLA 1IV0A 2O4IA 3BKQX 3AAQA 4CE9A 4FVUA 1D5AA 3CFRA 4BE2A 3SQ4A 4NCGA 1YJ9N 2RE2A 2P9LB 4IBNA 2GTDA 4HHTA 1QQNA 2EHGA 4GVEA 1R0AA 3QIPA 4Z94A 4I6MB 4ROCB 2E2QA 3THXB 4LH5A 2QRCA 4IEEA 5J2PA 3IKMA 4B8CA 3OH9A 4LFCK 4H0YB 3AVFA 2D0OA 1UT4A 2GV9A 1T44A 4BR4A 1XMOK 3PSFA 4NCBA 3HRGA 2UXDK 4CFAA 5JVHL 4M3TA 4CEOA 4DV1K 3QICA 3LWLA 1KY7A 3OYBA 3CCRN 3O9UA 3L0QA 1Q9UA 3K5MA 2HBJA 2Y1IA 4K8XA 4IOXA 3THYB 4RW7A 3D4VA 4CEQA 1FKOA 1HNZK 1O1WA 3OLPA 1NGDA 2NVMA 2OYQA 4ROEB 4CZJA 3LDOA 3E01A 3IG1A 3EO3A 3QO9A 2FBXA 1VQNN 3LP3A 1N5YA 3K0SA 4FJJA 4DCHA 1Z25A 5CR4A 4H4OA 3EZ5A 2KZZA 1TL1A 1VQMN 2XY8A 4OGEA 1YT3A 2Q0RA 2HOEA 2P5OA 3V1OA 4FO0A 4JKCA 5KRSA 4QS8A 4B9QA 3NMUA 2YKNA 4FK2A 2UXBK 2FBTA 1EWRA 4RTFD 3OS0A 3RWUA 4DLEA 2QWLA 1M3QA 3NGIA 2Y8LA 1QQOA 4JLHA 4O44A 5AQUA 4JKHA 4NLBA 1HU0A 1VSLA 3AGKA 4W5NA 3D45A 4HCBA 1BWFO 3NH0A 4DR1K 3HP6A 5BR8K 3M1FA 3ZCMA 4LFBK 2GELA 3ENOA 4BRQA 4IJAA 1JFIC 3A5OC 3C95A 4CBWA 3OH6A 3HK2A 4DTUA 4DSJA 3MCPA 1LWFA 3G0ZA 4HJHA 5BRDA 1N36K 4DQ8A 3VERA 1YQLA 1J5EK 3KHYA 3BUZB 1XHXA 1U6ZA 3IRXA 3LALA 5AQXA 1GLFO 3O9TA 2DKCA 3V9XA 4AM7A 1P5DX 5J2MA 3O6WA 5IYBP 4ZTFA 5FPNA 2ZJPL 5E84A 4I9LA 1V5SA 3JSMA 3LDSA 1QHTA 3ZX0A 3RRHA 3S3MA 4YOUA 1YJWN 2P9PA 4BRCA 3ULEA 3PIOL 1BQNA 2QR1A 2IS3A 3AO3A 1JLQA 3LM9A 4BR0A 1UA1A 2YHYA 1NGHA 3VEZA 2ZFDB 2JHNA 2WBNA 5HOOA 3L2WA 3DOKA 4FLYA 3DXKB 3KD5E 4FK0A 3TU5A 2NOZA 3CJ7A 1DGKN 3VF4A 3AO2A 2E1YA 3H1QA 3DRRA 3SLCA 3HOSA 3PX0A 3CCVN 4YORA 1ATNA 4JI1K 3SMPA 3KLHA 3VESA 3VENA 1HJRA 1NOYA 2PY5A 5ELZA 3OCIA 1RT4A 1QTSA 4H0PA 1GLCG 1N32K 3U3GA 3PX4A 2P9KB 4BQZA 1C4GA 1LW2A 5EVZA 3N4QA 1TK8A 2F96A 4CHNA 1F21A 5EOYA 3CF5L 1D9DA 3D2EA 1HKBA 3WNHA 4JI0K 2VWKA 4I8OA 1A5WA 3SBGA 2VGNA 1YTUA 4BRPA 4LH4A 1L5UA 5J1EA 3U4LA 1K35A 2P9UA 3SJHA 4DTPA 3KKSA 1YI2N 2UUCK 4HUFA 3O3FA 1RDAA 1DEJA 2UXCK 4WX8A 2NZTA 4DV3K 2DY4A 5LJWA 1ZBLA 3CCMN 1JLCA 3NVKA 3TI0A 4DFKA 3DI6A 4FM2A 5KQDA 3ITHA 3ZETA 1MWMA 4ELVA 2FC0A 2E2OA 1WSEA 2IAJA 4ID5A 3FFIA 2A41A 1XNRK 2D5RA 2X74A 3ULDA 2I7NA 3O80A 1EX4A 4M3RA 3PSIA 3CVSA 1KFDA 4KB1A 2V7ZA 4U67L 5M1FA 4PHTX 4K41A 3F0ZA 2DFHA 2VGMA 1HKGA 2QWNA 3TR8A 3FZKA 4BGBA 1K8KA 3VGKA 1VOLB 2YJEA 2HNDA 3DWLA 3KLGA 5AQFA 1NGFA 2P1JA 3QINA 3FE1A 2XHBA 4XH4A 1ASUA 3SNNA 4CEZA 3R8EA 4Z0UA 4MLHA 3NCIA 1CXQA 2O8BA 4CGGA 3DM2A 2HF4A 1GOCA 4HCCA 3LP1A 3GG4A 4EAKA 2OANA 3EKUA 4YFUA 3QIOA 1LWCA 5JLHA 3CW7A 2P9SA 4MLEA 4JI4K 2NNWA 3PUFA 3NGZA 4CGFA 3ATVA 2I5WA 3UKRA 4EALA 4CESA 3RVCA 1N3CA 1LW0A 1RNHA 4CIGA 3AVKA 1KQSM 1BL3A 1E3MA 1Q82O 2RHKA 4Q0BA 1X9JA 3SAHA 4DTRA 4K0KK 4LSLA 3LZIA 3C65A 3O9SA 1Q86O 3BEXA 1K9MO 4JKEA 4BRAA 3PO5A 4B1ZA 4E7HA 1BO5O 3DRPA 4AHUA 4E7LA 1U4BA 3KWGA 4NO7A 2UUBK 3O4NA 4EAIA 2P51A 3RRGA 4AHSA 1JL2A 3OTOK 1Q8IA 2ZQBA 1VQ7N 1S9GA 3ULXA 4YOVA 1SL1A 2HL8A 3AV9A 1N39A 3CJBA 1NGMA 1QN7A 1RTHA 4DTJA 1FJGK 2UYTA 4QOZB 5HROA 3H08A 1GLAG 1B9FA 1BUPA 4GVMA 3KLIA 3V9UA 4JI8K 1E4GT 3OYHA 2Q97A 5BN9A 1XNQK 3AVLA 4O8UA 2PWWA 4KREA 4ISFA 3JYTA 3Q7BA 1OVQA 5HSHA 4BR5A 3P38A 2NRZA 2IV9A 4YOWA 1YVNA 3G25A 3IAYA 3OS2A 2X78A 3P4IA 2OOYA 3M8PA 4Y1DA 3OYJA 3HI0A 3SQ1A 3ZSYA 3EZWA 1NOZA 2YNHA 4C1NK 1NK8A 1VSFA 3VQBA 2LSNA 3HPGA 3M8SA 1QVFM 1KO9A 1WNSA 2VWBA 1MPGA 2V7YA 2QA4N 1ATSA 4WXAA 2WTUA 4I6MA 3ZSRA 1C47A 2Q1NA 3PIPL 3RSMA 4OX9K 1TAUA 4F9OA 1NKBA 4W5RA 5HRSA 2XO7A 4JI2K 4KHUA 4CEBA 1NH2A 4C8NA 4FWOA 4E19A 1P90A 4OPJA 4DUZK 1IG9A 3KLFA 4IO8A 2E2PA 2Y1JA 3ZSXA 4WF9L 2WONA 2FF6A 2VYPA 4HTUA 2Z1JA 1JXEA 2ATQA 4E1MA 4CF2A 3QEXA 4F3OA 1DT9A 5LL6Z 4PWDA 5GADP 5FLXO 3WXLA 3WNEA 2OPRA 3RTVA 5BR9A 4EHTA 3KK1A 4KTQA 3ZLJA 3THYA 1H1VA 3O9QA 5M1KA 2P9PB 3ULEB 1G15A 4CHZA 4CHQA 2HBKA 4ZTJA 1QNCA 3AVGA 1OH7A 2OTJN 2KW4A 2NWVA 4J2BA 5C12A 3ZSZA 3ENBA 1KYUA 3OYIA 4BG9A 3CC4N 1RCHA 2E6LA 3U6FA 3ISNC 4H8KA 4DU1A 3TANA 1LAWA 2NOHA 4X66K 2O3OA 4I7FA 4FWMA 3PO4A 1LWEA 3L4IA 2W42A 3FZLA 4XEIA 3A5NC 3O08A 3DLLL 2EHBD 3RPJA 4B9VA 4FZYA 2D0BA 2YHWA 1D9FA 4BWMA 2CGJA 5FDLA 3NVMA 2XRIA 4AM6A 5A2QO 1WOQA 4J8FA 3OSTA 3O1WA 5JN5A 5KRTA 4FZZA 4CJEA 2YJFA 3L3VA 4OJRA 1BCOA 4I9QA 2P9UB 4BR2A 1B9KA 3A5MC 1VTOA 4BROA 4Y0WA 2KFZA 3O3GA 1RBUA 4G1QA 4K8ZA 3KK2A 3MXJA 3NGYA 5BPMA 4KHYA 2G8KA 5AQJA 1TGHA 4LF9K 4R79A 1NMNA 3Q7CA 1UWBA 4CZMA 4RW4A 1VQ8N 1KFSA 3CI5A 2YH5A 3ZX2A 4Z4CA 4JRQA 5JS2A 2ZD1A 1EQYA 4B9UA 3HPHA 4CJSA 1X9MA 4WFAL 1ATRA 1DKGD 3ZEUA 4M3ZA 1M90O 4B3TK 2ZGYA 3WNFA 4CBXA 4EP5A 4KB0A 5H1SQ 4YY3K 3TTCA 1EP4A 1SKWA 3QEIA 4KRFA 2VG5A 1MP9A 2YNIA 1HQUA 3TSQA 1VK0A 4KHQA 1YIJN 4X62K 3OJUA 1IKWA 1NGBA 3MECA 1NVPA 3ZSWA 4BDZA 1K8KB 3D2FA 1M5Q1 5LMUK 2ITGA 2FBVA 3DPTA 1S5JA 2HHWA 3LAMA 4YDUA 3L8BA 5C15A 1HX1A 3B6OA 2G8IA 3EAYA 1W97L 5SWMA 1DLOA 4CF1A 4CZGA 2PYJA 3L2VA 2Z1IA 1BA0A 3P83D 2QWOA 4BC2A 4BREA 4JV5K 1RT6A 4B1YB 5AQHA 2DKDA 4QS7A 5GIOA 2HMIA 1Q81O 4YHHK 2P9SB 3DLBA 1QN9A 2HZMA 2YX6A 3TTDA 3FFKB 3L2QA 3QB0A 1REVA 2IGIA 3UKRB 1NGIA 4MDBA 5F0XA 4JK7A 4DSIA 1GLJO 2FXUA 5F1XA 2OPQA 4FK4A 4K43A 1LOTB 2E6MA 3VEYA 4CF9A 3RSEA 5I3UA 4B3RK 4CEFA 1U47A 4B08A 2HBLA 4FM0A 3WXJA 3FZMA 3QEVA 3AA3A 3AVMA 2B4JA 2CGLA 2GWKA 1QSYA 4F3TA 4PL8A 1GOBA 2DTUA 1HUXA 1RBSA 4CZLA 3LP0A 1OH5A 5IWAK 4DV4K 1FKPA 3AVCA 3OYAA 4OO1J 2ZGZA 1HQEA 3CQYA 1TYQB 3SYZA 5TKYA 3HL8A 4DTXA 1YITN 3VEOA 1KRPA 4IXCA 2GWJA 3R1XA 4EJYA 1T03A 4O5BA 3JXUA 1WSGA 4O5FA 4NLCA 5C10A 1IH7A 4EHUA 3PV8A 4DQQA 2PAVA 4FJIA 3K2PA 3HT3A 3CCLN 1RDDA 3ZSVA 4L8RB 3OYLA 2O8CA 4DQIA 4FJXA 3MCAB 1C1AA 4MO4A 4KPYA 3SUNA 4BJUA 4DTOA 3CD6N 2WOMA 2HF3A 3SI6A 2OZMA 2QI2A 5FRMA 5F2RA 4MQ3A 3H1VX 3HO1A 3DLGA 1HPMA 4DULA 3BP8A 3KTQA 1HNIA 3EYZA 2F9TA 5AQMA 2QXLA 1VSDA 3QBXA 3UB5A 1VSIA 4BDPA 3EIKA 3U9ZA 5TKWA 1HNWK 4FW2A 5GAGP 4WCEL 3I3WA 1ZBSA 3TTFA 3MX2A 5DMRA 1BCMA 4BRFA 1JLEA 5AZJA 1C9BB 4BRGA 4KAZA 2HNYA 2G8UA 1B9DA 4DV6K 4IOCL 3ASMA 3VQ9A 4BRMA 4H0VB 1L3SA 3J7AP 1LXTA 1RTIA 3KK7A 4FLZA 5KPZA 1PZDA 1L3VA 3KVGA 5F9CA 4CGHA 5KTQA 4QCLA 1UAXA 1YTAA 2OPPA 1HPZA 4CJPA 3VQ5A 3V6DA 3C6HA 3ZSQA 3AY9A 1PCJX 3JAMO 4CJ7A 4BRIA 1PCZA 4PKGA 3H3OB 4JI5K 5DK5A 1NKEA 3I8DA 1K73O 4CJ3A 5AZIB 2A40A 4RCHA 3LDQA 5KQ8A 4O0JA 5JICA 2F7TA 3OYEA 4CEEA 4UQGA 3DYAA 4JK9A 3R3LA 2HKPA 3SZ2A 2GEMA 2HVIA 2VQFK 3B8AX 3CETA 3F9MA 4AHCA 3SUPA 5LY3A 1RDBA 2QM1A 2ZF5O 3ZT4A 4E7IA 2ASPA 4BVPA 3DLKA 4FW1A 4FOIA 3SCXA 1D8YA 2XY6A 3AA4A 4AILC 3TWHA 2YNGA 1SL0A 4ILHA 3VQPA 2HVHA 1BGXT 2PYLA 3BDPA 2R5XA 1LCUA 1WN7A 4WQ5C 1QNAA 4H0XB 1KY6A 2FKMX 1NLVA 4V19S 5HRPA 1XI1A 3E9PA 4CJFA 3SPYA 3UKUB 4OVLA 1E42A 5FPMA 4LF8K 3T4NA 3JS6A 1VQKN 3E9LA 3ZEUB 4M7YA 3OVNA 1T7PA 1QSLA 4KI4A 1BOTO 2Z0FA 3VQ4A 3HS8A 3UIQA 4LC9B 1JKHA 2PBDA 3ID8A 3TAPA 2YA3A 1WBDA 3L2RA 3ZSOA 2UU9K 1RGIA 5E26A 3TABA 5C24A 3D2FB 1YUWA 3HPOA 1RBTA 3J81O 3CG7A 4BVOA 1QN4A 3AVNA 3WXIA 1KCFA 1VRUA 1Y64A 4IFEA 2NRVA 4WQ4A 3LZJA 2X6SA 3OY9A 1C0FA 2RKIA 3KZBA 4FJ8A 2WC9A 2KHOA 2OZSA 4M3YA 1NGGA 3CJCA 2QWPA 4UY8O 2BE2A 3CIPA 3PX6A 4YOXA 3N89A 3IH7A 2OPSA 1BQMA 2E5LK 2QKKA 2ZM6K 3K58A 1QE1A 3NBPA 4CZKA 4RWTA 3QNNA 4O4GA 2YHXA 1JL1A 5J2QA 4NCAA 2QKBA 4M3UA 2H4LX 3C6TA 1V4TA 4J2DA 4KH6A 4FPAA 4LY7A 1UA0A 1TK0A 3OJSA 3VN5A 1WB9A 2V9JA 5EPCA 4EJZA 4F2RA 3CXCM 2IDOA 4IZ9A 4DU3A 3RSEB 3G71N 4JD2B 4W5TA 4M45A 2E20A 4CJVA 3I0XA 1GLBG 1WQAA 3OBYA 3LP2A
chains in the Genus database with same CATH topology
3NF6A 3AO5A 4KO0A 4CFCA 3M8SA 1KO9A 1WNSA 4N56A 2VWJA 1X9WA 4FYDA 1LWYA 1VSHA 4DTNA 3LPTA 3OYFA 1VTLE 1NK0A 4AHRA 4O0IA 5HP1A 1T05A 1LV5A 3V4IA 3CFOA 3ZSRA 3NHGA 1QTMA 3HSTB 1L3UA 2G8VA 3T1AA 2D0CA 4I2QA 3VQEA 3OYMA 1TAUA 4WE1A 3NE6A 2JOIA 4W5NA 1NKBA 4DQPA 4W5RA 1VSKA 5HRSA 2XO7A 3S3OA 1W9HA 4CEBA 4E0DA 1NH2A 4C8NA 1U48A 4KHUA 4TPSA 4E19A 4ZHRA 4OPJA 4DQSA 4HUEA 2IC3A 1IG9A 3KLFA 2Y1JA 3ZSXA 4FJNA 3P5JA 2WONA 1YVUA 1TV6A 3AA5X 3DLEA 4HTUA 2Z1JA 1C6VA 1J54A 1JXEA 3TAEA 1IKYA 2ATQA 4E1MA 4CF2A 1LWWA 4DSFA 3QEXA 4F3OA 1QN3A 2G8WA 1GOAA 5CY4A 4FJ7A 4PWDA 5KGXA 4DSKA 2Z1HA 4OLBA 3WNEA 4E7KA 3SV4A 2OPRA 3RTVA 3OYNA 3KK1A 4KKOA 4KTQA 3T19A 2QK9A 5EU7A 1C1CA 2KTQA 4IG3A 1EXQA 4CF0A 4Q5VA 1NK5A 4H4MA 4CGIA 1G15A 4BE1A 4CHZA 1NJYA 4CHQA 1HRHA 4ZTJA 3HVRA 1QNCA 3AVGA 1TKTA 2RPIA 2PZSA 2KW4A 4RW6A 3DLHA 4CCHA 4J2BA 3ZSZA 1J5OA 1JXBA 3K5OA 4HVJA 1KYUA 2DFEA 3OYIA 1VSEA 5I42A 3VQQA 3QEPA 2NOLA 4FJGA 2A1SA 1RCHA 1SUQA 2E6LA 3U6FA 3OYGA 3ISNC 4H8KA 4DU1A 3TANA 1TK5A 4M41A 3D0PA 1LAWA 2O4GA 3AVBA 3V1QA 1WAJA 3MEGA 3K5LA 3V81A 3HJFA 2NOHA 5T7BA 3F10A 2O3OA 4I7FA 4E7JA 1YTFA 3AVHA 3WNGA 3RR8A 2OYQA 4RG8A 1CDWA 3PO4A 1LWEA 4DQRA 4CHPA 4Z4EA 4CGDA 1R4XA 5KGWA 2W42A 4CF8A 3NFAA 4M42A 4DLGA 2G8FA 3DOLA 4FZXC 3RMCA 3HS9A 4B0AA 1JLGA 4CJUA 4DFJA 1NK6A 3TARA 2HHQA 4AHVA 3RPJA 1SKRA 4B9VA 3G10A 4CHYA 1IO2A 2D0BA 2YHAA 3AVJA 3OS1A 4FZYA 5K14A 4IDKA 4CK2A 1D9FA 1X1PA 4BWMA 1UOCA 4GW6A 4E89A 5FDLA 2XRIA 1KVCA 1QQCA 3MXMA 1SL2A 4C8OA 3OSTA 3LWMA 2E4LA 1C1BA 1CZBA 4W5OA 4DTSA 2KZMA 1QN8A 5KRTA 4FLWA 3KK3A 3M8QA 4FZZA 2NOBA 4CJEA 4DU4A 2HHSA 4ICLA 3L3VA 4OJRA 4CJLA 4F2SA 1BCOA 4DFPA 1EKEA 3V9ZA 4I9QA 4Z4GA 4FXDA 2O4IA 1B9KA 1EETA 4CE9A 1VTOA 1D5AA 3CFRA 2KFZA 3O3GA 1RBUA 4BE2A 3SQ4A 4OKKA 4G1QA 3I0SA 1QS4A 4FLVA 4CJKA 3KK2A 3MXJA 3NGYA 1WLJA 4IBNA 4W5QA 2G8KA 4K8ZA 1FXXA 5CZ1A 3RR7A 4HHTA 4B8AB 1VSJA 1SKSA 1TGHA 2EHGA 2IV8A 1HMVA 1B92A 1S1TA 1R0AA 3QIPA 1UWBA 4ROCB 4RW4A 1KFSA 4EZ6A 4DG1A 3K59A 2YH5A 4LH5A 5HRRA 2B6AA 4Z4CA 3NF9A 4CIFA 4JRQA 5J2PA 2BGGA 5JS2A 4B8CA 1RT5A 1KLMA 3QETA 2QXFA 2ZD1A 3KJVA 3T3FA 1UT7A 3AVFA 3HPHA 4CJSA 4B9UA 1X9MA 3C6UA 2LAEA 1UT4A 3VQCA 2GV9A 3SV3A 3L3UA 4M3ZA 1HYZA 4IG0A 4NCBA 5C42A 3WNFA 4EP5A 4CFAA 4KB0A 4WZSD 1SKWA 1EP4A 4OKJA 3QEIA 1MU2A 4ID1A 1K6YA 4CEOA 1NK9A 4M3TA 3F9KA 4KRFA 2VG5A 1NJXA 4KTZA 1MP9A 2IOCA 2YNIA 3P1GA 5E41A 1HQUA 3LWLA 3NF8A 1KY7A 1S1WA 1VK0A 4IFVA 1RM1A 4YNQA 3OYBA 3F73A 4KHQA 3OJUA 1D3UA 2Z1GA 3AO1A 1IKWA 3K5MA 2Y1IA 1FN7A 1NVPA 3MECA 4BDYA 3ZSWA 4BDZA 3THVA 4K8XA 4RW7A 1KSPA 4CEQA 1FKOA 1WSIA 1YTBA 1O1WA 2XHIA 1BHLA 2F8TA 1NK4A 3RMAA 1N6QA 2ITGA 2FBVA 4OKEA 3DPTA 1S5JA 3HXMA 2R7YA 4ROEB 3LAMA 3M8RA 3L8BA 3E01A 1BIZA 3IG1A 3V9SA 4BE0A 3QO9A 2FBXA 1RT1A 3B6OA 2G8IA 4FLUA 4FJLA 3DRSA 1BI4A 1DLOA 4CF1A 5SWMA 2PYJA 3L2VA 3LP3A 2Z1IA 3AO4A 3VA3A 4OLAA 4E3SA 1N5YA 1TGOA 3P83D 4CJ5A 2XY7A 3TAQA 5IYDP 4FJJA 1WAFA 1RT6A 4NYNA 1DTQA 1Z25A 2HMIA 4H4OA 3H1ZA 3EZ5A 1ZBUA 2KZZA 1Y97A 3QERA 4JS5A 1NJZA 1TL1A 2XY8A 4OGEA 1KYFA 1YT3A 3DLBA 1QN9A 2HB5A 4B9TA 3V1OA 1KLNA 2P5OA 2HZMA 3L2QA 1REVA 4KHYA 2IGIA 5KRSA 4FCYA 4N5SA 3RMBA 1NJWA 2JLEA 4N41A 1TKZA 5FROA 2YKNA 4FK2A 4PQUA 4KTWA 2FBTA 1CXUA 3OS0A 3QEWA 4DSIA 1X9SA 3RWUA 4DLEA 2AJQA 1M3QA 3NGIA 4CJ4A 4B9MA 2OPQA 1RT7A 1ZBFA 4FK4A 4JLHA 4O44A 5C25A 2E6MA 3RMDA 4CF9A 1HU0A 1VSLA 2FGTA 2GBZA 2X6NA 5I3UA 1DTTA 4CEFA 1CLQA 1U47A 4Z4IA 4KI6A 4B08A 4FM0A 3QEVA 1I39A 1HNVA 3TAMA 1RBVA 3AA3A 3D45A 3KIOA 3QLHA 3AVMA 2B4JA 3SQ2A 3MAQA 4HCBA 4LD0A 3NH0A 3HP6A 1QSYA 4F3TA 3S3NA 5JS1A 3VQ6A 1RT2A 4ELUA 4Y1CA 2KFNA 3ALYA 4OGCA 1NKCA 3NDKA 1RT3A 3ZCMA 1U49A 3SNSA 4RODB 1GOBA 1HYSA 1KYDA 2DTUA 4HUGA 4FLXA 1RBSA 1TBPA 1JFIC 3C95A 3LP0A 1WSHA 1TKDA 1TAQA 1ZBIA 1KTQA 1RTJA 1FKPA 1Z26A 3AVCA 4DTUA 4DSJA 3HK2A 3OYAA 1LWFA 3OSMA 1A5VA 3G0ZA 3CQ8A 1HQEA 1QSSA 3SYZA 1YQLA 3U3YA 3HL8A 4DTXA 1XHXA 3IRXA 1Q9YA 2VG7A 4GMJB 1KRPA 2YNFA 4J2EA 1QN6A 3LALA 4EJYA 1T03A 4O5BA 3PY8A 1S6PA 3V9XA 1WSGA 4FJKA 5J2MA 5IYBP 4ZTFA 3B6PA 4EZ9A 4PA1A 1VOKA 1XC9A 1QTPA 2Z8UA 4I9LA 1IH7A 3NH1A 3JSMA 3PV8A 1Q9XA 3LDSA 1QHTA 3RRHA 4DQQA 3S3MA 4B3OA 5FRNA 4FJIA 3K2PA 4TSXA 4CEAA 3HT3A 1RDDA 1NK7A 1TL3A 2JGUA 1VRTA 3ZSVA 4L8RB 3OYLA 1BQNA 5SZTA 5IYCP 4IKFA 2IS3A 4DQIA 3AO3A 1KVAA 1JLQA 2HHUA 3EY1A 4B9LA 4FJXA 1UA1A 2MJ7A 1BIUA 1C1AA 3HM9A 2RN2A 4I2PA 3SUNA 4KPYA 4DTOA 3A2FA 3HVTA 3L2WA 1BISA 2WOMA 3DOKA 5CYQA 4FLYA 2B5JA 3BGRA 4KFBA 4DMNA 4CJRA 3SI6A 3KD5E 4FK0A 2NOZA 3HP9A 5FRMA 3HO1A 4MQ3A 5HRNA 1JLBA 4FM1A 3DLGA 4DS4A 1M3HA 3V9WA 3AO2A 1JLAA 4DULA 3KTQA 4Z4FA 3NH2A 1YQRA 1HNIA 3EYZA 3DRRA 3I0RA 3TAGA 3PX0A 2HNZA 3ZT2A 4FJ5A 1ITGA 4C8KA 4M3WA 2HHXA 3KLHA 1VSDA 1HJRA 1NOYA 4FVMA 2PY5A 1FK9A 1TKXA 1C0TA 1QN5A 1VSIA 4BDPA 3OCIA 4B9SA 3EIKA 1I3AA 1RT4A 1QTSA 4F4KA 4DF4A 4FW2A 3OYKA 3V1RA 2YV0X 3U3GA 3AVIA 1C0MA 3PX4A 5CYMA 3QESA 5DMRA 3CM6A 1BCMA 3AA2A 1LW2A 3OYCA 1TK8A 3MXIA 1JLEA 2F96A 4CHNA 1F21A 1C9BB 3SJJA 1KVBA 1D9DA 4KAZA 2HNYA 3WNHA 1B9DA 2VWKA 2G8UA 3ASMA 4CJTA 2F8SA 4I8OA 1A5WA 1JLFA 3DPUA 4C8MA 3VQ9A 3SUOA 1L3SA 1YTUA 3CM5A 2HHTA 4LSNA 1RTIA 4LH4A 3MEDA 5J1EA 4FLZA 1L5UA 1HYVA 2DFFA 1A5XA 4CERA 4KHSA 1PZDA 1L3VA 4DTPA 3KKSA 3K5NA 4C8LA 3KTUA 3SPZA 1XWLA 4CJQA 4KHNA 1ZYQA 4E1NA 4HUFA 4CGHA 3S9HA 4CEDA 5KTQA 4QCLA 3KD1E 1UAXA 3O3FA 1YTAA 1RDAA 1HPZA 2OPPA 4DF8A 2P5GA 2YHBA 4CJPA 1S1VA 3VQDA 2DY4A 3VQ5A 1ZBLA 3V6DA 3AVAA 2G30A 2ETJA 1JLCA 1ASVA 3ZSQA 3TI0A 4DFKA 1YQKA 3KKRA 3DI6A 4FM2A 3ITHA 4RW9A 1J9AA 1PCZA 4ELVA 2FC0A 4MFBA 5DK5A 1WSEA 3OC3C 1NKEA 3VA0A 3I8DA 4DWIA 4FJ9A 2IAJA 4ID5A 4EP4A 2BDPA 3FFIA 5KI6A 4CJ3A 4CFDA 3K57A 2D5RA 2X74A 3ULDA 1IKXA 5J2NA 4QAGA 2RF2A 4N76A 4O0JA 1C0UA 3OYEA 4CEEA 4UQGA 4OPKA 1EX4A 3DYAA 4M3RA 1KFDA 3MEEA 3SZ2A 4KB1A 3LPUA 2HVIA 4JS4A 3C94A 4AHCA 3SUPA 1RILA 3F0ZA 1RDBA 2DFHA 3ZT4A 3TR8A 1S6QA 1S1XA 1WSFA 2EX3A 4E7IA 1QNEA 1VOLB 4BACA 3DLKA 4FW1A 4CJWA 3SCXA 1D8YA 4AHTA 3LAKA 2XY6A 3SQ0A 2HNDA 1U45A 5D3GA 3AA4A 3KLGA 3TWHA 2YNGA 4AILC 1SL0A 1W80A 4O55A 3VQPA 2P1JA 2HVHA 3QINA 4KHWA 2XHBA 1TBAB 1BGXT 3O4QA 2BANA 2PYLA 1ASUA 3SNNA 2D0AA 4CEZA 3BDPA 2OZMA 1WN7A 3TAFA 1L3TA 1QNAA 4Z0UA 3NAEA 4Z4HA 3NCIA 1KY6A 4CECA 1CXQA 1TVRA 4CGGA 5HRPA 3DM2A 4HCCA 1GOCA 4R5PA 3LP1A 4RW8A 4J2AA 1XI1A 2ZE2A 4CJFA 4YFUA 4F8RA 2MZ8A 1LWCA 3QIOA 3SPYA 3SUQA 4DSEA 4OVLA 1AISA 3KLEA 1E42A 4JRPA 3I0WA 2FBYA 3PUFA 3VQ7A 4CGFA 2VG6A 2Q3SA 3NGZA 3LANA 3OVNA 1T7PA 1QNBA 2I5WA 2NUBA 1QSLA 4KI4A 4AH9A 4CESA 3VQ4A 3HS8A 3UIQA 1ZBHA 4M3XA 1JKHA 1N3CA 1LW0A 2VJ0A 4Q11A 1RNHA 1WSJA 1VSMA 2KQ2A 4CIGA 1IKVA 1CZ9A 3AVKA 3TAPA 1BL3A 1EBMA 3DLRA 5HLFA 2I5JA 1RTDA 4Q0BA 3L2RA 1LAVA 4DS5A 3ZSOA 4DTRA 1LWVA 4LSLA 3LZIA 3TABA 1U04A 5C24A 4B9NA 3CYMA 4KV8A 3HPOA 2OA8A 2HZSA 1RBTA 3CG7A 1QN4A 3AVNA 4CHOA 3DMJA 2YKMA 3PO5A 4E7HA 1KCFA 1VRUA 3VQAA 3LZJA 3DRPA 2X6SA 4AHUA 3OY9A 3L2UA 4E7LA 4DFMA 2XY5A 1U4BA 1BI4B 3O4NA 2RKIA 2HHWA 1RBRA 4CFBA 3OYDA 4FJ8A 2P51A 2OZSA 4M3YA 3RRGA 4AHSA 1JL2A 3IS9A 1J53A 2HW3A 2HHVA 1Q8IA 2BE2A 2ZQBA 1S9GA 3ULXA 3PX6A 1N3AA 1SL1A 4CGJA 2NOIA 4PUOA 1YQMA 3N89A 3NF7A 4NYFA 3IH7A 2OPSA 2NOFA 3AV9A 1BQMA 2QKKA 1N39A 4IFYA 1NGMA 1QN7A 1RTHA 4DTJA 1XHZA 3O3HA 4ELTA 1S1UA 3K58A 4DTMA 1QE1A 3NBPA 4QOZB 3QNNA 5HROA 3H08A 4GVMA 1B9FA 4O4GA 3V9UA 3KLIA 4FJMA 3OYHA 1JL1A 5J2QA 4NCAA 2QKBA 3AVLA 4M3UA 3C6TA 2G8HA 1SV5A 3JYTA 5HBMA 4KREA 4J2DA 2A1RA 3KRMA 4BWJA 1S9EA 3ZT1A 4PY5A 1RDCA 4CK3A 3HYFA 4LY7A 4XIUA 3VQ8A 1UA0A 2GUIA 3OJSA 3ZT0A 2IV9A 1TK0A 3VN5A 4FLTA 4FJHA 5AN4A 4EJZA 4F2RA 4CIEA 1W0HA 2IDOA 3IAYA 3OS2A 2X78A 4DU3A 3LP2A 3M8PA 4Y1DA 3OYJA 3SQ1A 3ZSYA 1NOZA 2YNHA 2NOEA 4CK1A 4W5TA 4M45A 4CJVA 1NK8A 3I0XA 1ASWA 1T8EA 3ZT3A 3CFPA 1VSFA 3VQBA 5CZ2A 4NCGA 2LSNA 4DSLA 4N47A 3HPGA 3QNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF6 A;  3AO5 A;  4KO0 A;  4CFC A;  3M8S A;  2VWJ A;  1WNS A;  4N56 A;  1X9W A;  4FYD A;  4DTN A;  1VSH A;  1NK0 A;  3LPT A;  3OYF A;  1VTL E;  4FJM A;  4AHR A;  4O0I A;  5HP1 A;  1T05 A;  1LV5 A;  3V4I A;  3CFO A;  3ZSR A;  3NHG A;  1QTM A;  3HST B;  1L3U A;  2G8V A;  3T1A A;  2D0C A;  4I2Q A;  3VQE A;  3OYM A;  1TAU A;  4WE1 A;  3NE6 A;  4W5N A;  1NKB A;  4DQP A;  4W5R A;  1VSK A;  5HRS A;  2XO7 A;  3S3O A;  1W9H A;  4CEB A;  4E0D A;  1NH2 A;  4C8N A;  1U48 A;  4KHU A;  4E19 A;  4ZHR A;  4OPJ A;  4DQS A;  4HUE A;  2IC3 A;  1IG9 A;  3KLF A;  2Y1J A;  3ZSX A;  4FJN A;  3P5J A;  2WON A;  1YVU A;  1TV6 A;  3AA5 X;  3DLE A;  4HTU A;  2Z1J A;  1C6V A;  1J54 A;  1JXE A;  3TAE A;  1IKY A;  2ATQ A;  4E1M A;  4CF2 A;  4DSF A;  3QEX A;  4F3O A;  1QN3 A;  2G8W A;  1GOA A;  5CY4 A;  4FJ7 A;  4PWD A;  5KGX A;  4DSK A;  2Z1H A;  4OLB A;  3WNE A;  4E7K A;  3SV4 A;  2OPR A;  3RTV A;  3OYN A;  3KK1 A;  4KKO A;  4KTQ A;  3T19 A;  2QK9 A;  5EU7 A;  1C1C A;  2KTQ A;  4IG3 A;  1EXQ A;  4CF0 A;  4Q5V A;  1NK5 A;  4H4M A;  4CGI A;  1G15 A;  4BE1 A;  4CHZ A;  1NJY A;  4CHQ A;  1HRH A;  4ZTJ A;  3HVR A;  1QNC A;  3AVG A;  1TKT A;  2RPI A;  2PZS A;  2KW4 A;  4RW6 A;  3DLH A;  4CCH A;  4J2B A;  3ZSZ A;  1J5O A;  1JXB A;  3K5O A;  4HVJ A;  1KYU A;  2DFE A;  3OYI A;  1VSE A;  5I42 A;  3VQQ A;  3QEP A;  4FJG A;  2A1S A;  1RCH A;  1SUQ A;  2E6L A;  3U6F A;  3OYG A;  3ISN C;  4H8K A;  4DU1 A;  3TAN A;  1TK5 A;  4M41 A;  3D0P A;  1LAW A;  2O4G A;  3AVB A;  3V1Q A;  1WAJ A;  3MEG A;  3K5L A;  3V81 A;  3HJF A;  4E7J A;  5T7B A;  3RR8 A;  4FJH A;  4I7F A;  5FRN A;  1YTF A;  3AVH A;  3WNG A;  4RG8 A;  1CDW A;  3PO4 A;  1LWE A;  4DQR A;  4CHP A;  4Z4E A;  4CGD A;  1R4X A;  5KGW A;  2W42 A;  4CF8 A;  3NFA A;  4M42 A;  4DLG A;  2G8F A;  3DOL A;  4FZX C;  3RMC A;  3HS9 A;  4B0A A;  1JLG A;  4CJU A;  4DFJ A;  1NK6 A;  3TAR A;  2HHQ A;  4AHV A;  1SKR A;  4B9V A;  3G10 A;  4CHY A;  1IO2 A;  2D0B A;  2YHA A;  3AVJ A;  3OS1 A;  4FZY A;  5K14 A;  4IDK A;  4CK2 A;  1D9F A;  1X1P A;  4BWM A;  1UOC A;  4GW6 A;  4E89 A;  5FDL A;  2XRI A;  1KVC A;  1QQC A;  3MXM A;  1SL2 A;  4C8O A;  3LWM A;  4DTS A;  2E4L A;  1C1B A;  1CZB A;  4W5O A;  2KZM A;  1QN8 A;  5KRT A;  4FLW A;  3KK3 A;  3M8Q A;  4FZZ A;  4CJE A;  4DU4 A;  2HHS A;  4ICL A;  3L3V A;  4OJR A;  4CJL A;  4F2S A;  1BCO A;  4DFP A;  1EKE A;  3V9Z A;  4I9Q A;  4Z4G A;  4FXD A;  2O4I A;  1B9K A;  1EET A;  4CE9 A;  1VTO A;  1D5A A;  3CFR A;  2KFZ A;  3O3G A;  1RBU A;  4BE2 A;  3SQ4 A;  4OKK A;  4G1Q A;  3I0S A;  1QS4 A;  4FLV A;  4CJK A;  3KK2 A;  3MXJ A;  3NGY A;  1WLJ A;  4IBN A;  4W5Q A;  2G8K A;  4K8Z A;  1FXX A;  5CZ1 A;  3RR7 A;  4HHT A;  4B8A B;  1VSJ A;  1SKS A;  1TGH A;  2EHG A;  2IV8 A;  1HMV A;  1B92 A;  1S1T A;  1R0A A;  3QIP A;  1UWB A;  4ROC B;  4RW4 A;  1KFS A;  4EZ6 A;  4DG1 A;  3K59 A;  4LH5 A;  5HRR A;  2B6A A;  4Z4C A;  3NF9 A;  4CIF A;  4JRQ A;  5J2P A;  2BGG A;  5JS2 A;  4B8C A;  1RT5 A;  1KLM A;  3QET A;  2QXF A;  2ZD1 A;  3KJV A;  3T3F A;  3HPH A;  3AVF A;  4CJS A;  4B9U A;  4B3O A;  1X9M A;  3C6U A;  3VQC A;  3SV3 A;  2GV9 A;  3L3U A;  4M3Z A;  1HYZ A;  4IG0 A;  4NCB A;  5C42 A;  3WNF A;  4EP5 A;  4CFA A;  4KB0 A;  4WZS D;  1SKW A;  1EP4 A;  4OKJ A;  3QEI A;  1MU2 A;  4ID1 A;  1K6Y A;  4CEO A;  1NK9 A;  4M3T A;  3F9K A;  4KRF A;  2VG5 A;  1NJX A;  4KTZ A;  1MP9 A;  2IOC A;  2YNI A;  3P1G A;  5E41 A;  1HQU A;  3LWL A;  3NF8 A;  1KY7 A;  1S1W A;  1VK0 A;  4IFV A;  1RM1 A;  4YNQ A;  3OYB A;  3F73 A;  4KHQ A;  3OJU A;  1D3U A;  2Z1G A;  3AO1 A;  1IKW A;  3K5M A;  2Y1I A;  3MEC A;  1NVP A;  4BDY A;  4K8X A;  3ZSW A;  4BDZ A;  3THV A;  4RW7 A;  1KSP A;  4CEQ A;  1FKO A;  1WSI A;  1YTB A;  1O1W A;  2F8T A;  1BHL A;  1NK4 A;  3RMA A;  1N6Q A;  2ITG A;  2FBV A;  4OKE A;  2R7Y A;  1S5J A;  3HXM A;  2OYQ A;  4ROE B;  3LAM A;  3M8R A;  3L8B A;  3E01 A;  1BIZ A;  3IG1 A;  3V9S A;  4BE0 A;  3QO9 A;  2FBX A;  1RT1 A;  3B6O A;  2G8I A;  4FLU A;  4FJL A;  3DRS A;  1BI4 A;  1DLO A;  4CF1 A;  5SWM A;  2PYJ A;  3L2V A;  3LP3 A;  2Z1I A;  3AO4 A;  3VA3 A;  4OLA A;  4E3S A;  1N5Y A;  1TGO A;  3P83 D;  4CJ5 A;  2XY7 A;  3TAQ A;  5IYD P;  4FJJ A;  1WAF A;  1RT6 A;  4NYN A;  1DTQ A;  1Z25 A;  2HMI A;  4H4O A;  3H1Z A;  3EZ5 A;  1ZBU A;  2KZZ A;  1Y97 A;  3QER A;  4JS5 A;  1NJZ A;  1TL1 A;  2XY8 A;  4OGE A;  1KYF A;  1YT3 A;  3DLB A;  1QN9 A;  2HB5 A;  4B9T A;  3V1O A;  1KLN A;  2P5O A;  3L2Q A;  1REV A;  4KHY A;  2IGI A;  5KRS A;  4FCY A;  4N5S A;  3RMB A;  1NJW A;  2JLE A;  4N41 A;  1TKZ A;  5FRO A;  2YKN A;  4FK2 A;  4PQU A;  4KTW A;  2FBT A;  1CXU A;  3OS0 A;  3QEW A;  4DSI A;  1X9S A;  3RWU A;  4DLE A;  2AJQ A;  3NGI A;  4CJ4 A;  4B9M A;  2OPQ A;  1RT7 A;  1ZBF A;  4FK4 A;  4JLH A;  4O44 A;  5C25 A;  2E6M A;  3RMD A;  4CF9 A;  1VSL A;  2GBZ A;  2X6N A;  5I3U A;  1DTT A;  4CEF A;  1CLQ A;  1U47 A;  4Z4I A;  4KI6 A;  4B08 A;  4FM0 A;  3QEV A;  1I39 A;  1HNV A;  3TAM A;  1RBV A;  3AA3 A;  3D45 A;  3KIO A;  3QLH A;  3AVM A;  2B4J A;  3SQ2 A;  3MAQ A;  4HCB A;  4LD0 A;  3NH0 A;  3HP6 A;  1QSY A;  4F3T A;  3S3N A;  5JS1 A;  3VQ6 A;  1RT2 A;  4ELU A;  4Y1C A;  2KFN A;  3ALY A;  4OGC A;  1NKC A;  3NDK A;  1RT3 A;  3ZCM A;  1U49 A;  1HYS A;  4ROD B;  1GOB A;  1KYD A;  2DTU A;  4HUG A;  4FLX A;  1RBS A;  1TBP A;  1JFI C;  3C95 A;  3LP0 A;  1WSH A;  1TKD A;  1TAQ A;  1ZBI A;  1KTQ A;  1RTJ A;  1FKP A;  1Z26 A;  3AVC A;  4DTU A;  4DSJ A;  3HK2 A;  3OYA A;  1LWF A;  3G0Z A;  1A5V A;  3CQ8 A;  1HQE A;  1QSS A;  3SYZ A;  3U3Y A;  3HL8 A;  4DTX A;  1XHX A;  3IRX A;  1Q9Y A;  2VG7 A;  4GMJ B;  1KRP A;  2YNF A;  4J2E A;  1QN6 A;  3LAL A;  1T03 A;  4O5B A;  3PY8 A;  1S6P A;  3V9X A;  1WSG A;  4FJK A;  5J2M A;  5IYB P;  4ZTF A;  3B6P A;  4EZ9 A;  4PA1 A;  1VOK A;  1XC9 A;  1QTP A;  2Z8U A;  4I9L A;  1IH7 A;  3NH1 A;  3JSM A;  3PV8 A;  1Q9X A;  3LDS A;  1QHT A;  3RRH A;  4DQQ A;  3S3M A;  4FJI A;  3K2P A;  4TSX A;  4CEA A;  3HT3 A;  1RDD A;  1NK7 A;  1TL3 A;  2JGU A;  1VRT A;  3ZSV A;  4L8R B;  3OYL A;  1BQN A;  5SZT A;  5IYC P;  4IKF A;  2IS3 A;  4DQI A;  3AO3 A;  1KVA A;  1JLQ A;  2HHU A;  3EY1 A;  4B9L A;  4FJX A;  1UA1 A;  2MJ7 A;  1BIU A;  1C1A A;  3HM9 A;  2RN2 A;  4I2P A;  3SUN A;  4KPY A;  4DTO A;  3A2F A;  3HVT A;  3L2W A;  1BIS A;  2WOM A;  3DOK A;  5CYQ A;  4FLY A;  2B5J A;  3BGR A;  4KFB A;  4DMN A;  4CJR A;  3SI6 A;  3KD5 E;  4FK0 A;  3HP9 A;  5FRM A;  3HO1 A;  4MQ3 A;  5HRN A;  1JLB A;  4FM1 A;  3DLG A;  4DS4 A;  3V9W A;  3AO2 A;  1JLA A;  3KTQ A;  4Z4F A;  3NH2 A;  1HNI A;  3EYZ A;  3DRR A;  3I0R A;  3TAG A;  3PX0 A;  2HNZ A;  3ZT2 A;  4FJ5 A;  1ITG A;  4C8K A;  4M3W A;  2HHX A;  3KLH A;  1VSD A;  1HJR A;  1NOY A;  4FVM A;  2PY5 A;  1FK9 A;  1TKX A;  1C0T A;  1QN5 A;  1VSI A;  4BDP A;  3OCI A;  4B9S A;  3EIK A;  1I3A A;  1RT4 A;  1QTS A;  4F4K A;  4DF4 A;  4FW2 A;  3OYK A;  3V1R A;  2YV0 X;  3U3G A;  3AVI A;  1C0M A;  3PX4 A;  5CYM A;  3QES A;  5DMR A;  3CM6 A;  1BCM A;  3AA2 A;  1LW2 A;  3OYC A;  1TK8 A;  3MXI A;  1JLE A;  2F96 A;  4CHN A;  1F21 A;  1C9B B;  3SJJ A;  1KVB A;  1D9D A;  4KAZ A;  2HNY A;  3WNH A;  1B9D A;  2VWK A;  2G8U A;  3ASM A;  4CJT A;  2F8S A;  1JLF A;  1A5W A;  4C8M A;  3VQ9 A;  3SUO A;  1L3S A;  1YTU A;  3CM5 A;  2HHT A;  4LSN A;  1RTI A;  4LH4 A;  3MED A;  5J1E A;  4FLZ A;  1L5U A;  1HYV A;  2DFF A;  1A5X A;  4CER A;  4KHS A;  1PZD A;  1L3V A;  4DTP A;  3KKS A;  3K5N A;  4C8L A;  3SPZ A;  1XWL A;  4CJQ A;  4KHN A;  1ZYQ A;  4E1N A;  4HUF A;  4CGH A;  3S9H A;  4CED A;  5KTQ A;  4QCL A;  3KD1 E;  1UAX A;  3O3F A;  1YTA A;  1RDA A;  1HPZ A;  2OPP A;  4DF8 A;  2P5G A;  2YHB A;  4CJP A;  1S1V A;  3VQD A;  2DY4 A;  3VQ5 A;  1ZBL A;  3V6D A;  3AVA A;  2G30 A;  2ETJ A;  1JLC A;  1ASV A;  3ZSQ A;  3TI0 A;  4DFK A;  3KKR A;  3DI6 A;  4FM2 A;  3ITH A;  4RW9 A;  1J9A A;  1PCZ A;  4ELV A;  2FC0 A;  4MFB A;  5DK5 A;  1WSE A;  3OC3 C;  1NKE A;  3VA0 A;  3I8D A;  4DWI A;  4FJ9 A;  2IAJ A;  4ID5 A;  4EP4 A;  2BDP A;  3FFI A;  5KI6 A;  4CJ3 A;  4CFD A;  3K57 A;  2D5R A;  2X74 A;  3ULD A;  1IKX A;  5J2N A;  4QAG A;  2RF2 A;  4N76 A;  4O0J A;  1C0U A;  3OYE A;  4CEE A;  4UQG A;  4OPK A;  1EX4 A;  3DYA A;  4M3R A;  1KFD A;  3MEE A;  3SZ2 A;  4KB1 A;  3LPU A;  2HVI A;  4JS4 A;  3C94 A;  4AHC A;  3SUP A;  1RIL A;  1RDB A;  2DFH A;  3ZT4 A;  3TR8 A;  1S6Q A;  1S1X A;  1WSF A;  2EX3 A;  4E7I A;  1QNE A;  1VOL B;  4BAC A;  3DLK A;  4FW1 A;  4CJW A;  3SCX A;  1D8Y A;  4AHT A;  3LAK A;  2XY6 A;  3SQ0 A;  2HND A;  1U45 A;  5D3G A;  3AA4 A;  3KLG A;  3TWH A;  2YNG A;  4AIL C;  1SL0 A;  1W80 A;  4O55 A;  3VQP A;  2P1J A;  2HVH A;  3QIN A;  4KHW A;  2XHB A;  1TBA B;  1BGX T;  3O4Q A;  2BAN A;  2PYL A;  1ASU A;  3SNN A;  2D0A A;  4CEZ A;  3BDP A;  2OZM A;  1WN7 A;  3TAF A;  1L3T A;  1QNA A;  4Z0U A;  3NAE A;  4Z4H A;  3NCI A;  1KY6 A;  4CEC A;  1CXQ A;  1TVR A;  4CGG A;  5HRP A;  3DM2 A;  4HCC A;  1GOC A;  4R5P A;  3LP1 A;  4RW8 A;  4J2A A;  1XI1 A;  2ZE2 A;  4CJF A;  4YFU A;  4F8R A;  3QIO A;  1LWC A;  3SPY A;  3SUQ A;  4DSE A;  4OVL A;  1AIS A;  3KLE A;  1E42 A;  4JRP A;  3VQ7 A;  2FBY A;  3PUF A;  3NGZ A;  4CGF A;  2VG6 A;  2Q3S A;  3LAN A;  3OVN A;  1T7P A;  1QNB A;  2NUB A;  1QSL A;  4KI4 A;  4AH9 A;  4CES A;  3VQ4 A;  3HS8 A;  3UIQ A;  1ZBH A;  4M3X A;  1JKH A;  1LW0 A;  2VJ0 A;  1RNH A;  4CIG A;  1WSJ A;  1VSM A;  2KQ2 A;  1IKV A;  1CZ9 A;  3AVK A;  3TAP A;  1BL3 A;  3DLR A;  5HLF A;  2I5J A;  1RTD A;  4Q0B A;  3L2R A;  1LAV A;  4DS5 A;  3ZSO A;  4DTR A;  4LSL A;  3LZI A;  3TAB A;  4B9N A;  1U04 A;  5C24 A;  3CYM A;  4KV8 A;  3HPO A;  2OA8 A;  1RBT A;  3CG7 A;  1QN4 A;  3AVN A;  4CHO A;  3DMJ A;  2YKM A;  3PO5 A;  4E7H A;  1KCF A;  1VRU A;  3VQA A;  3LZJ A;  3DRP A;  2X6S A;  4AHU A;  3OY9 A;  3L2U A;  4E7L A;  4DFM A;  2XY5 A;  1U4B A;  1BI4 B;  3O4N A;  2RKI A;  2HHW A;  1RBR A;  4CFB A;  3OYD A;  4FJ8 A;  2P51 A;  2OZS A;  4M3Y A;  3RRG A;  4AHS A;  1JL2 A;  3IS9 A;  1J53 A;  2HW3 A;  2HHV A;  1Q8I A;  2BE2 A;  2ZQB A;  1S9G A;  3PX6 A;  1SL1 A;  4CGJ A;  4PUO A;  4NYF A;  3NF7 A;  2OPS A;  3AV9 A;  1BQM A;  2QKK A;  4IFY A;  1NGM A;  1QN7 A;  1RTH A;  4DTJ A;  1XHZ A;  3O3H A;  4ELT A;  1S1U A;  3K58 A;  4DTM A;  1QE1 A;  3NBP A;  4QOZ B;  3QNN A;  5HRO A;  3H08 A;  4GVM A;  1B9F A;  4O4G A;  3V9U A;  3KLI A;  3OYH A;  1JL1 A;  5J2Q A;  4NCA A;  2QKB A;  3AVL A;  4M3U A;  3C6T A;  2G8H A;  1SV5 A;  3JYT A;  5HBM A;  4KRE A;  4J2D A;  2A1R A;  4BWJ A;  1S9E A;  3ZT1 A;  4PY5 A;  1RDC A;  4CK3 A;  3HYF A;  4LY7 A;  4XIU A;  3VQ8 A;  1UA0 A;  2GUI A;  3OJS A;  3ZT0 A;  2IV9 A;  1TK0 A;  3VN5 A;  4FLT A;  4F2R A;  4CIE A;  1W0H A;  2IDO A;  3IAY A;  3OS2 A;  2X78 A;  4DU3 A;  3LP2 A;  3M8P A;  4Y1D A;  3OYJ A;  3SQ1 A;  3ZSY A;  1NOZ A;  2YNH A;  4CK1 A;  4W5T A;  4M45 A;  4CJV A;  1NK8 A;  1T8E A;  1ASW A;  3ZT3 A;  3CFP A;  1VSF A;  3VQB A;  5CZ2 A;  4NCG A;  2LSN A;  4DSL A;  4N47 A;  3HPG A;  3QNO A; 
#chains in the Genus database with same CATH topology
 3NF6 A;  3AO5 A;  4CFC A;  2D4W A;  4FYD A;  1VSH A;  3LPT A;  3OYF A;  1LV5 A;  4DR5 K;  5CHI A;  3UE5 A;  2D0C A;  2E1Z A;  3VQE A;  3OYM A;  4WE1 A;  3NE6 A;  4BR7 A;  1WBB A;  3QFP A;  4PKH A;  4ZHR A;  4DQS A;  1TUU A;  5GIP A;  2IC3 A;  1E4F T;  4B1X B;  3CER A;  1IBL K;  4CZE A;  1UL7 A;  1R59 O;  3DLE A;  3CMA N;  1C6V A;  3P31 A;  5M1N A;  1RFQ A;  2G8W A;  3E9O A;  4DSK A;  1VQ6 N;  2QK9 A;  3VF2 A;  5EU7 A;  1C1C A;  4KHP K;  4BY9 C;  4B1W B;  3J8A A;  1NK5 A;  4WFN L;  4H4M A;  2O8C B;  1HRH A;  3GE1 A;  1VAZ A;  3BF1 A;  4CCH A;  3J7Z O;  3VQQ A;  5LJV A;  3QEP A;  1SUQ A;  2HHH K;  3CCS N;  2HL9 A;  3WEE B;  1VQ4 N;  5IT9 O;  3RR8 A;  4FJH A;  1JDY A;  1YTF A;  3AVH A;  1NG9 A;  1X3M A;  4Z4E A;  4CGD A;  3L4Q A;  1R4X A;  4CF8 A;  3NFA A;  4M42 A;  4FZX C;  3HS9 A;  4B0A A;  4DFJ A;  5AQN A;  3TAR A;  2HHQ A;  3VTH A;  2Q36 A;  5ADX A;  1SKR A;  3G10 A;  4BRK A;  3HTV A;  2YHA A;  3AVJ A;  1Z05 A;  5K14 A;  4HWI A;  4GW6 A;  4E89 A;  4IWV A;  5AZJ B;  4JHD A;  4C8O A;  1CZB A;  4W5O A;  1QN8 A;  4FLW A;  4BG8 A;  2I7P A;  4DU4 A;  3D6R A;  2CH5 A;  1HJO A;  4F2S A;  1EKE A;  3L6Q A;  4BC3 A;  3V9Z A;  4FXD A;  4M63 C;  5AR0 A;  4IO9 L;  3HBT A;  1QS4 A;  4CJK A;  2HHU A;  4BRH A;  5CZ1 A;  4GV3 A;  3RR7 A;  3A5L C;  1VSJ A;  3ATU A;  4EAJ A;  1NBW A;  1HMV A;  1S1T A;  1P5G X;  1B92 A;  3OW2 M;  1TYQ A;  4EZ6 A;  4DG1 A;  1VQO N;  3J7Y P;  2KLA A;  2B6A A;  3SAG A;  4CIF A;  1S3X A;  2BGG A;  3QET A;  2QXF A;  1UT7 A;  1PVS A;  3C6U A;  2LAE A;  3SV3 A;  3CCQ N;  1HYZ A;  4IG0 A;  5C42 A;  4WZS D;  4OKJ A;  1MU2 A;  4ID1 A;  1K6Y A;  1NJX A;  4KTZ A;  3P1G A;  2IOC A;  1CZA N;  1X3N A;  4YNQ A;  3F73 A;  2QW9 A;  2Z1G A;  4JKA A;  4BC4 A;  3D7E O;  3C0B A;  4O8K A;  1WSI A;  2JWL A;  2F8T A;  2XHI A;  1BHL A;  3D7Q A;  5I9E B;  1NK4 A;  1N6Q A;  4OKE A;  3M8R A;  3PMG A;  1VHX A;  3WXK A;  5CE3 A;  4BE0 A;  1RT1 A;  1BI4 A;  5LMN K;  2W6L A;  5KPR A;  3AO4 A;  3VA3 A;  4MRQ A;  2XY7 A;  3CCU N;  5IYD P;  1Z6R A;  1G99 A;  2ZWH A;  1IBK K;  3P39 A;  1DTQ A;  3H1Z A;  4B3S K;  1XUP O;  4JS5 A;  4CFF A;  3EEQ A;  3H3N O;  4CW7 B;  1KYF A;  1ZC6 A;  1KD1 O;  4B9T A;  2YI1 A;  1KLN A;  1N34 K;  3LDL A;  1EO1 A;  1KC8 O;  4N5S A;  2Q0U A;  1NJW A;  2JLE A;  3CME N;  1TKZ A;  5FRO A;  1QQM A;  4N41 A;  4KTW A;  3E1Y A;  3QEW A;  2J4R A;  3CQX A;  1X9S A;  2AJQ A;  1RT7 A;  2ITM A;  5C25 A;  3RMD A;  2GUP A;  3I33 A;  5MLC Q;  1Q7Y O;  3O8M A;  4ISE A;  4FWK A;  1DTT A;  1IJJ A;  4IL8 A;  4Z4I A;  4KI6 A;  1I39 A;  1HNV A;  3TAM A;  3CHW A;  3KIO A;  5AQK A;  3SQ2 A;  3PLA A;  1FW6 A;  4EAG A;  3S3N A;  3C7N A;  4LFA K;  5JS1 A;  1RT2 A;  4PL7 A;  4Y1C A;  3LDP A;  1RT3 A;  3SNS A;  4ROD B;  4HUG A;  3VGM A;  4FLX A;  1TBP A;  1TKD A;  1QZ5 A;  1ESV A;  2JHJ A;  1KTQ A;  1RTJ A;  1TAQ A;  1ZBI A;  1VQ5 N;  3OSM A;  3CQ8 A;  5AZI A;  5BPN A;  1QSS A;  3U3Y A;  2V52 B;  2HST A;  3W0L A;  1Q9Y A;  2VG7 A;  4J2E A;  1QN6 A;  4E1J A;  1OKJ A;  1BU6 O;  3PY8 A;  3B6P A;  4EZ9 A;  4PA1 A;  1VOK A;  2NRW A;  3NH1 A;  2QLV A;  4L3Q A;  5AQY A;  4NXM K;  4TSX A;  4CD1 A;  3VEW A;  1NK7 A;  1TL3 A;  2JGU A;  3GOI A;  1VRT A;  3H6E A;  5SZT A;  4OPA A;  5IYC P;  1KVA A;  1XQS C;  3EY1 A;  2MJ7 A;  2RN2 A;  4I2P A;  2OCE A;  4JAX A;  3HVT A;  3CJA A;  1BIS A;  2NRR A;  1QZ6 A;  4DMN A;  4NXN K;  3HP9 A;  4FM1 A;  2Q31 A;  4DS4 A;  2ASM A;  2DKA A;  1T6A A;  3TDH A;  1M3H A;  1KXP A;  2F4V K;  3J80 O;  1JLA A;  1MWK A;  4Z4F A;  3UKU A;  3ZT2 A;  3T1Y K;  1ITG A;  4M3W A;  2UUA K;  1TKX A;  1QN5 A;  4YOY A;  1I3A A;  3IUC A;  1IBM K;  2YV0 X;  4H5W A;  3SMS A;  3QES A;  3CM6 A;  3AA2 A;  3LM2 A;  3OYC A;  3NA5 A;  3SJJ A;  1KVB A;  2E88 A;  3S41 A;  4CJT A;  1JLF A;  3DPU A;  2HHT A;  3CM5 A;  4LSN A;  3M6G A;  1NGE A;  4JEP A;  4A2A A;  4KHS A;  4CER A;  1A5X A;  2GX9 A;  4MDA A;  2QWM A;  3K5N A;  3KTU A;  3SPZ A;  1OH8 A;  1NMD A;  1ZYQ A;  1XMQ K;  3S9H A;  3VQD A;  3I56 N;  5AQS A;  2G30 A;  1ASV A;  4BQL A;  1J9A A;  3FR0 A;  4YDU C;  3QDK A;  3OC3 C;  3VA0 A;  5EXW A;  1K2Y X;  4CFD A;  3K57 A;  1U2V A;  5J2N A;  4QAG A;  4N76 A;  1C0U A;  1HR0 K;  3QFU A;  1VQL N;  3FZH A;  5AQR A;  2E8A A;  5M1O A;  3LPU A;  4JS4 A;  4JHD B;  4EIA A;  4JD2 A;  3C94 A;  4A2B A;  3VF6 A;  3OSE A;  5GAE P;  1RIL A;  4DV2 K;  2W6K A;  1S1X A;  5AQI A;  1WSF A;  4U7B A;  2EX3 A;  4CBU A;  1QNE A;  3GL1 A;  4BAC A;  4A59 A;  1YJN N;  4AHT A;  1W80 A;  2AP1 A;  4KHW A;  1TBA B;  3O4Q A;  2BAN A;  2BUP A;  4FWN A;  2D0A A;  3N4P A;  3C6A A;  2PFU A;  3NAE A;  4BRD A;  4Z4H A;  2IVN A;  1TVR A;  1SZ2 A;  4R5P A;  5JMV D;  3SK3 A;  2ZE2 A;  3A8Y A;  4DSE A;  3CJ9 A;  5BMP A;  1AIS A;  4JRP A;  5EY4 A;  3VQ7 A;  2VG6 A;  4IOA L;  4FWQ A;  2FSK A;  4HTL A;  4AH9 A;  3EE8 A;  4JI3 K;  3CPW M;  1ZBH A;  5FPE A;  2VJ0 A;  2P9I B;  1WSJ A;  3OGD A;  1VSM A;  1HLU A;  1IKV A;  4FWS A;  1CZ9 A;  2A42 A;  2F7L A;  1EBM A;  3MX5 A;  2I5J A;  4DS5 A;  1LWV A;  1DIZ A;  1U04 A;  4KV8 A;  2OA8 A;  2HZS A;  3VMF B;  2YKM A;  2IVO A;  4DFM A;  4H5T A;  3WEE A;  1BI4 B;  1RBR A;  3OYD A;  3I55 N;  3OA9 A;  3CWT A;  2Q2R A;  3IS9 A;  2HW3 A;  1JCE A;  3DAW A;  3OBW A;  1N3A A;  4IEI A;  4CGJ A;  4DR4 K;  4NYF A;  3NF7 A;  1K8A O;  2NOF A;  2DPN A;  4IFY A;  2NLX A;  1OH6 A;  1XHZ A;  3ZX3 A;  4ELT A;  4DTM A;  5AQO A;  1I94 K;  4JKG A;  3WUH A;  3VGL A;  3VET A;  1T6C A;  3VEX A;  1BDG A;  1SV5 A;  5HBM A;  3CJ1 A;  3KRM A;  1S9E A;  3ZT1 A;  4C7P A;  1RDC A;  4CK3 A;  3HYF A;  4XIU A;  2GUI A;  5AN4 A;  4CIE A;  1W0H A;  2WUS A;  3R6M A;  5BRF A;  5JMV A;  4JN4 A;  5ADX H;  4ISG A;  3CFP A;  5CZ2 A;  3QNO A;  4KO0 A;  3ENH A;  2VWJ A;  4N56 A;  1T6D A;  1X9W A;  2QWR A;  4DTN A;  3WXM B;  1NK0 A;  3C7N B;  4BRL A;  4CZH A;  4FJM A;  4O0I A;  1T05 A;  3NHG A;  1SS6 A;  1J3M A;  1QVG M;  4BGA A;  1NGJ A;  1W9H A;  1U48 A;  2FUV A;  5GAH P;  2QRD A;  4XH5 A;  3FZF A;  4DV0 K;  5JLF A;  4LF7 K;  1TV6 A;  3LL3 A;  4JK8 A;  1LWW A;  4DSF A;  1QN3 A;  4EAH D;  5CY4 A;  4FJ7 A;  1VKL A;  5KGX A;  4GKJ K;  3M3Z A;  4OLB A;  4E7K A;  3FGU A;  1YAG A;  4KKO A;  4M7X A;  4CF0 A;  1WJW A;  4A57 A;  1SAZ A;  2O8D A;  4BE1 A;  1NJY A;  1P8Z A;  3HVR A;  1EWQ A;  4WQ5 A;  2PZS A;  2RPI A;  2E2N A;  2O8E A;  1NNE A;  4RW6 A;  4WYB A;  2D1K A;  3K5O A;  4HVJ A;  2DFE A;  1VSE A;  1N8R O;  2NOL A;  3T7Z A;  2FKF A;  3E66 A;  3DJC A;  3OYG A;  1S72 N;  3D0P A;  2O4G A;  3K5L A;  1WAJ A;  3MEG A;  5T7B A;  1TUO A;  4IDH A;  1CDW A;  4DQR A;  4JNE A;  3WT0 A;  3ENO C;  4DLG A;  3TSU A;  3RMC A;  1BA1 A;  4D7Q A;  1NK6 A;  4GV9 A;  3TPQ A;  1IO2 A;  3OS1 A;  3CWA A;  1NWK A;  1X1P A;  1KVC A;  1MDU B;  1QQC A;  2H3G X;  4GNI A;  2OTL N;  1SL2 A;  4B1V A;  4DTS A;  1C1B A;  2KZM A;  5KL0 A;  3TSP A;  2P5G A;  5HL7 L;  3HOT A;  2HHS A;  4DFP A;  1RDU A;  5C2F A;  4KH5 A;  4Z4G A;  1EET A;  4KBO A;  4H03 B;  4OKK A;  3I0S A;  4FLV A;  3AAP A;  1WLJ A;  3MDQ A;  4W5Q A;  1FXX A;  4B8A B;  1SKS A;  2IVP A;  2IV8 A;  4LF5 K;  3LDN A;  2QTD A;  5B8H A;  3K59 A;  5HRR A;  3NF9 A;  1RT5 A;  1KLM A;  2CGK A;  4WQ4 C;  3KJV A;  3T3F A;  4B3O A;  3TE5 A;  3VQC A;  3UW2 A;  3L3U A;  1U2V B;  4H0O A;  3FLC O;  5BPL A;  1QHA A;  1NK9 A;  3F9K A;  3VTI A;  5E41 A;  1D4X A;  3NF8 A;  4A62 A;  4AQY K;  1S1W A;  3EE9 A;  4IFV A;  1RM1 A;  2P9N A;  1D3U A;  3AO1 A;  2HMP A;  1FN7 A;  4BDY A;  5M1Q A;  4DKW A;  3THV A;  2JPI A;  1KSP A;  1YTB A;  2V92 A;  3RMA A;  4QS9 A;  5AQT A;  4BC5 A;  4QG5 A;  2V51 B;  4A5A A;  3HXM A;  2R7Y A;  3CVT A;  1BIZ A;  3V9S A;  3QBW A;  4FLU A;  4FJL A;  3DRS A;  3ZYY X;  3G6E N;  2BH1 A;  5C0Y A;  1GLD G;  4OLA A;  4E3S A;  1TGO A;  4CJ5 A;  3TAQ A;  3O1B A;  3KWI A;  1WAF A;  4NYN A;  3MWP A;  1XSZ A;  1ZBU A;  3DXM A;  1Y97 A;  3QER A;  4AF1 A;  1NJZ A;  5AQV A;  5FPD A;  3I8B A;  2HB5 A;  1TUY A;  1HNX K;  4FCY A;  3RMB A;  4PQU A;  1CXU A;  4D7R A;  4CJ4 A;  4B9M A;  1ZBF A;  5AFU H;  1WUA A;  2FGT A;  2GBZ A;  2X6N A;  1CLQ A;  2FSN A;  4FWP A;  1RBV A;  3QLH A;  3MAQ A;  4LD0 A;  5BN8 A;  3BF3 A;  3VQ6 A;  4ELU A;  2KFN A;  3ALY A;  4OGC A;  1NKC A;  3NDK A;  1U49 A;  1HYS A;  3MN6 A;  1KYD A;  1NJI O;  3CWU A;  1WSH A;  5AQP A;  1Z26 A;  3BZC A;  1YHQ N;  1A5V A;  3A0I X;  4A61 A;  5BRH A;  4GMJ B;  4JKG B;  2YNF A;  3THW A;  3SAF A;  2O8F A;  1S6P A;  4FJK A;  4ILG B;  1OVY A;  5M1P A;  1XC9 A;  4DR7 K;  1QTP A;  2Z8U A;  2A3Z A;  1Q9X A;  1N33 K;  4DR2 K;  4CEA A;  4IKF A;  2IIR A;  4B9L A;  1BIU A;  3HM9 A;  3A2F A;  5CYQ A;  2QEX N;  2B5J A;  3BGR A;  4KFB A;  4OPH A;  4CJR A;  3HM8 A;  3HSC A;  5HRN A;  1JLB A;  3V9W A;  2OOX A;  3T1H K;  1NGC A;  3NH2 A;  1YQR A;  4DV7 K;  3I0R A;  2A6A A;  3TAG A;  2HNZ A;  4FJ5 A;  2HBM A;  4C8K A;  4K25 A;  3VEV A;  4CZI A;  2F9W A;  1KAY A;  2HHX A;  4FVM A;  1FK9 A;  1O13 A;  1C0T A;  4B9S A;  4DR3 K;  4F4K A;  2P9I A;  4DF4 A;  4GKK K;  1YF5 L;  3OYK A;  4H0T B;  5JVG L;  1W7A A;  3V1R A;  3AVI A;  1C0M A;  5CYM A;  4XH1 A;  3HZ6 A;  2V8Q A;  3EL2 A;  3ENC A;  1W2B M;  3MXI A;  3CC7 N;  3R9P A;  2F8S A;  4C8M A;  3SUO A;  2O8D B;  3EN9 A;  3MED A;  3VOV A;  1VQP N;  1HYV A;  2DFF A;  3K9J A;  2O8E B;  4C8L A;  1XWL A;  4CJQ A;  4KHN A;  4C1N I;  3U9D A;  3MWT A;  4E1N A;  1IG8 A;  4CED A;  4DV5 K;  5EX5 A;  3CC2 N;  3KD1 E;  4LF6 K;  2ZJQ L;  1EUV A;  2P9L A;  4A5B A;  2YHB A;  3AAR A;  3QML A;  4DF8 A;  1S1V A;  4JKF A;  2FLO A;  5DM7 L;  3MN7 A;  4LF4 K;  3K9K A;  2NLV A;  1ILY A;  1NGA A;  2ASO A;  1MA9 B;  3AVA A;  2ETJ A;  3EKS A;  2NRX A;  1YQK A;  3F5T A;  3KKR A;  3CPE A;  4JKD A;  3THX A;  4RW9 A;  1VQ9 N;  4NB4 A;  4B1U B;  4MFB A;  3G4S N;  1C0G A;  3H45 C;  4DWI A;  2Y8Q A;  4FJ9 A;  4EP4 A;  2BDP A;  5GIN A;  5KI6 A;  3T69 A;  1IKX A;  2RF2 A;  4OPK A;  3MEE A;  4BRN A;  4JI6 K;  1S6Q A;  1M1K O;  3AGR A;  3O5B A;  4CJW A;  1NM1 A;  3LAK A;  3SQ0 A;  4H5N A;  2W41 A;  1U45 A;  5D3G A;  4B3M K;  3VPZ A;  4O55 A;  4JI7 K;  4H5R A;  2BTF A;  3CCE N;  3TAF A;  1L3T A;  4CZF A;  2W40 A;  4CEC A;  3GBT A;  4JYA K;  1JJ2 M;  4RW8 A;  4PKI A;  3WQT A;  4J2A A;  1Q18 A;  4F8R A;  1HKC A;  2MZ8 A;  3SUQ A;  3KLE A;  4JKB A;  3I0W A;  2FBY A;  3MMV A;  2VQE K;  2Q3S A;  3LAN A;  1QNB A;  2NUB A;  2FF3 B;  4ILJ A;  3CCJ N;  4M3X A;  4Q11 A;  2KQ2 A;  4IJN A;  4YOT A;  3DLR A;  3IFR A;  4MO5 A;  2P9N B;  5HLF A;  1RTD A;  3O9R A;  4GY2 B;  5BRE A;  1LAV A;  1GLL O;  4B9N A;  3D2E B;  3CYM A;  3H46 O;  3O4W A;  4CHO A;  3DMJ A;  3VQA A;  3L2U A;  2XY5 A;  3F2K A;  4CFB A;  1JCG A;  2QWQ A;  1J53 A;  2HHV A;  2NOI A;  2QRE A;  1YQM A;  5AFU A;  4PUO A;  3PDK A;  3IMX A;  3DXM B;  3BZK A;  3O3H A;  2CH6 A;  1S1U A;  3ZET B;  2G8H A;  3BY5 A;  3MN9 A;  2A1R A;  4BWJ A;  2ZJR L;  4PY5 A;  3VQ8 A;  3ZT0 A;  4WFB L;  4FLT A;  4FOE A;  4G9Z A;  3CWS A;  3MK6 A;  1T3V A;  4FL9 A;  3GDQ A;  5AQQ A;  2NOE A;  4CK1 A;  5C2D A;  1S22 A;  1T8E A;  1ASW A;  3ZT3 A;  4X65 K;  4HUE A;  4FWR A;  3ID6 A;  4N47 A;  4DSL A;  1LWY A;  2AA4 A;  1VTL E;  4AHR A;  5HP1 A;  1KAZ A;  3DXK A;  3V4I A;  3CFO A;  1QTM A;  1SQK A;  3MN5 A;  3HST B;  1L3U A;  2G8V A;  3C04 A;  4H5V A;  3T1A A;  4I2Q A;  2EWS A;  2JOI A;  1J6Z A;  1XC3 A;  4DQP A;  2FSJ A;  1VSK A;  3S3O A;  4E0D A;  3W3D A;  4TPS A;  2O8B B;  4FJN A;  3P5J A;  1KFQ A;  3THW B;  1YVU A;  1KFI A;  3AA5 X;  1J54 A;  4FPB A;  3TAE A;  1IKY A;  5AQL A;  2O8F B;  1GOA A;  2NRH A;  5BMN A;  2Z1H A;  2P9K A;  1KAX A;  3SV4 A;  4FWL A;  1RDW X;  1YXQ A;  3OYN A;  3T19 A;  1GLE G;  1BG3 A;  5AQW A;  3M5R A;  2KTQ A;  4IG3 A;  1EXQ A;  4C23 A;  4Q5V A;  1ZXO A;  1NU0 A;  2WFB A;  4CGI A;  2H5A X;  4CI6 A;  3IDH A;  4CVN E;  1TKT A;  3SBT A;  3DLH A;  1J5O A;  1JXB A;  3U8X A;  5I42 A;  4FJG A;  4DB3 A;  2A1S A;  5AQZ A;  4KH4 A;  5DM6 L;  1TK5 A;  1PCM X;  4M41 A;  4CD3 A;  3V1Q A;  3HJF A;  3AVB A;  3V81 A;  4E7J A;  3F10 A;  5FRN A;  4BR9 A;  3WNG A;  4RG8 A;  2VCP A;  1JCF A;  2KKZ A;  4CHP A;  2NRT A;  5KGW A;  2G8F A;  3DOL A;  1V4S A;  4CJU A;  1JLG A;  3OHR A;  4GV6 A;  4AHV A;  4X64 K;  4CHY A;  4IDK A;  4CK2 A;  4DHY A;  2JWK A;  4K42 A;  2YCH A;  1UOC A;  4DUY K;  4DR6 K;  2A5X A;  3MXM A;  5KPT A;  5AJ3 K;  3LWM A;  2E4L A;  4EFH A;  3KK3 A;  3M8Q A;  2NOB A;  2D0P A;  5AQG A;  4ICL A;  4FSV A;  3WQU A;  4CJL A;  1IV0 A;  2O4I A;  3BKQ X;  3AAQ A;  4CE9 A;  4FVU A;  1D5A A;  3CFR A;  4BE2 A;  3SQ4 A;  4NCG A;  1YJ9 N;  2RE2 A;  2P9L B;  4IBN A;  2GTD A;  4HHT A;  1QQN A;  2EHG A;  4GVE A;  1R0A A;  3QIP A;  4Z94 A;  4I6M B;  4ROC B;  2E2Q A;  3THX B;  4LH5 A;  2QRC A;  4IEE A;  5J2P A;  3IKM A;  4B8C A;  3OH9 A;  4LFC K;  4H0Y B;  3AVF A;  2D0O A;  1UT4 A;  2GV9 A;  1T44 A;  4BR4 A;  1XMO K;  3PSF A;  4NCB A;  3HRG A;  2UXD K;  4CFA A;  5JVH L;  4M3T A;  4CEO A;  4DV1 K;  3QIC A;  3LWL A;  1KY7 A;  3OYB A;  3CCR N;  3O9U A;  3L0Q A;  1Q9U A;  3K5M A;  2HBJ A;  2Y1I A;  4K8X A;  4IOX A;  3THY B;  4RW7 A;  3D4V A;  4CEQ A;  1FKO A;  1HNZ K;  1O1W A;  3OLP A;  1NGD A;  2NVM A;  2OYQ A;  4ROE B;  4CZJ A;  3LDO A;  3E01 A;  3IG1 A;  3EO3 A;  3QO9 A;  2FBX A;  1VQN N;  3LP3 A;  1N5Y A;  3K0S A;  4FJJ A;  4DCH A;  1Z25 A;  5CR4 A;  4H4O A;  3EZ5 A;  2KZZ A;  1TL1 A;  1VQM N;  2XY8 A;  4OGE A;  1YT3 A;  2Q0R A;  2HOE A;  2P5O A;  3V1O A;  4FO0 A;  4JKC A;  5KRS A;  4QS8 A;  4B9Q A;  3NMU A;  2YKN A;  4FK2 A;  2UXB K;  2FBT A;  1EWR A;  4RTF D;  3OS0 A;  3RWU A;  4DLE A;  2QWL A;  1M3Q A;  3NGI A;  2Y8L A;  1QQO A;  4JLH A;  4O44 A;  5AQU A;  4JKH A;  4NLB A;  1HU0 A;  1VSL A;  3AGK A;  4W5N A;  3D45 A;  4HCB A;  1BWF O;  3NH0 A;  4DR1 K;  3HP6 A;  5BR8 K;  3M1F A;  3ZCM A;  4LFB K;  2GEL A;  3ENO A;  4BRQ A;  4IJA A;  1JFI C;  3A5O C;  3C95 A;  4CBW A;  3OH6 A;  3HK2 A;  4DTU A;  4DSJ A;  3MCP A;  1LWF A;  3G0Z A;  4HJH A;  5BRD A;  1N36 K;  4DQ8 A;  3VER A;  1YQL A;  1J5E K;  3KHY A;  3BUZ B;  1XHX A;  1U6Z A;  3IRX A;  3LAL A;  5AQX A;  1GLF O;  3O9T A;  2DKC A;  3V9X A;  4AM7 A;  1P5D X;  5J2M A;  3O6W A;  5IYB P;  4ZTF A;  5FPN A;  2ZJP L;  5E84 A;  4I9L A;  1V5S A;  3JSM A;  3LDS A;  1QHT A;  3ZX0 A;  3RRH A;  3S3M A;  4YOU A;  1YJW N;  2P9P A;  4BRC A;  3ULE A;  3PIO L;  1BQN A;  2QR1 A;  2IS3 A;  3AO3 A;  1JLQ A;  3LM9 A;  4BR0 A;  1UA1 A;  2YHY A;  1NGH A;  3VEZ A;  2ZFD B;  2JHN A;  2WBN A;  5HOO A;  3L2W A;  3DOK A;  4FLY A;  3DXK B;  3KD5 E;  4FK0 A;  3TU5 A;  2NOZ A;  3CJ7 A;  1DGK N;  3VF4 A;  3AO2 A;  2E1Y A;  3H1Q A;  3DRR A;  3SLC A;  3HOS A;  3PX0 A;  3CCV N;  4YOR A;  1ATN A;  4JI1 K;  3SMP A;  3KLH A;  3VES A;  3VEN A;  1HJR A;  1NOY A;  2PY5 A;  5ELZ A;  3OCI A;  1RT4 A;  1QTS A;  4H0P A;  1GLC G;  1N32 K;  3U3G A;  3PX4 A;  2P9K B;  4BQZ A;  1C4G A;  1LW2 A;  5EVZ A;  3N4Q A;  1TK8 A;  2F96 A;  4CHN A;  1F21 A;  5EOY A;  3CF5 L;  1D9D A;  3D2E A;  1HKB A;  3WNH A;  4JI0 K;  2VWK A;  4I8O A;  1A5W A;  3SBG A;  2VGN A;  1YTU A;  4BRP A;  4LH4 A;  1L5U A;  5J1E A;  3U4L A;  1K35 A;  2P9U A;  3SJH A;  4DTP A;  3KKS A;  1YI2 N;  2UUC K;  4HUF A;  3O3F A;  1RDA A;  1DEJ A;  2UXC K;  4WX8 A;  2NZT A;  4DV3 K;  2DY4 A;  5LJW A;  1ZBL A;  3CCM N;  1JLC A;  3NVK A;  3TI0 A;  4DFK A;  3DI6 A;  4FM2 A;  5KQD A;  3ITH A;  3ZET A;  1MWM A;  4ELV A;  2FC0 A;  2E2O A;  1WSE A;  2IAJ A;  4ID5 A;  3FFI A;  2A41 A;  1XNR K;  2D5R A;  2X74 A;  3ULD A;  2I7N A;  3O80 A;  1EX4 A;  4M3R A;  3PSI A;  3CVS A;  1KFD A;  4KB1 A;  2V7Z A;  4U67 L;  5M1F A;  4PHT X;  4K41 A;  3F0Z A;  2DFH A;  2VGM A;  1HKG A;  2QWN A;  3TR8 A;  3FZK A;  4BGB A;  1K8K A;  3VGK A;  1VOL B;  2YJE A;  2HND A;  3DWL A;  3KLG A;  5AQF A;  1NGF A;  2P1J A;  3QIN A;  3FE1 A;  2XHB A;  4XH4 A;  1ASU A;  3SNN A;  4CEZ A;  3R8E A;  4Z0U A;  4MLH A;  3NCI A;  1CXQ A;  2O8B A;  4CGG A;  3DM2 A;  2HF4 A;  1GOC A;  4HCC A;  3LP1 A;  3GG4 A;  4EAK A;  2OAN A;  3EKU A;  4YFU A;  3QIO A;  1LWC A;  5JLH A;  3CW7 A;  2P9S A;  4MLE A;  4JI4 K;  2NNW A;  3PUF A;  3NGZ A;  4CGF A;  3ATV A;  2I5W A;  3UKR A;  4EAL A;  4CES A;  3RVC A;  1N3C A;  1LW0 A;  1RNH A;  4CIG A;  3AVK A;  1KQS M;  1BL3 A;  1E3M A;  1Q82 O;  2RHK A;  4Q0B A;  1X9J A;  3SAH A;  4DTR A;  4K0K K;  4LSL A;  3LZI A;  3C65 A;  3O9S A;  1Q86 O;  3BEX A;  1K9M O;  4JKE A;  4BRA A;  3PO5 A;  4B1Z A;  4E7H A;  1BO5 O;  3DRP A;  4AHU A;  4E7L A;  1U4B A;  3KWG A;  4NO7 A;  2UUB K;  3O4N A;  4EAI A;  2P51 A;  3RRG A;  4AHS A;  1JL2 A;  3OTO K;  1Q8I A;  2ZQB A;  1VQ7 N;  1S9G A;  3ULX A;  4YOV A;  1SL1 A;  2HL8 A;  3AV9 A;  1N39 A;  3CJB A;  1NGM A;  1QN7 A;  1RTH A;  4DTJ A;  1FJG K;  2UYT A;  4QOZ B;  5HRO A;  3H08 A;  1GLA G;  1B9F A;  1BUP A;  4GVM A;  3KLI A;  3V9U A;  4JI8 K;  1E4G T;  3OYH A;  2Q97 A;  5BN9 A;  1XNQ K;  3AVL A;  4O8U A;  2PWW A;  4KRE A;  4ISF A;  3JYT A;  3Q7B A;  1OVQ A;  5HSH A;  4BR5 A;  3P38 A;  2NRZ A;  2IV9 A;  4YOW A;  1YVN A;  3G25 A;  3IAY A;  3OS2 A;  2X78 A;  3P4I A;  2OOY A;  3M8P A;  4Y1D A;  3OYJ A;  3HI0 A;  3SQ1 A;  3ZSY A;  3EZW A;  1NOZ A;  2YNH A;  4C1N K;  1NK8 A;  1VSF A;  3VQB A;  2LSN A;  3HPG A;  3M8S A;  1QVF M;  1KO9 A;  1WNS A;  2VWB A;  1MPG A;  2V7Y A;  2QA4 N;  1ATS A;  4WXA A;  2WTU A;  4I6M A;  3ZSR A;  1C47 A;  2Q1N A;  3PIP L;  3RSM A;  4OX9 K;  1TAU A;  4F9O A;  1NKB A;  4W5R A;  5HRS A;  2XO7 A;  4JI2 K;  4KHU A;  4CEB A;  1NH2 A;  4C8N A;  4FWO A;  4E19 A;  1P90 A;  4OPJ A;  4DUZ K;  1IG9 A;  3KLF A;  4IO8 A;  2E2P A;  2Y1J A;  3ZSX A;  4WF9 L;  2WON A;  2FF6 A;  2VYP A;  4HTU A;  2Z1J A;  1JXE A;  2ATQ A;  4E1M A;  4CF2 A;  3QEX A;  4F3O A;  1DT9 A;  5LL6 Z;  4PWD A;  5GAD P;  5FLX O;  3WXL A;  3WNE A;  2OPR A;  3RTV A;  5BR9 A;  4EHT A;  3KK1 A;  4KTQ A;  3ZLJ A;  3THY A;  1H1V A;  3O9Q A;  5M1K A;  2P9P B;  3ULE B;  1G15 A;  4CHZ A;  4CHQ A;  2HBK A;  4ZTJ A;  1QNC A;  3AVG A;  1OH7 A;  2OTJ N;  2KW4 A;  2NWV A;  4J2B A;  5C12 A;  3ZSZ A;  3ENB A;  1KYU A;  3OYI A;  4BG9 A;  3CC4 N;  1RCH A;  2E6L A;  3U6F A;  3ISN C;  4H8K A;  4DU1 A;  3TAN A;  1LAW A;  2NOH A;  4X66 K;  2O3O A;  4I7F A;  4FWM A;  3PO4 A;  1LWE A;  3L4I A;  2W42 A;  3FZL A;  4XEI A;  3A5N C;  3O08 A;  3DLL L;  2EHB D;  3RPJ A;  4B9V A;  4FZY A;  2D0B A;  2YHW A;  1D9F A;  4BWM A;  2CGJ A;  5FDL A;  3NVM A;  2XRI A;  4AM6 A;  5A2Q O;  1WOQ A;  4J8F A;  3OST A;  3O1W A;  5JN5 A;  5KRT A;  4FZZ A;  4CJE A;  2YJF A;  3L3V A;  4OJR A;  1BCO A;  4I9Q A;  2P9U B;  4BR2 A;  1B9K A;  3A5M C;  1VTO A;  4BRO A;  4Y0W A;  2KFZ A;  3O3G A;  1RBU A;  4G1Q A;  4K8Z A;  3KK2 A;  3MXJ A;  3NGY A;  5BPM A;  4KHY A;  2G8K A;  5AQJ A;  1TGH A;  4LF9 K;  4R79 A;  1NMN A;  3Q7C A;  1UWB A;  4CZM A;  4RW4 A;  1VQ8 N;  1KFS A;  3CI5 A;  2YH5 A;  3ZX2 A;  4Z4C A;  4JRQ A;  5JS2 A;  2ZD1 A;  1EQY A;  4B9U A;  3HPH A;  4CJS A;  1X9M A;  4WFA L;  1ATR A;  1DKG D;  3ZEU A;  4M3Z A;  1M90 O;  4B3T K;  2ZGY A;  3WNF A;  4CBX A;  4EP5 A;  4KB0 A;  5H1S Q;  4YY3 K;  3TTC A;  1EP4 A;  1SKW A;  3QEI A;  4KRF A;  2VG5 A;  1MP9 A;  2YNI A;  1HQU A;  3TSQ A;  1VK0 A;  4KHQ A;  1YIJ N;  4X62 K;  3OJU A;  1IKW A;  1NGB A;  3MEC A;  1NVP A;  3ZSW A;  4BDZ A;  1K8K B;  3D2F A;  1M5Q 1;  5LMU K;  2ITG A;  2FBV A;  3DPT A;  1S5J A;  2HHW A;  3LAM A;  4YDU A;  3L8B A;  5C15 A;  1HX1 A;  3B6O A;  2G8I A;  3EAY A;  1W97 L;  5SWM A;  1DLO A;  4CF1 A;  4CZG A;  2PYJ A;  3L2V A;  2Z1I A;  1BA0 A;  3P83 D;  2QWO A;  4BC2 A;  4BRE A;  4JV5 K;  1RT6 A;  4B1Y B;  5AQH A;  2DKD A;  4QS7 A;  5GIO A;  2HMI A;  1Q81 O;  4YHH K;  2P9S B;  3DLB A;  1QN9 A;  2HZM A;  2YX6 A;  3TTD A;  3FFK B;  3L2Q A;  3QB0 A;  1REV A;  2IGI A;  3UKR B;  1NGI A;  4MDB A;  5F0X A;  4JK7 A;  4DSI A;  1GLJ O;  2FXU A;  5F1X A;  2OPQ A;  4FK4 A;  4K43 A;  1LOT B;  2E6M A;  3VEY A;  4CF9 A;  3RSE A;  5I3U A;  4B3R K;  4CEF A;  1U47 A;  4B08 A;  2HBL A;  4FM0 A;  3WXJ A;  3FZM A;  3QEV A;  3AA3 A;  3AVM A;  2B4J A;  2CGL A;  2GWK A;  1QSY A;  4F3T A;  4PL8 A;  1GOB A;  2DTU A;  1HUX A;  1RBS A;  4CZL A;  3LP0 A;  1OH5 A;  5IWA K;  4DV4 K;  1FKP A;  3AVC A;  3OYA A;  4OO1 J;  2ZGZ A;  1HQE A;  3CQY A;  1TYQ B;  3SYZ A;  5TKY A;  3HL8 A;  4DTX A;  1YIT N;  3VEO A;  1KRP A;  4IXC A;  2GWJ A;  3R1X A;  4EJY A;  1T03 A;  4O5B A;  3JXU A;  1WSG A;  4O5F A;  4NLC A;  5C10 A;  1IH7 A;  4EHU A;  3PV8 A;  4DQQ A;  2PAV A;  4FJI A;  3K2P A;  3HT3 A;  3CCL N;  1RDD A;  3ZSV A;  4L8R B;  3OYL A;  2O8C A;  4DQI A;  4FJX A;  3MCA B;  1C1A A;  4MO4 A;  4KPY A;  3SUN A;  4BJU A;  4DTO A;  3CD6 N;  2WOM A;  2HF3 A;  3SI6 A;  2OZM A;  2QI2 A;  5FRM A;  5F2R A;  4MQ3 A;  3H1V X;  3HO1 A;  3DLG A;  1HPM A;  4DUL A;  3BP8 A;  3KTQ A;  1HNI A;  3EYZ A;  2F9T A;  5AQM A;  2QXL A;  1VSD A;  3QBX A;  3UB5 A;  1VSI A;  4BDP A;  3EIK A;  3U9Z A;  5TKW A;  1HNW K;  4FW2 A;  5GAG P;  4WCE L;  3I3W A;  1ZBS A;  3TTF A;  3MX2 A;  5DMR A;  1BCM A;  4BRF A;  1JLE A;  5AZJ A;  1C9B B;  4BRG A;  4KAZ A;  2HNY A;  2G8U A;  1B9D A;  4DV6 K;  4IOC L;  3ASM A;  3VQ9 A;  4BRM A;  4H0V B;  1L3S A;  3J7A P;  1LXT A;  1RTI A;  3KK7 A;  4FLZ A;  5KPZ A;  1PZD A;  1L3V A;  3KVG A;  5F9C A;  4CGH A;  5KTQ A;  4QCL A;  1UAX A;  1YTA A;  2OPP A;  1HPZ A;  4CJP A;  3VQ5 A;  3V6D A;  3C6H A;  3ZSQ A;  3AY9 A;  1PCJ X;  3JAM O;  4CJ7 A;  4BRI A;  1PCZ A;  4PKG A;  3H3O B;  4JI5 K;  5DK5 A;  1NKE A;  3I8D A;  1K73 O;  4CJ3 A;  5AZI B;  2A40 A;  4RCH A;  3LDQ A;  5KQ8 A;  4O0J A;  5JIC A;  2F7T A;  3OYE A;  4CEE A;  4UQG A;  3DYA A;  4JK9 A;  3R3L A;  2HKP A;  3SZ2 A;  2GEM A;  2HVI A;  2VQF K;  3B8A X;  3CET A;  3F9M A;  4AHC A;  3SUP A;  5LY3 A;  1RDB A;  2QM1 A;  2ZF5 O;  3ZT4 A;  4E7I A;  2ASP A;  4BVP A;  3DLK A;  4FW1 A;  4FOI A;  3SCX A;  1D8Y A;  2XY6 A;  3AA4 A;  4AIL C;  3TWH A;  2YNG A;  1SL0 A;  4ILH A;  3VQP A;  2HVH A;  1BGX T;  2PYL A;  3BDP A;  2R5X A;  1LCU A;  1WN7 A;  4WQ5 C;  1QNA A;  4H0X B;  1KY6 A;  2FKM X;  1NLV A;  4V19 S;  5HRP A;  1XI1 A;  3E9P A;  4CJF A;  3SPY A;  3UKU B;  4OVL A;  1E42 A;  5FPM A;  4LF8 K;  3T4N A;  3JS6 A;  1VQK N;  3E9L A;  3ZEU B;  4M7Y A;  3OVN A;  1T7P A;  1QSL A;  4KI4 A;  1BOT O;  2Z0F A;  3VQ4 A;  3HS8 A;  3UIQ A;  4LC9 B;  1JKH A;  2PBD A;  3ID8 A;  3TAP A;  2YA3 A;  1WBD A;  3L2R A;  3ZSO A;  2UU9 K;  1RGI A;  5E26 A;  3TAB A;  5C24 A;  3D2F B;  1YUW A;  3HPO A;  1RBT A;  3J81 O;  3CG7 A;  4BVO A;  1QN4 A;  3AVN A;  3WXI A;  1KCF A;  1VRU A;  1Y64 A;  4IFE A;  2NRV A;  4WQ4 A;  3LZJ A;  2X6S A;  3OY9 A;  1C0F A;  2RKI A;  3KZB A;  4FJ8 A;  2WC9 A;  2KHO A;  2OZS A;  4M3Y A;  1NGG A;  3CJC A;  2QWP A;  4UY8 O;  2BE2 A;  3CIP A;  3PX6 A;  4YOX A;  3N89 A;  3IH7 A;  2OPS A;  1BQM A;  2E5L K;  2QKK A;  2ZM6 K;  3K58 A;  1QE1 A;  3NBP A;  4CZK A;  4RWT A;  3QNN A;  4O4G A;  2YHX A;  1JL1 A;  5J2Q A;  4NCA A;  2QKB A;  4M3U A;  2H4L X;  3C6T A;  1V4T A;  4J2D A;  4KH6 A;  4FPA A;  4LY7 A;  1UA0 A;  1TK0 A;  3OJS A;  3VN5 A;  1WB9 A;  2V9J A;  5EPC A;  4EJZ A;  4F2R A;  3CXC M;  2IDO A;  4IZ9 A;  4DU3 A;  3RSE B;  3G71 N;  4JD2 B;  4W5T A;  4M45 A;  2E20 A;  4CJV A;  3I0X A;  1GLB G;  1WQA A;  3OBY A;  3LP2 A; 
#chains in the Genus database with same CATH homology
 3NF6 A;  3AO5 A;  4KO0 A;  4CFC A;  3M8S A;  1KO9 A;  1WNS A;  4N56 A;  2VWJ A;  1X9W A;  4FYD A;  1LWY A;  1VSH A;  4DTN A;  3LPT A;  3OYF A;  1VTL E;  1NK0 A;  4AHR A;  4O0I A;  5HP1 A;  1T05 A;  1LV5 A;  3V4I A;  3CFO A;  3ZSR A;  3NHG A;  1QTM A;  3HST B;  1L3U A;  2G8V A;  3T1A A;  2D0C A;  4I2Q A;  3VQE A;  3OYM A;  1TAU A;  4WE1 A;  3NE6 A;  2JOI A;  4W5N A;  1NKB A;  4DQP A;  4W5R A;  1VSK A;  5HRS A;  2XO7 A;  3S3O A;  1W9H A;  4CEB A;  4E0D A;  1NH2 A;  4C8N A;  1U48 A;  4KHU A;  4TPS A;  4E19 A;  4ZHR A;  4OPJ A;  4DQS A;  4HUE A;  2IC3 A;  1IG9 A;  3KLF A;  2Y1J A;  3ZSX A;  4FJN A;  3P5J A;  2WON A;  1YVU A;  1TV6 A;  3AA5 X;  3DLE A;  4HTU A;  2Z1J A;  1C6V A;  1J54 A;  1JXE A;  3TAE A;  1IKY A;  2ATQ A;  4E1M A;  4CF2 A;  1LWW A;  4DSF A;  3QEX A;  4F3O A;  1QN3 A;  2G8W A;  1GOA A;  5CY4 A;  4FJ7 A;  4PWD A;  5KGX A;  4DSK A;  2Z1H A;  4OLB A;  3WNE A;  4E7K A;  3SV4 A;  2OPR A;  3RTV A;  3OYN A;  3KK1 A;  4KKO A;  4KTQ A;  3T19 A;  2QK9 A;  5EU7 A;  1C1C A;  2KTQ A;  4IG3 A;  1EXQ A;  4CF0 A;  4Q5V A;  1NK5 A;  4H4M A;  4CGI A;  1G15 A;  4BE1 A;  4CHZ A;  1NJY A;  4CHQ A;  1HRH A;  4ZTJ A;  3HVR A;  1QNC A;  3AVG A;  1TKT A;  2RPI A;  2PZS A;  2KW4 A;  4RW6 A;  3DLH A;  4CCH A;  4J2B A;  3ZSZ A;  1J5O A;  1JXB A;  3K5O A;  4HVJ A;  1KYU A;  2DFE A;  3OYI A;  1VSE A;  5I42 A;  3VQQ A;  3QEP A;  2NOL A;  4FJG A;  2A1S A;  1RCH A;  1SUQ A;  2E6L A;  3U6F A;  3OYG A;  3ISN C;  4H8K A;  4DU1 A;  3TAN A;  1TK5 A;  4M41 A;  3D0P A;  1LAW A;  2O4G A;  3AVB A;  3V1Q A;  1WAJ A;  3MEG A;  3K5L A;  3V81 A;  3HJF A;  2NOH A;  5T7B A;  3F10 A;  2O3O A;  4I7F A;  4E7J A;  1YTF A;  3AVH A;  3WNG A;  3RR8 A;  2OYQ A;  4RG8 A;  1CDW A;  3PO4 A;  1LWE A;  4DQR A;  4CHP A;  4Z4E A;  4CGD A;  1R4X A;  5KGW A;  2W42 A;  4CF8 A;  3NFA A;  4M42 A;  4DLG A;  2G8F A;  3DOL A;  4FZX C;  3RMC A;  3HS9 A;  4B0A A;  1JLG A;  4CJU A;  4DFJ A;  1NK6 A;  3TAR A;  2HHQ A;  4AHV A;  3RPJ A;  1SKR A;  4B9V A;  3G10 A;  4CHY A;  1IO2 A;  2D0B A;  2YHA A;  3AVJ A;  3OS1 A;  4FZY A;  5K14 A;  4IDK A;  4CK2 A;  1D9F A;  1X1P A;  4BWM A;  1UOC A;  4GW6 A;  4E89 A;  5FDL A;  2XRI A;  1KVC A;  1QQC A;  3MXM A;  1SL2 A;  4C8O A;  3OST A;  3LWM A;  2E4L A;  1C1B A;  1CZB A;  4W5O A;  4DTS A;  2KZM A;  1QN8 A;  5KRT A;  4FLW A;  3KK3 A;  3M8Q A;  4FZZ A;  2NOB A;  4CJE A;  4DU4 A;  2HHS A;  4ICL A;  3L3V A;  4OJR A;  4CJL A;  4F2S A;  1BCO A;  4DFP A;  1EKE A;  3V9Z A;  4I9Q A;  4Z4G A;  4FXD A;  2O4I A;  1B9K A;  1EET A;  4CE9 A;  1VTO A;  1D5A A;  3CFR A;  2KFZ A;  3O3G A;  1RBU A;  4BE2 A;  3SQ4 A;  4OKK A;  4G1Q A;  3I0S A;  1QS4 A;  4FLV A;  4CJK A;  3KK2 A;  3MXJ A;  3NGY A;  1WLJ A;  4IBN A;  4W5Q A;  2G8K A;  4K8Z A;  1FXX A;  5CZ1 A;  3RR7 A;  4HHT A;  4B8A B;  1VSJ A;  1SKS A;  1TGH A;  2EHG A;  2IV8 A;  1HMV A;  1B92 A;  1S1T A;  1R0A A;  3QIP A;  1UWB A;  4ROC B;  4RW4 A;  1KFS A;  4EZ6 A;  4DG1 A;  3K59 A;  2YH5 A;  4LH5 A;  5HRR A;  2B6A A;  4Z4C A;  3NF9 A;  4CIF A;  4JRQ A;  5J2P A;  2BGG A;  5JS2 A;  4B8C A;  1RT5 A;  1KLM A;  3QET A;  2QXF A;  2ZD1 A;  3KJV A;  3T3F A;  1UT7 A;  3AVF A;  3HPH A;  4CJS A;  4B9U A;  1X9M A;  3C6U A;  2LAE A;  1UT4 A;  3VQC A;  2GV9 A;  3SV3 A;  3L3U A;  4M3Z A;  1HYZ A;  4IG0 A;  4NCB A;  5C42 A;  3WNF A;  4EP5 A;  4CFA A;  4KB0 A;  4WZS D;  1SKW A;  1EP4 A;  4OKJ A;  3QEI A;  1MU2 A;  4ID1 A;  1K6Y A;  4CEO A;  1NK9 A;  4M3T A;  3F9K A;  4KRF A;  2VG5 A;  1NJX A;  4KTZ A;  1MP9 A;  2IOC A;  2YNI A;  3P1G A;  5E41 A;  1HQU A;  3LWL A;  3NF8 A;  1KY7 A;  1S1W A;  1VK0 A;  4IFV A;  1RM1 A;  4YNQ A;  3OYB A;  3F73 A;  4KHQ A;  3OJU A;  1D3U A;  2Z1G A;  3AO1 A;  1IKW A;  3K5M A;  2Y1I A;  1FN7 A;  1NVP A;  3MEC A;  4BDY A;  3ZSW A;  4BDZ A;  3THV A;  4K8X A;  4RW7 A;  1KSP A;  4CEQ A;  1FKO A;  1WSI A;  1YTB A;  1O1W A;  2XHI A;  1BHL A;  2F8T A;  1NK4 A;  3RMA A;  1N6Q A;  2ITG A;  2FBV A;  4OKE A;  3DPT A;  1S5J A;  3HXM A;  2R7Y A;  4ROE B;  3LAM A;  3M8R A;  3L8B A;  3E01 A;  1BIZ A;  3IG1 A;  3V9S A;  4BE0 A;  3QO9 A;  2FBX A;  1RT1 A;  3B6O A;  2G8I A;  4FLU A;  4FJL A;  3DRS A;  1BI4 A;  1DLO A;  4CF1 A;  5SWM A;  2PYJ A;  3L2V A;  3LP3 A;  2Z1I A;  3AO4 A;  3VA3 A;  4OLA A;  4E3S A;  1N5Y A;  1TGO A;  3P83 D;  4CJ5 A;  2XY7 A;  3TAQ A;  5IYD P;  4FJJ A;  1WAF A;  1RT6 A;  4NYN A;  1DTQ A;  1Z25 A;  2HMI A;  4H4O A;  3H1Z A;  3EZ5 A;  1ZBU A;  2KZZ A;  1Y97 A;  3QER A;  4JS5 A;  1NJZ A;  1TL1 A;  2XY8 A;  4OGE A;  1KYF A;  1YT3 A;  3DLB A;  1QN9 A;  2HB5 A;  4B9T A;  3V1O A;  1KLN A;  2P5O A;  2HZM A;  3L2Q A;  1REV A;  4KHY A;  2IGI A;  5KRS A;  4FCY A;  4N5S A;  3RMB A;  1NJW A;  2JLE A;  4N41 A;  1TKZ A;  5FRO A;  2YKN A;  4FK2 A;  4PQU A;  4KTW A;  2FBT A;  1CXU A;  3OS0 A;  3QEW A;  4DSI A;  1X9S A;  3RWU A;  4DLE A;  2AJQ A;  1M3Q A;  3NGI A;  4CJ4 A;  4B9M A;  2OPQ A;  1RT7 A;  1ZBF A;  4FK4 A;  4JLH A;  4O44 A;  5C25 A;  2E6M A;  3RMD A;  4CF9 A;  1HU0 A;  1VSL A;  2FGT A;  2GBZ A;  2X6N A;  5I3U A;  1DTT A;  4CEF A;  1CLQ A;  1U47 A;  4Z4I A;  4KI6 A;  4B08 A;  4FM0 A;  3QEV A;  1I39 A;  1HNV A;  3TAM A;  1RBV A;  3AA3 A;  3D45 A;  3KIO A;  3QLH A;  3AVM A;  2B4J A;  3SQ2 A;  3MAQ A;  4HCB A;  4LD0 A;  3NH0 A;  3HP6 A;  1QSY A;  4F3T A;  3S3N A;  5JS1 A;  3VQ6 A;  1RT2 A;  4ELU A;  4Y1C A;  2KFN A;  3ALY A;  4OGC A;  1NKC A;  3NDK A;  1RT3 A;  3ZCM A;  1U49 A;  3SNS A;  4ROD B;  1GOB A;  1HYS A;  1KYD A;  2DTU A;  4HUG A;  4FLX A;  1RBS A;  1TBP A;  1JFI C;  3C95 A;  3LP0 A;  1WSH A;  1TKD A;  1TAQ A;  1ZBI A;  1KTQ A;  1RTJ A;  1FKP A;  1Z26 A;  3AVC A;  4DTU A;  4DSJ A;  3HK2 A;  3OYA A;  1LWF A;  3OSM A;  1A5V A;  3G0Z A;  3CQ8 A;  1HQE A;  1QSS A;  3SYZ A;  1YQL A;  3U3Y A;  3HL8 A;  4DTX A;  1XHX A;  3IRX A;  1Q9Y A;  2VG7 A;  4GMJ B;  1KRP A;  2YNF A;  4J2E A;  1QN6 A;  3LAL A;  4EJY A;  1T03 A;  4O5B A;  3PY8 A;  1S6P A;  3V9X A;  1WSG A;  4FJK A;  5J2M A;  5IYB P;  4ZTF A;  3B6P A;  4EZ9 A;  4PA1 A;  1VOK A;  1XC9 A;  1QTP A;  2Z8U A;  4I9L A;  1IH7 A;  3NH1 A;  3JSM A;  3PV8 A;  1Q9X A;  3LDS A;  1QHT A;  3RRH A;  4DQQ A;  3S3M A;  4B3O A;  5FRN A;  4FJI A;  3K2P A;  4TSX A;  4CEA A;  3HT3 A;  1RDD A;  1NK7 A;  1TL3 A;  2JGU A;  1VRT A;  3ZSV A;  4L8R B;  3OYL A;  1BQN A;  5SZT A;  5IYC P;  4IKF A;  2IS3 A;  4DQI A;  3AO3 A;  1KVA A;  1JLQ A;  2HHU A;  3EY1 A;  4B9L A;  4FJX A;  1UA1 A;  2MJ7 A;  1BIU A;  1C1A A;  3HM9 A;  2RN2 A;  4I2P A;  3SUN A;  4KPY A;  4DTO A;  3A2F A;  3HVT A;  3L2W A;  1BIS A;  2WOM A;  3DOK A;  5CYQ A;  4FLY A;  2B5J A;  3BGR A;  4KFB A;  4DMN A;  4CJR A;  3SI6 A;  3KD5 E;  4FK0 A;  2NOZ A;  3HP9 A;  5FRM A;  3HO1 A;  4MQ3 A;  5HRN A;  1JLB A;  4FM1 A;  3DLG A;  4DS4 A;  1M3H A;  3V9W A;  3AO2 A;  1JLA A;  4DUL A;  3KTQ A;  4Z4F A;  3NH2 A;  1YQR A;  1HNI A;  3EYZ A;  3DRR A;  3I0R A;  3TAG A;  3PX0 A;  2HNZ A;  3ZT2 A;  4FJ5 A;  1ITG A;  4C8K A;  4M3W A;  2HHX A;  3KLH A;  1VSD A;  1HJR A;  1NOY A;  4FVM A;  2PY5 A;  1FK9 A;  1TKX A;  1C0T A;  1QN5 A;  1VSI A;  4BDP A;  3OCI A;  4B9S A;  3EIK A;  1I3A A;  1RT4 A;  1QTS A;  4F4K A;  4DF4 A;  4FW2 A;  3OYK A;  3V1R A;  2YV0 X;  3U3G A;  3AVI A;  1C0M A;  3PX4 A;  5CYM A;  3QES A;  5DMR A;  3CM6 A;  1BCM A;  3AA2 A;  1LW2 A;  3OYC A;  1TK8 A;  3MXI A;  1JLE A;  2F96 A;  4CHN A;  1F21 A;  1C9B B;  3SJJ A;  1KVB A;  1D9D A;  4KAZ A;  2HNY A;  3WNH A;  1B9D A;  2VWK A;  2G8U A;  3ASM A;  4CJT A;  2F8S A;  4I8O A;  1A5W A;  1JLF A;  3DPU A;  4C8M A;  3VQ9 A;  3SUO A;  1L3S A;  1YTU A;  3CM5 A;  2HHT A;  4LSN A;  1RTI A;  4LH4 A;  3MED A;  5J1E A;  4FLZ A;  1L5U A;  1HYV A;  2DFF A;  1A5X A;  4CER A;  4KHS A;  1PZD A;  1L3V A;  4DTP A;  3KKS A;  3K5N A;  4C8L A;  3KTU A;  3SPZ A;  1XWL A;  4CJQ A;  4KHN A;  1ZYQ A;  4E1N A;  4HUF A;  4CGH A;  3S9H A;  4CED A;  5KTQ A;  4QCL A;  3KD1 E;  1UAX A;  3O3F A;  1YTA A;  1RDA A;  1HPZ A;  2OPP A;  4DF8 A;  2P5G A;  2YHB A;  4CJP A;  1S1V A;  3VQD A;  2DY4 A;  3VQ5 A;  1ZBL A;  3V6D A;  3AVA A;  2G30 A;  2ETJ A;  1JLC A;  1ASV A;  3ZSQ A;  3TI0 A;  4DFK A;  1YQK A;  3KKR A;  3DI6 A;  4FM2 A;  3ITH A;  4RW9 A;  1J9A A;  1PCZ A;  4ELV A;  2FC0 A;  4MFB A;  5DK5 A;  1WSE A;  3OC3 C;  1NKE A;  3VA0 A;  3I8D A;  4DWI A;  4FJ9 A;  2IAJ A;  4ID5 A;  4EP4 A;  2BDP A;  3FFI A;  5KI6 A;  4CJ3 A;  4CFD A;  3K57 A;  2D5R A;  2X74 A;  3ULD A;  1IKX A;  5J2N A;  4QAG A;  2RF2 A;  4N76 A;  4O0J A;  1C0U A;  3OYE A;  4CEE A;  4UQG A;  4OPK A;  1EX4 A;  3DYA A;  4M3R A;  1KFD A;  3MEE A;  3SZ2 A;  4KB1 A;  3LPU A;  2HVI A;  4JS4 A;  3C94 A;  4AHC A;  3SUP A;  1RIL A;  3F0Z A;  1RDB A;  2DFH A;  3ZT4 A;  3TR8 A;  1S6Q A;  1S1X A;  1WSF A;  2EX3 A;  4E7I A;  1QNE A;  1VOL B;  4BAC A;  3DLK A;  4FW1 A;  4CJW A;  3SCX A;  1D8Y A;  4AHT A;  3LAK A;  2XY6 A;  3SQ0 A;  2HND A;  1U45 A;  5D3G A;  3AA4 A;  3KLG A;  3TWH A;  2YNG A;  4AIL C;  1SL0 A;  1W80 A;  4O55 A;  3VQP A;  2P1J A;  2HVH A;  3QIN A;  4KHW A;  2XHB A;  1TBA B;  1BGX T;  3O4Q A;  2BAN A;  2PYL A;  1ASU A;  3SNN A;  2D0A A;  4CEZ A;  3BDP A;  2OZM A;  1WN7 A;  3TAF A;  1L3T A;  1QNA A;  4Z0U A;  3NAE A;  4Z4H A;  3NCI A;  1KY6 A;  4CEC A;  1CXQ A;  1TVR A;  4CGG A;  5HRP A;  3DM2 A;  4HCC A;  1GOC A;  4R5P A;  3LP1 A;  4RW8 A;  4J2A A;  1XI1 A;  2ZE2 A;  4CJF A;  4YFU A;  4F8R A;  2MZ8 A;  1LWC A;  3QIO A;  3SPY A;  3SUQ A;  4DSE A;  4OVL A;  1AIS A;  3KLE A;  1E42 A;  4JRP A;  3I0W A;  2FBY A;  3PUF A;  3VQ7 A;  4CGF A;  2VG6 A;  2Q3S A;  3NGZ A;  3LAN A;  3OVN A;  1T7P A;  1QNB A;  2I5W A;  2NUB A;  1QSL A;  4KI4 A;  4AH9 A;  4CES A;  3VQ4 A;  3HS8 A;  3UIQ A;  1ZBH A;  4M3X A;  1JKH A;  1N3C A;  1LW0 A;  2VJ0 A;  4Q11 A;  1RNH A;  1WSJ A;  1VSM A;  2KQ2 A;  4CIG A;  1IKV A;  1CZ9 A;  3AVK A;  3TAP A;  1BL3 A;  1EBM A;  3DLR A;  5HLF A;  2I5J A;  1RTD A;  4Q0B A;  3L2R A;  1LAV A;  4DS5 A;  3ZSO A;  4DTR A;  1LWV A;  4LSL A;  3LZI A;  3TAB A;  1U04 A;  5C24 A;  4B9N A;  3CYM A;  4KV8 A;  3HPO A;  2OA8 A;  2HZS A;  1RBT A;  3CG7 A;  1QN4 A;  3AVN A;  4CHO A;  3DMJ A;  2YKM A;  3PO5 A;  4E7H A;  1KCF A;  1VRU A;  3VQA A;  3LZJ A;  3DRP A;  2X6S A;  4AHU A;  3OY9 A;  3L2U A;  4E7L A;  4DFM A;  2XY5 A;  1U4B A;  1BI4 B;  3O4N A;  2RKI A;  2HHW A;  1RBR A;  4CFB A;  3OYD A;  4FJ8 A;  2P51 A;  2OZS A;  4M3Y A;  3RRG A;  4AHS A;  1JL2 A;  3IS9 A;  1J53 A;  2HW3 A;  2HHV A;  1Q8I A;  2BE2 A;  2ZQB A;  1S9G A;  3ULX A;  3PX6 A;  1N3A A;  1SL1 A;  4CGJ A;  2NOI A;  4PUO A;  1YQM A;  3N89 A;  3NF7 A;  4NYF A;  3IH7 A;  2OPS A;  2NOF A;  3AV9 A;  1BQM A;  2QKK A;  1N39 A;  4IFY A;  1NGM A;  1QN7 A;  1RTH A;  4DTJ A;  1XHZ A;  3O3H A;  4ELT A;  1S1U A;  3K58 A;  4DTM A;  1QE1 A;  3NBP A;  4QOZ B;  3QNN A;  5HRO A;  3H08 A;  4GVM A;  1B9F A;  4O4G A;  3V9U A;  3KLI A;  4FJM A;  3OYH A;  1JL1 A;  5J2Q A;  4NCA A;  2QKB A;  3AVL A;  4M3U A;  3C6T A;  2G8H A;  1SV5 A;  3JYT A;  5HBM A;  4KRE A;  4J2D A;  2A1R A;  3KRM A;  4BWJ A;  1S9E A;  3ZT1 A;  4PY5 A;  1RDC A;  4CK3 A;  3HYF A;  4LY7 A;  4XIU A;  3VQ8 A;  1UA0 A;  2GUI A;  3OJS A;  3ZT0 A;  2IV9 A;  1TK0 A;  3VN5 A;  4FLT A;  4FJH A;  5AN4 A;  4EJZ A;  4F2R A;  4CIE A;  1W0H A;  2IDO A;  3IAY A;  3OS2 A;  2X78 A;  4DU3 A;  3LP2 A;  3M8P A;  4Y1D A;  3OYJ A;  3SQ1 A;  3ZSY A;  1NOZ A;  2YNH A;  2NOE A;  4CK1 A;  4W5T A;  4M45 A;  4CJV A;  1NK8 A;  3I0X A;  1ASW A;  1T8E A;  3ZT3 A;  3CFP A;  1VSF A;  3VQB A;  5CZ2 A;  4NCG A;  2LSN A;  4DSL A;  4N47 A;  3HPG A;  3QNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...