2D0BA

Crystal structure of bst-rnase hiii in complex with mg2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0bA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0bA02
3K5OA 1A5XA 5JS2A 3VQCA 3QIOA 3OS2A 3LWLA 1NKEA 2HVIA 1C9BB 1W0HA 3LANA 4M45A 3ZSZA 3EY1A 3V81A 2B6AA 3G0ZA 1TBPA 2RF2A 3KK3A 3SQ4A 1NJXA 3ZCMA 4CIGA 4ELUA 4EP4A 1NK4A 3RWUA 1TKZA 4JRPA 3AVCA 4CHNA 3OYLA 4OPKA 3CYMA 1RBVA 2Z1GA 3V9ZA 1WSHA 3S3OA 2FBXA 1QE1A 3LAKA 5KGWA 5I42A 1BISA 1HYZA 1SKRA 1CXUA 2P1JA 1RTHA 4KHUA 2HHXA 3L2WA 4M3TA 1I3AA 4WZSD 1QQCA 3VQPA 3RRHA 4DF8A 4Z4EA 3L3VA 2BDPA 3HVRA 5C25A 3VQ5A 2LSNA 4AHVA 1RT5A 2FBTA 1JLEA 3SZ2A 4DQSA 4KAZA 4FZXC 4KHSA 3IS9A 4OJRA 4CFAA 2IV9A 5IYDP 1VOKA 3QETA 2XY5A 4KB0A 1U47A 2KTQA 1QN9A 1IKXA 3RMCA 2IS3A 1TL3A 1N5YA 1HYVA 3VQ9A 3KLGA 1C0MA 4JRQA 3AV9A 1LAVA 3V1RA 3ZT4A 2RKIA 3OY9A 4DLEA 3SUQA 3ZSXA 2WONA 4IKFA 3DYAA 4B0AA 2GV9A 3VQEA 1S5JA 4HVJA 1EP4A 1FKOA 5E41A 3TARA 3H1ZA 4H4OA 4NYFA 4CJEA 3OYAA 2HVHA 1LWFA 1JXEA 3MXMA 4KHQA 1JLCA 3I8DA 3WNEA 4FLTA 3OS0A 4CJLA 1RT7A 1IKYA 4FJJA 4O5BA 3QERA 3K58A 2QK9A 2IV8A 4CJRA 5KGXA 3ZSRA 1EETA 1VSEA 3QINA 3OS1A 4OKEA 4ID5A 1NOYA 1NJWA 1KY6A 3AA2A 1A5VA 3MXJA 4LH5A 1R4XA 3CM5A 5KI6A 4CK2A 5KTQA 1IG9A 3RR8A 3DOLA 2HHSA 1UA0A 4AHUA 3OC3C 3K5MA 3AA3A 3OCIA 4HTUA 1TV6A 1B9KA 2Y1JA 3BGRA 3CM6A 4WE1A 1IH7A 2OZMA 3SUNA 1RT3A 3HPHA 1RT6A 4CJ5A 3HO1A 4CJWA 4FJ7A 2EHGA 4DFJA 1BCMA 1XHXA 4K8XA 4DQQA 3KLEA 1D9FA 1BL3A 3P1GA 4AH9A 4E89A 4KI6A 1TAQA 5DMRA 1ZBFA 1VOLB 4Y1DA 5FDLA 4FM0A 5J2NA 3SPZA 1RT1A 5EU7A 5HROA 2YNFA 1LWCA 3V9XA 4QCLA 3SV4A 4CHQA 4CJSA 3S3NA 1B92A 1I39A 1VSHA 3AVIA 3DLGA 1YTBA 5J2MA 1JLFA 4GMJB 3TAFA 4W5OA 4FCYA 5HRSA 2G8VA 1YT3A 2OPRA 4CEAA 5I3UA 4N76A 1T8EA 3OYEA 3MXIA 4N56A 2YNIA 4BE0A 3DOKA 3L8BA 1WSFA 2P5GA 1CXQA 3L3UA 5CZ1A 5DK5A 3PO4A 1NK9A 4J2AA 4I2QA 3ZT1A 4O44A 2YNGA 3OJSA 4CJ4A 3V9UA 3EZ5A 1U48A 1VSJA 3VQQA 3OJUA 4ZTFA 4J2BA 1WN7A 4DWIA 3MAQA 1SL0A 2D0BA 1S6PA 4NYNA 4CF9A 4F2SA 1NGMA 2OA8A 4Q5VA 1HPZA 1VSMA 4DTPA 4KHNA 3NE6A 3KK1A 2ZE2A 4B9UA 4J2DA 1LV5A 4F2RA 4HUGA 3RR7A 4KPYA 5KRTA 1PZDA 3B6OA 4CGGA 4DQPA 2B5JA 1S9EA 2D0AA 5HRRA 2Z1HA 3CFRA 3ITHA 1SL1A 1BQMA 1RBSA 3OYGA 1T7PA 4CESA 2XO7A 1LW0A 3OYKA 1J53A 4N5SA 3PV8A 3DRPA 3VQ7A 1JKHA 1EXQA 3NH2A 3LZJA 4N47A 1TKDA 3HS9A 4DF4A 2D5RA 4CJUA 4DTRA 4E0DA 4KRFA 1KY7A 3O3GA 2F8SA 2OPSA 1X9SA 1QNBA 4FVMA 3HVTA 4CF1A 3AVHA 3KD1E 4OPJA 3HJFA 2ATQA 4Z4IA 3LP2A 4IG3A 1HRHA 2X74A 4KI4A 1TGHA 5IYCP 1S1XA 2RN2A 3ZSVA 1X9WA 1ZYQA 1VK0A 3TAEA 4CJTA 3QEVA 2Z8UA 1JFIC 1KSPA 1HQUA 1S1VA 3DLEA 5SZTA 4C8NA 1U49A 4CJFA 4CEBA 3HM9A 1QN4A 1HYSA 1S1WA 4FYDA 1WAJA 4PY5A 1YVUA 4KFBA 4LSNA 4CFBA 4KHYA 2B4JA 3KK2A 3VQBA 4CGIA 4DTOA 1GOAA 3AA5X 3WNHA 1LAWA 4HUEA 4DSEA 4LSLA 1HQEA 1HMVA 1K6YA 4OLAA 2HHQA 3NFAA 2VJ0A 4OGEA 3G10A 4CGFA 3ZT0A 1ASVA 2YKNA 2Z1JA 3D45A 4AHSA 3TAGA 3TAQA 1L3SA 1RILA 4W5TA 1N6QA 2QKBA 5FRNA 3NGZA 4CECA 1QSSA 4F3OA 2GUIA 1BI4B 3TAMA 1S6QA 1FXXA 4Y1CA 1VSLA 4BWJA 2PY5A 4IDKA 3IRXA 1R0AA 4CIFA 3OYNA 3LWMA 1KTQA 3IAYA 1QNCA 2OPPA 3KLHA 4ROEB 1VSFA 5FROA 2G8HA 4DTSA 4FK0A 1RBTA 1NK5A 3AO4A 3FFIA 4FLYA 5D3GA 4DTNA 1IKVA 1SUQA 3NF7A 5J2PA 4K8ZA 2KZMA 5CZ2A 3NF9A 1MP9A 4IG0A 5HRPA 4R5PA 3L2RA 3SQ0A 4CFDA 1O1WA 1VTOA 1WAFA 2Y1IA 3LDSA 1CZ9A 4CHYA 3O3FA 3O3HA 4JS5A 2KZZA 4CHPA 3HK2A 3M8SA 2X78A 4CCHA 4DFMA 2XY6A 1SKWA 3ZT2A 4TSXA 4KTZA 3TR8A 4Z4CA 4BE2A 2PZSA 1L3VA 3CFOA 4OLBA 1RBUA 1U04A 3B6PA 2XHBA 1YTFA 1BIUA 3NH0A 1RDCA 1D8YA 2G8KA 2DFEA 4O4GA 3VA3A 1ZBUA 4M41A 3LP3A 1JLBA 3KKRA 3S3MA 1BIZA 1GOBA 4DS4A 4ZTJA 4DU4A 2A1RA 4CHZA 1ZBLA 3AO5A 1HNIA 3VQDA 4J2EA 4Z4HA 3OVNA 3V9WA 4O55A 3L2QA 4I9LA 1KRPA 3RMBA 2IDOA 3UIQA 4IBNA 1KYUA 1WSJA 3C95A 2HHUA 1X1PA 3PY8A 2EX3A 3K2PA 3QEPA 4FJMA 5J1EA 3OYDA 3TABA 3F9KA 3SNNA 1F21A 3DRRA 4DQIA 3KD5E 4DTJA 2IC3A 3E01A 3QO9A 4LH4A 4YFUA 1TK5A 5SWMA 5T7BA 2P51A 1RDAA 3DI6A 4F4KA 3L2UA 2FBVA 1XI1A 1KFSA 4FM2A 1SV5A 3HL8A 4DTXA 4E1NA 4BDPA 4AHTA 5HRNA 4CE9A 1ASUA 3TWHA 2I5JA 4ROCB 1BI4A 1LWEA 4CEFA 3OYFA 3DLBA 1D5AA 3ZSQA 2OYQA 4ZHRA 4B9TA 2FC0A 2HNZA 1RTIA 1Z26A 2YNHA 3LAMA 1NKBA 4CGDA 1NKCA 4B9LA 4B8CA 5HLFA 1VRTA 1QNEA 3IG1A 1TKTA 4CERA 4E7JA 2E4LA 3SQ1A 4FJNA 3OYJA 4FM1A 1A5WA 2YV0X 3KJVA 4FLWA 1QN8A 3HP6A 2G8WA 4PUOA 3T19A 3SUPA 3NGYA 2JGUA 4CGHA 1NJZA 2XY7A 1VSKA 1PCZA 1QN6A 1CZBA 3V1OA 1Z25A 1L3UA 3JSMA 2O4GA 1NK8A 1S9GA 3JYTA 2QXFA 3BDPA 1EX4A 3U3YA 4XIUA 4CFCA 3OYCA 4Z4FA 4BDZA 5CYQA 1KFDA 4RW4A 2VWJA 4DQRA 3SJJA 1W80A 3RMAA 1RCHA 3DLRA 3KLFA 4E3SA 4ELTA 3ZSYA 3QEIA 1VRUA 3AVLA 2W42A 3QNNA 1L3TA 3KTQA 4QOZB 4DSFA 1SKSA 3AA4A 1C1CA 3THVA 4KB1A 2HNYA 1SL2A 2YKMA 4HCCA 2FBYA 2JLEA 5IYBP 1UA1A 2G8UA 1JL1A 2YHBA 3DLHA 4CJQA 1NK7A 2HHTA 1TGOA 2AJQA 1QHTA 1ZBIA 1RNHA 1QSYA 2HHVA 1REVA 3CQ8A 1CDWA 1MU2A 3HSTB 4RW8A 3NHGA 3QESA 4BWMA 4B9VA 4MQ3A 4KTWA 4F8RA 1RM1A 2VWKA 1BGXT 3NH1A 3DLKA 3TANA 1D9DA 1EKEA 1KCFA 2ZQBA 1IO2A 1BQNA 1W9HA 4UQGA 2HB5A 4JS4A 1KYDA 4FJHA 4CJPA 4FZYA 3HPGA 3NAEA 4F3TA 3A2FA 5JS1A 3TI0A 4FW1A 3NCIA 1WSGA 4GVMA 4DSIA 1HNVA 1WLJA 1TKXA 4GW6A 4CJVA 3NGIA 3PX0A 4CJ3A 4DSJA 4FJGA 2E6MA 4Z4GA 1YTUA 1G15A 4I2PA 1AISA 4DTUA 2DTUA 1JLGA 4B08A 3RTVA 4FLUA 1QN7A 3SCXA 3AVJA 4DFKA 3HXMA 4OGCA 5C42A 3CFPA 2HW3A 1J5OA 4H8KA 1T03A 1Q9XA 4QAGA 1T05A 3LPTA 2PYLA 5KRSA 1KLMA 4I9QA 3WNFA 4CIEA 2IGIA 4O0IA 5HBMA 2WOMA 4RODB 3RMDA 3D0PA 4L8RB 3MEGA 3VQAA 5CYMA 4AHCA 3LPUA 3T1AA 4FJ8A 2BGGA 3VA0A 4CGJA 4FJIA 2Z1IA 1RT4A 3P83D 4E19A 4RW6A 3AVKA 3AO2A 4W5RA 3MEEA 4KREA 2P5OA 1C0TA 4HUFA 3HPOA 1FK9A 4KV8A 1S1UA 1WSEA 1X9MA 1ITGA 3I0RA 4DG1A 4IFVA 2KFNA 2ITGA 3NF8A 2HMIA 2YHAA 3SYZA 1QNAA 3AVAA 3KLIA 1NH2A 3V9SA 3SQ2A 4DMNA 4FZZA 3M8RA 1VSIA 1E42A 2RPIA 4M3UA 1U45A 1QTPA 3DRSA 3VQ8A 2F8TA 1TVRA 4E7HA 1UOCA 3C94A 4KKOA 4W5NA 2DFHA 4EZ9A 1YTAA 3EYZA 1VTLE 1B9FA 2GBZA 2KQ2A 3M8QA 4FJKA 1QN5A 1DTTA 1J54A 3OYHA 3QIPA 4W5QA 3M8PA 4DU3A 1BCOA 3QNOA 4DFPA 4FXDA 3ISNC 1D3UA 3NBPA 4ICLA 3SV3A 2MJ7A 2G30A 4RW7A 2NUBA 3AO3A 4ID1A 3VQ4A 2E6LA 4B8AB 3K57A 4AILC 2OZSA 4FJXA 2OPQA 1NOZA 3AVBA 3PX6A 3QEWA 4M42A 1RTJA 4M3WA 4DS5A 3P5JA 3AVGA 4DLGA 3C6TA 4O0JA 3DM2A 3ZSOA 4OVLA 3AVFA 2HNDA 3MEDA 2IOCA 1KVBA 4OKJA 1NJYA 3L2VA 5FRMA 2VG5A 3V4IA 3EIKA 4NCBA 2DY4A 1NK6A 4FLXA 5CY4A 4N41A 2XRIA 3C6UA 4OKKA 4CJKA 1BHLA 3K5NA 4CHOA 4M3XA 4Z0UA 4KHWA 3OYMA 4JLHA 4FJ5A 4CK3A 3OYIA 4FJ9A 1RDBA 1C1AA 3HP9A 1ZBHA 1WSIA 4G1QA 2ETJA 1UWBA 3KIOA 3MECA 4B3OA 1KVCA 1Q8IA 3I0SA 3O4QA 3AVMA 1TK8A 4M3ZA 3ASMA 3ALYA 3LP0A 3LP1A 3NF6A 4EP5A 4DTMA 3HT3A 1QN3A 2HHWA 3LZIA 2Q3SA 3SI6A 4DSKA 4FLVA 1TAUA 1JLQA 2PYJA 4M3YA 4KO0A 3U3GA 3ULDA 3F73A 1CLQA 3SPYA 3PO5A 4B9NA 5C24A 4E1MA 2A1SA 1UAXA 4NCGA 2VG6A 4BE1A 2XY8A 4C8KA 1LW2A 1RT2A 3PX4A 1JXBA 2F96A 1WNSA 3DMJA 3RRGA 3O4NA 3K5LA 1KVAA 4YNQA 1RBRA 2VG7A 1XHZA 4LY7A 3V1QA 4E7IA 3SUOA 2IAJA 3KKSA 4LD0A 4B9MA 4C8MA 4FLZA 4DU1A 3AO1A 3V6DA 3CG7A 4B9SA 2KW4A 3QEXA 2O4IA 1DTQA 4EZ6A 3VN5A 1QTMA 4NCAA 3NDKA 3OYBA 1U4BA 4BACA 4KTQA 1TL1A 4CEDA 1QTSA 4FW2A 4CF2A 2G8IA 1NVPA 4HHTA 1RDDA 1Q9YA 4E7LA 2ZD1A 1KLNA 4C8LA 4PA1A 4RW9A 1XWLA 4FJLA 1VSDA 4I7FA 1J9AA 4DSLA 4H4MA 1L5UA 1XC9A 1GOCA 3LALA 2BANA 2X6NA 4AHRA 5J2QA 4Q0BA 2D0CA 1C6VA 4MFBA 3T3FA 4CF8A 1RTDA 3ZT3A 4CEZA 3K59A 4IFYA 4CF0A 2G8FA 1FKPA 3WNGA 1QS4A 3AVNA 1IKWA 3TAPA 4CK1A 4PQUA 4HCBA 1KYFA 1Y97A 4FK4A 3VQ6A 2DFFA 1HJRA 1NK0A 2R7YA 1C0UA 4M3RA 4CEOA 1TK0A 2QKKA 2X6SA 4E7KA 4FK2A 3HS8A 3QLHA 1QSLA 1B9DA 4CEQA 1C1BA 1ASWA 1JLAA 4BDYA 3PUFA 1TBAB 3HYFA 3ZSWA 3U6FA 3S9HA 1S1TA 2BE2A 5K14A 2KFZA 4CEEA 4C8OA 4ELVA 5HP1A 4PWDA 1DLOA 1JL2A 3H08A 4RG8A
chains in the Genus database with same CATH superfamily
4DV3K 2NLVA 1A5XA 2Z0FA 4GNIA 1C9BB 4A59A 3ZSZA 5AQMA 1QQOA 4X65K 1RFQA 4CIGA 1NJXA 1HLUA 4EJYA 4X66K 4OPKA 3CYMA 4JN4A 1YJNN 4BRMA 3C6HA 2FBXA 2NRTA 4WQ5C 4O8KA 1QZ5A 4IZ9A 5KGWA 2HSTA 5GAGP 3O1WA 1DEJA 1SKRA 1CXUA 1NGCA 4M3TA 3BP8A 3CJ1A 4WZSD 1QQCA 3RRHA 4DF8A 2Q0UA 4Z4EA 3L3VA 3C65A 2LSNA 1RT5A 3SZ2A 4KHSA 3AGKA 5AZJB 4OJRA 2QXLA 2KTQA 2XY5A 1IKXA 2IS3A 1TL3A 3GG4A 3VQ9A 3CJCA 2RKIA 3SUQA 3ZSXA 2WONA 2IIRA 4IKFA 3VQEA 4EAGA 1S5JA 4HVJA 5E41A 3TARA 1Q86O 3H1ZA 4CJEA 3OYAA 2FSKA 1JXEA 1JLCA 3I8DA 4PKIA 5C12A 2QK9A 2IV8A 5KGXA 1UL7A 5AFUH 1LXTA 4AQYK 1EETA 5AQLA 3OS1A 1NOYA 1NM1A 1Q82O 1KY6A 4A5BA 1HNWK 3RR8A 1MWMA 1UA0A 1WJWA 1FN7A 3FR0A 4FWKA 3CQXA 2OZMA 4D7RA 3BF1A 3HPHA 4A5AA 5E26A 3D7QA 4HWIA 4CJWA 4FJ7A 4DFJA 4DR1K 1BCMA 3EKSA 4DQQA 2OOXA 3OH9A 2O8DB 1N34K 4E89A 1TAQA 3SPZA 1VOLB 4Y1DA 2JHJA 3VGKA 4IXCA 5HROA 4CHQA 1NGGA 3DLGA 1VSHA 3T1HK 1JLFA 1X9JA 4GMJB 4XH1A 5M1NA 2ZGYA 4CEAA 3ULEA 1BA1A 3MXIA 3VTHA 2YNIA 3E9LA 3DOKA 4WCEL 4N56A 4BE0A 2P5GA 1TUUA 1CXQA 3GDQA 1OVQA 1WN7A 3IUCA 4J2BA 3MK6A 1SL0A 1N36K 3UE5A 4CF9A 4DB3A 3CD6N 4FWMA 1HPZA 4KHNA 5LL6Z 2GEMA 2ASMA 1LV5A 5KRTA 2PWWA 1U2VA 4BRLA 2Z1HA 3VF2A 4CESA 1QHAA 1EXQA 4N47A 3EN9A 1S3XA 5BR8K 4DF4A 4E0DA 4KRFA 5FLXO 3HVTA 4CF1A 1C0GA 5BMPA 3HJFA 2ATQA 2CGJA 3QBXA 1HRHA 1S1XA 1ZYQA 3TAEA 2OANA 3ENBA 4H5TA 4DUYK 2YX6A 5EOYA 1KSPA 2YJEA 4CEBA 1KQSM 3J7ZO 3FZMA 1WAJA 4OPHA 4PY5A 1CZAN 3ZX2A 4KFBA 4KHYA 1FW6A 2B4JA 3KK2A 2I7PA 3VQBA 3BKQX 4CGIA 1GOAA 4YOXA 1GLCG 1M1KO 2HHQA 3G25A 4DR7K 3TAQA 3R9PA 1N6QA 4GV6A 4DV0K 3NGZA 4CECA 1QSSA 4Y1CA 3CWTA 1R0AA 4CIFA 1KTQA 3VEYA 2HL9A 1K8KA 3SNSA 1VSFA 4BG8A 5D3GA 1RBTA 4BC5A 1BU6O 5KL0A 3A8YA 3NF7A 4K8ZA 1VHXA 3H3OB 1MP9A 3SQ0A 4CFDA 2ZJPL 1K9MO 4BRGA 2Y1IA 1VKLA 3LDSA 1YQRA 4CHYA 1YIJN 2F7TA 2HL8A 4CCHA 2PZSA 4OLBA 4BJUA 1RBUA 2FXUA 4LFBK 1BIUA 1D8YA 2G8KA 4FO0A 2AP1A 3VA3A 4I8OA 1ZBUA 4CZMA 1BIZA 3ENCA 3P39A 2QW9A 3AO5A 4J2EA 1VQLN 3OVNA 3V9WA 4O55A 1KRPA 4BRPA 1SAZA 1N3AA 3CJ9A 3C95A 2HHUA 3E9OA 2EX3A 3K2PA 5HL7L 2YHXA 3UB5A 3OYDA 3VETA 3TABA 1Z05A 4Y0WA 4DV2K 2IC3A 4YFUA 4JI5K 5T7BA 2E1ZA 4JKHA 4B1UB 1KFSA 2VGMA 1SV5A 4DTXA 5AQIA 4CE9A 1ASUA 1YXQA 3LDOA 1BI4A 3OYFA 4CEFA 3DLBA 1D5AA 4ZHRA 3U8XA 4F9OA 4AM6A 3VEXA 3MCAB 2ZFDB 1RTIA 1Z26A 1NKBA 3OSTA 4CGDA 2YI1A 1Q81O 5TKWA 3MWPA 4IFEA 2E4LA 2YJFA 2YV0X 3CI5A 2Q31A 2Y8LA 1VSKA 3MX5A 2P9NA 1VAZA 2O4GA 1SQKA 3JSMA 1NK8A 3P31A 5AQUA 2P9IB 4BDZA 3SJJA 5AQSA 3DLRA 3ZSYA 3AVLA 3QNNA 4IL8A 1NWKA 3THVA 2YKMA 1PVSA 1P90A 3QFPA 1JL1A 2YHBA 2HBJA 5ADXA 2AJQA 1RNHA 4JHDA 1M3HA 2E88A 3NHGA 1KAXA 4X64K 4BWMA 4BRQA 4B9VA 4MQ3A 3Q7CA 3DLKA 2VCPA 1BQNA 1W9HA 2HB5A 3WXIA 4CJPA 3HM8A 3HPGA 1WQAA 2JHNA 1C4GA 3RPJA 3A2FA 3TI0A 3KRMA 3NCIA 4NLBA 4LF7K 1JCFA 1TKXA 3PX0A 3BEXA 4FJGA 4DV4K 1YTUA 4DSJA 4GV9A 2YH5A 4I2PA 4JK7A 4B08A 3RTVA 1Q9UA 3VGLA 3SCXA 3CF5L 3CFPA 4QAGA 1T05A 4BROA 3D4VA 4CIEA 2IGIA 4OO1J 2KHOA 5HBMA 1XMQK 4L8RB 5CYMA 5I9EB 1GLBG 3LPUA 3T1AA 3L6QA 4FJIA 4FJ8A 5AZIB 4XH5A 1RT4A 4E19A 1HNZK 4RW6A 3AVKA 3WXKA 3MCPA 5AQHA 1XSZA 3I0RA 3MN9A 3F10A 4ISGA 1TYQB 1YQLA 3NF8A 2HMIA 5EXWA 3AVAA 4FZZA 3W3DA 1TVRA 4E7HA 1EWRA 2PAVA 1NG9A 3MX2A 3EYZA 1VTLE 2GBZA 4FJKA 1IJJA 3M8PA 3L0QA 3G4SN 3J7AP 4ICLA 3SV3A 2P9LA 2G30A 4RW7A 3VQ4A 4B8AB 2OZSA 2E6LA 1ZC6A 3K57A 2OPQA 3P4IA 3JAMO 4M42A 3O9SA 3CERA 3C6TA 3ZSOA 3CCUN 5H1SQ 2VG5A 3V4IA 4NCBA 2DY4A 4A2AA 5GAEP 4CJKA 3K5NA 4Z0UA 1ZBHA 1RDBA 1C1AA 4G1QA 4B3OA 4LF9K 3I0SA 1TK8A 3AVMA 3ASMA 1YITN 2FF3B 2HBMA 2IVPA 1LWWA 3WQUA 4BR4A 3HT3A 3P38A 3LZIA 2PYJA 1NLVA 4JV5K 4RCHA 4YOUA 3ULDA 4LF6K 1CLQA 3SLCA 5LJWA 1VQKN 3PO5A 4B9NA 5C24A 4E1MA 4NCGA 3ATVA 3PX4A 1JXBA 1WNSA 3DMJA 3RVCA 1KVAA 1VQ5N 3O9TA 4LF5K 4E7IA 4DU1A 3AO1A 4FWRA 3CG7A 1VQ8N 2IVNA 3QEXA 5AQFA 3VN5A 1QTMA 4NCAA 1EBMA 2Q2RA 4JK8A 2QREA 3CWSA 1KLNA 4RW9A 1XWLA 1IBMK 1VSDA 2RE2A 1GOCA 2BANA 4K43A 2P9SB 1C6VA 4A61A 1NGAA 1QQNA 1RTDA 2HZSA 4CF0A 2NLXA 4HCBA 1NJIO 2A3ZA 1HJRA 1C0UA 4BR9A 5MLCQ 2X6SA 4E7KA 4FK2A 1B9DA 4CEQA 1C1BA 3HOSA 3ZEUA 5JLFA 3LDQA 4BDYA 2KFZA 3HYFA 4BRHA 3OA9A 2A5XA 4IEEA 5CR4A 2YHWA 4RG8A 3QIOA 1NKEA 2HVIA 4M45A 3ZETB 2B6AA 3KK3A 3VEZA 2UUAK 3ZCMA 5M1FA 4CBXA 1HR0K 3RWUA 3OYLA 3DXMA 1UT7A 2Z1GA 2E2OA 2NOIA 1QE1A 3VF4A 2Y8QA 1NGBA 4EAKA 1BISA 5JLHA 1HYZA 2NRXA 2P1JA 1RTHA 1I3AA 2GELA 3CCVN 2FKFA 3IS9A 4HTLA 3H46O 4KB0A 3EE9A 3WQTA 1QN9A 4BRNA 4MDAA 1YHQN 3RSMA 3NMUA 1KAYA 3KLGA 1C0MA 4DLEA 3ZT4A 4ISEA 4M7XA 3L4IA 1FKOA 2J4RA 4BQLA 4JKAA 4H4OA 1LCUA 3S41A 4LFAK 1IBLK 1LWFA 3MXMA 3DWLA 4FLTA 5AQYA 1IKYA 3K58A 5CE3A 5E84A 4GV3A 3CMEN 4DSIA 3SAHA 4LH5A 1IG9A 3H6EA 2HF4A 4FVUA 2HHSA 3K5MA 3OC3C 3AA3A 3OCIA 4HTUA 1TV6A 4L3QA 3CM6A 4A57A 2QRCA 3CMAN 2OTLN 1RT3A 3WT0A 4I6MA 3THXA 2EHGA 3VESA 4K8XA 3LDPA 1BL3A 3P1GA 1D9FA 4KI6A 4NO7A 5JMVD 3IAYA 3PDKA 1YF5L 2YNFA 5IWAK 1LWCA 4QCLA 3SV4A 5GINA 3S3NA 3R6MA 4BC3A 1YTBA 4FL9A 4W5OA 3MWTA 1YT3A 1T8EA 3OYEA 3L8BA 3M6GA 3EL2A 3CXCM 4DKWA 3IMXA 2GWKA 2YNGA 4H0XB 4ILGB 4DWIA 3MAQA 2D0BA 1S6PA 5GIPA 4NYNA 4Q5VA 2WFBA 1VSMA 4DTPA 3JXUA 3NE6A 4KPYA 4B9UA 2VYPA 4PKHA 4IDHA 3B6OA 4CGGA 4DQPA 2D0AA 5AQPA 1WB9A 1RBSA 2V51B 4WQ5A 4MO4A 3OYKA 1J53A 3DRPA 3VQ7A 1JKHA 3LZJA 5M1PA 4CJUA 4GKJK 1MDUB 3PLAA 1QNBA 4FVMA 3AVHA 3KD1E 3ID6A 4Z4IA 3LP2A 2NOZA 2QM1A 2ITMA 3TTCA 1TGHA 4CBUA 2YHYA 1VK0A 4GVEA 3QEVA 5F0XA 2Z8UA 1HQUA 4JKEA 2O8CA 2VGNA 2QRDA 4YHHK 4FYDA 1YVUA 2CH5A 3CC4N 1OH8A 3W0LA 2HKPA 5BPLA 4DSEA 4LSLA 2KKZA 3GE1A 4B1WB 4DR6K 4OGEA 4IJAA 4IO9L 3I0XA 2YKNA 1RILA 4BQZA 1VQ4N 3TAMA 1S6QA 1FXXA 4BWJA 1K73O 4H0PA 2PY5A 3OBWA 3OYNA 4MDBA 3KLHA 4ROEB 2G8HA 1T6AA 1SZ2A 1NBWA 4QS9A 3ENHA 5HRPA 5JVGL 3L2RA 1U6ZA 4IWVA 2CGKA 1O1WA 1YI2N 5FPEA 3DAWA 2I5WA 3WEEA 1WAFA 1CZ9A 4JS5A 4CHPA 3HK2A 3M8SA 2VQFK 4DFMA 1SKWA 4D7QA 4TSXA 3TR8A 3TSPA 1G99A 1U04A 3CW7A 5BMNA 2XHBA 1YTFA 5FPNA 3NH0A 1RDCA 4M41A 1YJ9N 3LP3A 1JLBA 3KKRA 3S3MA 1LOTB 4WYBA 4I9LA 5AQQA 3RMBA 3UIQA 2P9PA 3TTFA 1VQON 3PY8A 4FJMA 5J1EA 2FSJA 3SNNA 3E01A 1RDAA 4K0KK 3ZX3A 5DM6L 4E1NA 4BDPA 2W6LA 2UUCK 1NU0A 1Y64A 1LWEA 4FSVA 2BTFA 1H1VA 4JKBA 3ZSQA 2CGLA 3GBTA 2YNHA 3OW2M 1WBBA 4OPAA 3WXLA 5HLFA 1TKTA 1KO9A 2NRZA 3SQ1A 3OYJA 1QN8A 1VQPN 3NVKA 1NJZA 2XY7A 1QN6A 1CZBA 1L3UA 3O9UA 4X62K 2I7NA 1EX4A 4BGAA 4BR2A 1GLJO 3O80A 4BRFA 3QMLA 4CFCA 1WOQA 1KFIA 5CYQA 4RW4A 2VWJA 3L4QA 4E3SA 3KLFA 4ELTA 2DPNA 3QEIA 3UKRB 1L3TA 4QOZB 1SKSA 3AA4A 4KB1A 2WBNA 4M7YA 5AJ3K 4JKGB 2G8UA 4CJQA 2QA4N 3AAPA 3UKUB 1TGOA 3MN7A 3ENOC 2HHVA 3DXKB 3IH7A 1CDWA 1REVA 3QESA 2V7ZA 1Q7YO 4KTWA 4F8RA 2VWKA 1BGXT 5KPTA 3NH1A 4KH4A 3PSFA 4CZLA 4WFNL 2O8EB 2E5LK 4HJHA 3K9JA 2H4LX 2UXBK 4JS4A 3CC7N 1X3MA 4QS8A 3Q7BA 5KQDA 4CI6A 1T6DA 1WSGA 2E2PA 2NZTA 4CJVA 2E6MA 4CZJA 2O8BA 3IDHA 1E3MA 3SBTA 5AQJA 1QN7A 2O8FB 4DFKA 1N39A 5C42A 4DV6K 1J5OA 3LM9A 3D2EB 2A41A 3KWIA 2PYLA 4O0IA 4H0TB 4RODB 5HSHA 3MEGA 2R5XA 2BGGA 4CGJA 3AO2A 3SK3A 4B3SK 2QWRA 1FK9A 1S1UA 3D6RA 1ITGA 2KFNA 1QNAA 1NH2A 3THYA 2P9KA 3M8RA 1VSIA 1E42A 2RPIA 1U45A 3DRSA 2MZ8A 4W5NA 4KKOA 2KLAA 4EZ9A 2V7YA 3M8QA 3CETA 4DU3A 1IBKK 1J54A 3OYHA 1BCOA 1T6CA 2P9UB 3U4LA 1P5DX 4ID1A 4FJXA 4N76A 1T3VA 3MN6A 3AVBA 3EAYA 4DS5A 4CVNE 4BR0A 3J7YP 3CJBA 2FLOA 1RDUA 1E4GT 2NRWA 3C6UA 5BN9A 4JLHA 3HP9A 4U7BA 2ETJA 1WUAA 1RDWX 3VPZA 4FWOA 4C1NK 3BF3A 1ESVA 3THWB 5GAHP 4EP5A 4CW7B 4M3YA 3U3GA 3F73A 1HNXK 2ASOA 1LWVA 2A1SA 4DUZK 2VG6A 4AF1A 2XY8A 1PCMX 4BVPA 3RRGA 1RBRA 3SAGA 1RGIA 3OBYA 4FLZA 2KW4A 2NOEA 1DTQA 4KTQA 1TL1A 2ZGZA 3GOIA 5GADP 4HHTA 2NOHA 1Q9YA 2JWLA 4JKFA 4E7LA 5C15A 4PA1A 4JI6K 4FJLA 2WC9A 4I7FA 4DSLA 3WXJA 4H4MA 3LALA 3ATUA 3OSMA 4YOVA 3T3FA 2FF6A 4JI7K 4CEZA 4JI2K 1HKGA 1OH7A 4MRQA 5CHIA 1KYFA 1GLEG 3VERA 4FK4A 1NK0A 4DR2K 3LDLA 4CEOA 1TK0A 1EO1A 5AQOA 2QKKA 4EJZA 3PIPL 3HS8A 3BZKA 1QSLA 5FPDA 1V5SA 3U6FA 3PUFA 1TBAB 1S1TA 2BE2A 4ELVA 1W2BM 3C7NA 1JL2A 3L2VA 3K5OA 3LWLA 3VQCA 3OS2A 5BRDA 1W0HA 4WQ4C 3EY1A 3V81A 3G0ZA 3DJCA 1W97L 4JD2A 4EP4A 4H5NA 3ULXA 1VQ9N 2NOFA 3A5MC 5AQNA 4QG5A 4CZEA 3VEVA 3O8MA 3GL1A 1QVGM 3CCRN 2JOIA 3ULEB 5C25A 4K25A 3VQ5A 2FKMX 2FBTA 1NGFA 4KAZA 4FZXC 4K42A 5BRFA 4CFAA 2IV9A 5IYDP 3QETA 1U47A 4FWQA 3RMCA 1N5YA 1HYVA 1OVYA 3AV9A 1M3QA 1HKCA 4B0AA 1BWFO 3DYAA 3CCEN 4NYFA 1U2VB 4KHQA 3HTVA 5LMUK 3WNEA 3R8EA 1RT7A 4IOXA 1N3CA 4O5BA 4CJLA 3QERA 3D2FA 2RHKA 1VSEA 3QINA 4JK9A 4ID5A 3AA2A 1A5VA 3MXJA 4CK2A 1R4XA 1Q18A 1TUYA 5KTQA 3RSEA 1N32K 3DOLA 4JNEA 4AHUA 1ATNA 3OSEA 3BGRA 1IH7A 3SUNA 1YQKA 4C23A 1RT6A 4CJ5A 2Q36A 3KLEA 4AH9A 5FDLA 4FM0A 5J2NA 1RT1A 5EU7A 1ATSA 3FGUA 4B1VA 3I0WA 3CCJN 3TSQA 4CJSA 4BRIA 1I39A 3I56N 3JS6A 2G8VA 4FCYA 2OPRA 5I3UA 3KTUA 4DULA 1WSFA 5LJVA 5DK5A 3J80O 3PO4A 2QEXN 5AZJA 3LL3A 3ZT1A 4O44A 3OJSA 5BR9A 4XEIA 3V9UA 3EZ5A 4MLHA 1U48A 1VSJA 3VQQA 3T69A 1K8KB 3FFKB 3KK1A 2ZE2A 4J2DA 2WUSA 4HUGA 3RR7A 1PZDA 1YQMA 1SL1A 1BQMA 3HZ6A 2VQEK 4EAIA 1W7AA 1T7PA 4NLCA 1LW0A 3PV8A 4B3TK 3NH2A 1V4TA 1TKDA 1P5GX 3HS9A 3QB0A 2D5RA 4DTRA 1KY7A 2V8QA 1EQYA 3QBWA 2OPSA 1R59O 2WTUA 3G71N 2DKDA 3H1VX 4OPJA 2F7LA 2O3OA 4GY2B 2X74A 4CFFA 4KI4A 5IYCP 2RN2A 3ZSVA 4BREA 3EEQA 1X9WA 3AARA 2O8DA 1S1VA 1U49A 4C8NA 3CWUA 1HUXA 3HM9A 1NGHA 4LFCK 3QFUA 3FZKA 4DV1K 4CFBA 4DR3K 1BA0A 3E1YA 3WNHA 1LAWA 5LY3A 1OH5A 2A42A 3NFAA 2VJ0A 3EO3A 3H45C 3G10A 5F1XA 3CJAA 1ASVA 3ZT0A 2Z1JA 5BPMA 2QKBA 3O08A 3F2KA 1NGIA 2GUIA 1BI4B 2A40A 1VSLA 4IDKA 1IV0A 2FUVA 4DR5K 2W6KA 2OTJN 2LAEA 2OPPA 4DTSA 1NK5A 3FFIA 4FLYA 2ZWHA 1IKVA 4WFBL 2KZMA 5J2PA 5CZ2A 3NF9A 2F9WA 5EY4A 2P9NB 1VTOA 1KC8O 3O3FA 3O3HA 5AQZA 2UUBK 3R3LA 4QS7A 4YORA 2XY6A 3O9QA 1OH6A 4BE2A 2ZJQL 3CFOA 3B6PA 4JI4K 2DFEA 4O4GA 3U9ZA 4ZTJA 1GOBA 4DS4A 2A1RA 4CHZA 1ZBLA 3IFRA 4RTFD 4IBNA 1KYUA 1BUPA 4JHDB 4DV5K 3KD5E 3DRRA 4DTJA 3PIOL 1TK5A 5AQXA 4F4KA 4C7PA 2FBVA 1UT4A 3HL8A 1S22A 5HRNA 3A5NC 4B1XB 2ZJRL 3TWHA 3HBTA 4B9TA 2FC0A 3QICA 4PL8A 4B8CA 3IG1A 5KPZA 3A5LC 3N89A 4FJNA 4EAJA 2QLVA 3KJVA 2G8WA 2H5AX 3HP6A 4PUOA 3T19A 4KBOA 3NGYA 2JGUA 4CGHA 5IT9O 3V1OA 3T4NA 3OH6A 4H03B 5F2RA 3JYTA 3BDPA 1KFQA 4XIUA 3OYCA 4LF4K 2F4VK 3RMAA 3NVMA 1VQ6N 2NRRA 2W42A 3DPUA 2HNYA 1SL2A 4HCCA 1SS6A 2FBYA 3OHRA 3R1XA 5IYBP 4WF9L 1UA1A 4O8UA 1NK7A 5AQGA 4BY9C 2HHTA 5KPRA 3OLPA 1QHTA 1ZBIA 3VENA 5AQVA 3ZYYX 3CQ8A 1I94K 1MU2A 3HSTB 3TSUA 3K0SA 1RM1A 4ILJA 1EKEA 1KCFA 2ZQBA 4UQGA 2P9LB 2E1YA 1WBDA 4IJNA 4FJHA 1XMOK 4NXMK 1XQSC 4FZYA 3NAEA 2PFUA 4ISFA 4F3TA 5JS1A 3CHWA 4GVMA 4WX8A 1WLJA 4Z4GA 4FWPA 4B3RK 4DTUA 1E4FT 4FLUA 5KQ8A 4BVOA 1VQMN 4TPSA 4OGCA 3VF6A 4LF8K 4H8KA 1T03A 5DM7L 5JVHL 3A5OC 3KHYA 5M1QA 1KLMA 4I9QA 2WOMA 1XUPO 4DR4K 3SMPA 3CWAA 2P9IA 4IOCL 2Z1IA 3P83D 4CZGA 3MEEA 1JCGA 2NOLA 4FWNA 2P5OA 3HPOA 4KV8A 4PKGA 1GLAG 1WSEA 4WFAL 1XNRK 2W41A 4FOEA 3SYZA 3KLIA 4JAXA 1PCJX 1EUVA 3PSIA 3TTDA 4BG9A 3VQ8A 3CCLN 1HPMA 1UOCA 3LDNA 2DFHA 3CJ7A 1YTAA 4BRAA 4YDUC 1N8RO 2HMPA 3QIPA 4W5QA 3QNOA 3F0ZA 4FXDA 4E1JA 4PHTX 2NNWA 4EHUA 2MJ7A 4EAHD 1DIZA 4RWTA 2PBDA 5AQTA 3ZLJA 1NOZA 2HOEA 1RTJA 4M3WA 1YVNA 3P5JA 3AVGA 4FWSA 3AVFA 3MEDA 1DT9A 4OVLA 4EIAA 2IOCA 1KVBA 1ZBSA 3EIKA 4KHPK 4FLXA 2W40A 4PL7A 1BHLA 3AGRA 4CHOA 3OYMA 3CCSN 4FJ9A 3TDHA 1WSIA 4BR5A 4EFHA 1UWBA 3FZHA 1C0FA 3MECA 3BZCA 4M3ZA 3O4QA 3ZEUB 3LP0A 3OTOK 3ENOA 3O4WA 1QN3A 2GWJA 2HHWA 2Q3SA 3SI6A 4FLVA 4KO0A 2JWKA 3SPYA 5AZIA 5AQKA 2UU9K 1KD1O 1NGJA 4B1YB 4C8KA 1LW2A 2NRVA 4JEPA 1YUWA 2F96A 2ZM6K 1TYQA 4MO5A 3K5LA 4YNQA 3DXMB 2VG7A 3G6EN 1XHZA 3V1QA 3SUOA 3KK7A 4LD0A 2HBKA 4B9MA 3V6DA 2O4IA 2FSNA 4EZ6A 2HBLA 1EWQA 1KXPA 3PMGA 3ZX0A 3WUHA 1BOTO 1HU0A 4CEDA 4DV7K 1QTSA 1NVPA 2UXCK 2ZD1A 4H0VB 3VEWA 1J9AA 1L5UA 5C2DA 4Q0BA 2X6NA 4AHRA 5J2QA 2XHIA 2D0CA 2BH1A 5ELZA 4MFBA 4BC4A 4CF8A 3K59A 3TPQA 1FKPA 2D0OA 2FGTA 2V92A 1QS4A 2HF3A 3AVNA 4CK1A 5JICA 3TAPA 3CC2N 4BC2A 1Y97A 3O5BA 1HJOA 4M3RA 4UY8O 1QZ6A 1J6ZA 5LMNK 3HI0A 5K14A 4FPAA 3KZBA 1J5EK 2BUPA 3L3UA 5JS2A 2YA3A 4I6MB 3LANA 3THXB 3A0IX 1TBPA 2RF2A 3SQ4A 4ELUA 1NK4A 1TKZA 4JRPA 3AVCA 4CHNA 1RBVA 3V9ZA 1WSHA 3S3OA 3LAKA 5I42A 3CCQN 4KHUA 2HHXA 3L2WA 3EE8A 3HOTA 2VWBA 3VQPA 3M5RA 2BDPA 3HVRA 2JPIA 3I8BA 5AQRA 4AHVA 2HHHK 4EALA 1JLEA 4DQSA 4O5FA 4IOAL 2Q97A 3AAQA 1VOKA 4H5VA 5B8HA 2P9SA 3TU5A 4JRQA 1LAVA 2D4WA 3E66A 3V1RA 3OY9A 2QWMA 1M90O 2GV9A 1JJ2M 1EP4A 2HVHA 4FPBA 4NB4A 4FOIA 4J8FA 3OS0A 2GX9A 3I3WA 4FJJA 4YOWA 4CJRA 4ILHA 3ZSRA 5BPNA 1NMDA 4OKEA 3T1YK 4AM7A 1NJWA 5KI6A 3CM5A 4U67L 3SBGA 5M1OA 2Y1JA 1B9KA 1ZXOA 4WE1A 2NRHA 1JCEA 2QI2A 3HO1A 4A62A 4H5RA 3ZETA 1N33K 1XHXA 5C10A 3FZFA 5DMRA 1ZBFA 4BGBA 2O8CB 3O9RA 3C04A 3V9XA 4JI1K 1B92A 1T44A 3AVIA 4XH4A 5J2MA 3MN5A 3VGMA 3TAFA 5TKYA 5HRSA 3VEOA 3MMVA 1IG8A 1XNQK 4BRDA 5CZ1A 1NK9A 4H0YB 3WXMB 4J2AA 4I2QA 4CJ4A 4G9ZA 3MDQA 3OJUA 4ZTFA 2YCHA 1Z6RA 4BR7A 4F2SA 2H3GX 1NGMA 2OA8A 4WQ4A 4F2RA 5BRHA 2B5JA 1S9EA 3F9MA 5HRRA 3CFRA 3ITHA 2F9TA 3SAFA 3OYGA 2XO7A 3CIPA 4N5SA 3WEEB 4CBWA 2HZMA 4DQ8A 1NGEA 3O6WA 3ID8A 4M63C 3O3GA 1S72N 2F8SA 1X9SA 4OX9K 2OCEA 4YY3K 4IG3A 5F9CA 4EHTA 1ILYA 1YAGA 4CJTA 3HSCA 3H1QA 1NMNA 1JFIC 2NWVA 5M1KA 3DLEA 5SZTA 3M1FA 4CJFA 1QN4A 2P9PB 1HYSA 1S1WA 2D0PA 4LSNA 2GTDA 3IKMA 4DTOA 1J3MA 4WXAA 1HKBA 3AA5X 3J8AA 4DCHA 4HUEA 3CVTA 3N4PA 1HQEA 1ATRA 4MLEA 2OOYA 1HMVA 1K6YA 4OLAA 3VTIA 3TAGA 4CGFA 4F3OA 3D45A 4AHSA 3B8AX 1L3SA 4LC9B 4W5TA 5FRNA 3BY5A 4A2BA 1M5Q1 2ZF5O 3KWGA 4YOTA 3IRXA 1VQNN 3CPEA 2E8AA 3LWMA 4KH6A 1QNCA 5FROA 4JI8K 4FK0A 3AO4A 4DTNA 1SUQA 4R5PA 2D1KA 4IG0A 1YJWN 1GLLO 2NOBA 2KZZA 5C0YA 3DLLL 3NA5A 2Q1NA 2X78A 2DKAA 3ZT2A 4KTZA 4Z4CA 2ASPA 2E2QA 1L3VA 3EKUA 4CJ7A 3U9DA 1QVFM 4DU4A 5JN5A 3DPTA 1HNIA 3VQDA 4Z4HA 3K9KA 3KVGA 3L2QA 2IDOA 1WSJA 1X1PA 4B1ZA 1D4XA 3QEPA 3CVSA 3EZWA 4DQIA 3F9KA 1F21A 2DKCA 5BREA 4YOYA 3QO9A 4LH4A 5SWMA 1FJGK 1OKJA 2P51A 3DI6A 4DHYA 3L2UA 3SMSA 1XI1A 4NXNK 4FM2A 1JDYA 4AHTA 3QDKA 2QWLA 2I5JA 4Q11A 4ROCB 2OYQA 5FPMA 3N4QA 2HNZA 3SJHA 3LAMA 2O8BB 1NKCA 4B9LA 1VRTA 1QNEA 4JI3K 4CERA 3CCMN 4E7JA 1MWKA 2UXDK 2QWOA 4FM1A 1A5WA 4FLWA 3SUPA 2QR1A 4JKCA 1PCZA 3FZLA 1Z25A 1S9GA 1LWYA 2QXFA 3U3YA 4Z4FA 1KFDA 4DQRA 1W80A 1RCHA 4K41A 1VRUA 5EVZA 4CZHA 4CD3A 3C6AA 3KTQA 4DSFA 1C1CA 5ADXH 4BRKA 2JLEA 5EPCA 3THYB 4GKKK 2P9KB 3DLHA 5GIOA 1TUOA 5AR0A 1QSYA 1P8ZA 2GUPA 4RW8A 3UW2A 4JI0K 3TANA 1D9DA 1IO2A 1V4SA 1KYDA 4IO8A 4B3MK 1X3NA 4FW1A 3VOVA 5AN4A 1HNVA 4GW6A 1O13A 3NGIA 4JKDA 4CJ3A 4CZIA 1G15A 1AISA 2DTUA 1JLGA 4B9QA 3AVJA 4CZFA 3HXMA 1MA9B 5BN8A 2HW3A 3LM2A 1Q9XA 5JMVA 3LPTA 5KRSA 3BUZB 3WNFA 2QWNA 3RMDA 3D0PA 1KAZA 3CPWM 4FWLA 1C47A 3VQAA 3OGDA 5EX5A 4CZKA 4AHCA 3C0BA 3VA0A 4H0OA 4W5RA 4V19S 4KREA 1C0TA 4HUFA 3AY9A 3UKRA 1X9MA 2IVOA 3T7ZA 4DG1A 4IFVA 2ITGA 2QWQA 2YHAA 3V9SA 3SQ2A 4DMNA 4JKGA 2EHBD 4M3UA 3UKUA 1QTPA 2F8TA 2QTDA 1BG3A 1DKGD 3C94A 1HX1A 3DXKA 1B9FA 2KQ2A 5AQWA 3FE1A 1QN5A 1DTTA 4DFPA 2AA4A 3ISNC 1D3UA 4IEIA 3NBPA 2O8EA 2NUBA 2Q0RA 3AO3A 4H5WA 2V9JA 4AILC 3PX6A 3VMFB 3QEWA 4DLGA 4O0JA 3DM2A 2HNDA 1K35A 1QQMA 4OKJA 1NJYA 5FRMA 1NNEA 5AFUA 1NK6A 5CY4A 4N41A 2XRIA 4OKKA 3E9PA 3J81O 4M3XA 4KHWA 4FJ5A 4CK3A 3OYIA 2O8FA 2A6AA 3KIOA 1KVCA 1Q8IA 3D2EA 2CH6A 3ALYA 3LP1A 3NF6A 1MPGA 4DTMA 3I33A 1GLFO 2UYTA 4DSKA 1TAUA 1JLQA 2QWPA 3C7NB 1NGDA 1UAXA 4BE1A 1RT2A 2NVMA 1GLDG 4JD2B 3F5TA 3O4NA 3O1BA 4CD1A 5A2QO 4LY7A 2IAJA 3CQYA 3KKSA 3D7EO 4C8MA 4B9SA 5HOOA 1DGKN 4C1NI 2EWSA 4Z94A 3OYBA 3NDKA 4BACA 1U4BA 2P9UA 4FW2A 4CF2A 2G8IA 1RDDA 4C8LA 3HRGA 1K2YX 1XC9A 2E2NA 3TE5A 5C2FA 3FLCO 3M3ZA 3H3NO 3ZT3A 4JYAK 2G8FA 4IFYA 3WNGA 2V52B 4PQUA 1IKWA 1XC3A 4KH5A 3VQ6A 2DFFA 3D2FB 2R7YA 3QLHA 1K8AO 1BO5O 1VQ7N 1ASWA 3THWA 1JLAA 3RSEB 3ZSWA 4R79A 3I55N 3S9HA 4YDUA 4CEEA 4C8OA 4BRCA 5HP1A 4PWDA 2E20A 1DLOA 3H08A 1BDGA
chains in the Genus database with same CATH topology
3K5OA 1A5XA 5JS2A 3VQCA 3QIOA 3OS2A 3LWLA 1NKEA 2HVIA 1C9BB 1W0HA 3LANA 4M45A 3ZSZA 3EY1A 3V81A 2B6AA 3G0ZA 1TBPA 2RF2A 3KK3A 3SQ4A 1NJXA 3ZCMA 4CIGA 4ELUA 4EP4A 1NK4A 3RWUA 1TKZA 4JRPA 3AVCA 4EJYA 4CHNA 3OYLA 3ULXA 4OPKA 3CYMA 1UT7A 2NOFA 1RBVA 2Z1GA 1WSHA 2NOIA 3V9ZA 3S3OA 2FBXA 1QE1A 3LAKA 5KGWA 5I42A 1BISA 1HYZA 1SKRA 1CXUA 2P1JA 1RTHA 4KHUA 2HHXA 3L2WA 4M3TA 2JOIA 1I3AA 4WZSD 1QQCA 3VQPA 3RRHA 4DF8A 4Z4EA 3L3VA 2BDPA 3HVRA 5C25A 3VQ5A 2LSNA 4AHVA 1RT5A 2FBTA 1JLEA 3SZ2A 4DQSA 4KAZA 4FZXC 4KHSA 3IS9A 4OJRA 4CFAA 2IV9A 5IYDP 1VOKA 3QETA 2XY5A 4KB0A 1U47A 2KTQA 1QN9A 1IKXA 3RMCA 2IS3A 1TL3A 1N5YA 1HYVA 3VQ9A 3KLGA 1C0MA 4JRQA 3AV9A 1LAVA 1M3QA 3V1RA 2RKIA 3ZT4A 3OY9A 4DLEA 3ZSXA 3SUQA 2WONA 4IKFA 3DYAA 4B0AA 2GV9A 3VQEA 1S5JA 4HVJA 1EP4A 1FKOA 5E41A 3TARA 3H1ZA 4H4OA 4NYFA 4CJEA 3OYAA 2HVHA 1LWFA 1JXEA 3MXMA 4KHQA 1JLCA 3I8DA 3WNEA 4FLTA 3OS0A 4CJLA 1RT7A 1IKYA 1N3CA 4O5BA 3QERA 3K58A 4FJJA 2QK9A 2IV8A 4CJRA 5KGXA 3ZSRA 1EETA 1VSEA 3QINA 3OS1A 4OKEA 4ID5A 1NOYA 1NJWA 1KY6A 3AA2A 1A5VA 3MXJA 4LH5A 1R4XA 3CM5A 5KI6A 4CK2A 5KTQA 1IG9A 3RR8A 3DOLA 2HHSA 1UA0A 4AHUA 3OC3C 1FN7A 3K5MA 3AA3A 3OCIA 4HTUA 1TV6A 1B9KA 2Y1JA 3BGRA 3CM6A 4WE1A 1IH7A 2OZMA 3SUNA 1RT3A 1YQKA 3HPHA 1RT6A 4CJ5A 3HO1A 4CJWA 4FJ7A 2EHGA 4DFJA 1BCMA 1XHXA 4K8XA 4DQQA 3KLEA 1D9FA 1BL3A 3P1GA 4AH9A 4E89A 4KI6A 1TAQA 5DMRA 1ZBFA 1VOLB 4Y1DA 5FDLA 4FM0A 5J2NA 3SPZA 1RT1A 5EU7A 5HROA 2YNFA 3I0WA 1LWCA 3V9XA 4QCLA 3SV4A 4CHQA 4CJSA 3S3NA 1B92A 1I39A 1VSHA 3AVIA 3DLGA 1YTBA 5J2MA 1JLFA 4GMJB 3TAFA 4W5OA 4FCYA 5HRSA 2G8VA 1YT3A 2OPRA 4CEAA 3KTUA 5I3UA 1T8EA 3OYEA 4N76A 3MXIA 4N56A 2YNIA 4BE0A 3DOKA 3L8BA 4DULA 1WSFA 2P5GA 1CXQA 3L3UA 5CZ1A 5DK5A 3PO4A 1NK9A 4J2AA 4I2QA 3ZT1A 4O44A 2YNGA 3OJSA 4CJ4A 3V9UA 3EZ5A 1U48A 1VSJA 3VQQA 3OJUA 4ZTFA 4J2BA 1WN7A 4DWIA 3MAQA 1SL0A 2D0BA 1S6PA 4NYNA 4CF9A 4F2SA 1NGMA 2OA8A 4Q5VA 1HPZA 1VSMA 4DTPA 4KHNA 3NE6A 3KK1A 2ZE2A 4B9UA 4J2DA 1LV5A 4F2RA 4HUGA 3RR7A 4KPYA 5KRTA 1PZDA 3B6OA 4CGGA 4DQPA 2B5JA 1S9EA 2D0AA 5HRRA 1YQMA 2Z1HA 3CFRA 3ITHA 1SL1A 1BQMA 1RBSA 3OYGA 1T7PA 4CESA 2XO7A 1LW0A 3OYKA 1J53A 4N5SA 3PV8A 3DRPA 3VQ7A 1JKHA 1EXQA 2HZMA 3NH2A 4N47A 3LZJA 1TKDA 3HS9A 4DF4A 2D5RA 4CJUA 4DTRA 4E0DA 4KRFA 1KY7A 3O3GA 2F8SA 2OPSA 1X9SA 1QNBA 4FVMA 3HVTA 4CF1A 3AVHA 3KD1E 4OPJA 3HJFA 2ATQA 4Z4IA 3LP2A 2NOZA 2O3OA 4IG3A 1HRHA 2X74A 4KI4A 1TGHA 5IYCP 1S1XA 2RN2A 3ZSVA 1X9WA 1ZYQA 1VK0A 3TAEA 4CJTA 3QEVA 2Z8UA 1JFIC 1KSPA 1HQUA 1S1VA 3DLEA 5SZTA 4C8NA 1U49A 4CJFA 4CEBA 3HM9A 1QN4A 1HYSA 1S1WA 4FYDA 1WAJA 4PY5A 1YVUA 4KFBA 4LSNA 4CFBA 4KHYA 2B4JA 3KK2A 3VQBA 4CGIA 4DTOA 1GOAA 3AA5X 3WNHA 1LAWA 4HUEA 4DSEA 4LSLA 1HQEA 1HMVA 1K6YA 4OLAA 2HHQA 3NFAA 2VJ0A 4OGEA 3G10A 4CGFA 3ZT0A 3I0XA 1ASVA 2YKNA 2Z1JA 3D45A 4AHSA 3TAGA 3TAQA 1RILA 4W5TA 1L3SA 1N6QA 5FRNA 3NGZA 2QKBA 4CECA 1QSSA 4F3OA 2GUIA 1BI4B 3TAMA 1S6QA 1FXXA 4Y1CA 1VSLA 4BWJA 2PY5A 4IDKA 3IRXA 1R0AA 4CIFA 3OYNA 3LWMA 1KTQA 3IAYA 1QNCA 2LAEA 2OPPA 3KLHA 3SNSA 4ROEB 1VSFA 5FROA 2G8HA 4DTSA 4FK0A 1RBTA 1NK5A 3AO4A 3FFIA 4FLYA 5D3GA 4DTNA 1IKVA 1SUQA 3NF7A 5J2PA 4K8ZA 2KZMA 5CZ2A 3NF9A 1MP9A 4IG0A 5HRPA 4R5PA 3L2RA 3SQ0A 4CFDA 1O1WA 2I5WA 1VTOA 2NOBA 1WAFA 2Y1IA 3LDSA 1YQRA 1CZ9A 4CHYA 3O3HA 3O3FA 4JS5A 4CHPA 3HK2A 3M8SA 2KZZA 2X78A 4CCHA 4DFMA 2XY6A 1SKWA 3ZT2A 4TSXA 4KTZA 3TR8A 4Z4CA 4BE2A 2PZSA 1L3VA 3CFOA 4OLBA 1U04A 1RBUA 3B6PA 2XHBA 1YTFA 1BIUA 3NH0A 1RDCA 1D8YA 2G8KA 2DFEA 4O4GA 3VA3A 4I8OA 1ZBUA 4M41A 3LP3A 1JLBA 3KKRA 3S3MA 1BIZA 1GOBA 4DS4A 4ZTJA 4DU4A 2A1RA 4CHZA 3DPTA 1ZBLA 3AO5A 1HNIA 3VQDA 4J2EA 4Z4HA 3OVNA 3V9WA 4O55A 3L2QA 4I9LA 1KRPA 3RMBA 2IDOA 3UIQA 4IBNA 1N3AA 1KYUA 1WSJA 3C95A 2HHUA 1X1PA 3PY8A 2EX3A 3K2PA 3QEPA 4FJMA 5J1EA 3OYDA 4DSIA 3TABA 3F9KA 3SNNA 1F21A 3DRRA 4DQIA 3KD5E 4DTJA 2IC3A 3E01A 3QO9A 4LH4A 4YFUA 1TK5A 5SWMA 5T7BA 2P51A 1RDAA 3DI6A 4F4KA 3L2UA 2FBVA 1XI1A 1KFSA 1UT4A 4FM2A 1SV5A 3HL8A 4DTXA 4E1NA 4BDPA 4AHTA 5HRNA 4CE9A 1ASUA 3TWHA 2I5JA 4Q11A 4ROCB 1BI4A 1LWEA 4CEFA 3OYFA 3DLBA 1D5AA 3ZSQA 2OYQA 4ZHRA 4B9TA 2FC0A 1YTUA 2HNZA 1RTIA 1Z26A 2YNHA 3LAMA 1NKBA 3OSTA 4CGDA 1NKCA 4B9LA 4B8CA 5HLFA 1VRTA 1QNEA 3IG1A 1TKTA 1KO9A 4CERA 3N89A 4E7JA 2E4LA 3SQ1A 4FJNA 3OYJA 4FM1A 1A5WA 2YV0X 3KJVA 4FLWA 1QN8A 3HP6A 2G8WA 4PUOA 3T19A 3SUPA 3NGYA 2JGUA 4CGHA 1NJZA 2XY7A 1VSKA 1PCZA 1QN6A 1CZBA 3V1OA 1Z25A 1L3UA 3JSMA 2O4GA 1NK8A 1S9GA 1LWYA 3JYTA 2QXFA 3BDPA 1EX4A 3U3YA 4XIUA 4CFCA 3OYCA 4Z4FA 4BDZA 5CYQA 1KFDA 4RW4A 2VWJA 4DQRA 3SJJA 1W80A 3RMAA 1RCHA 3DLRA 3KLFA 4E3SA 4ELTA 3ZSYA 3QEIA 1VRUA 3AVLA 2W42A 3QNNA 1L3TA 3DPUA 3KTQA 4QOZB 4DSFA 1SKSA 3AA4A 1C1CA 3THVA 4KB1A 2HNYA 1SL2A 2YKMA 4HCCA 2FBYA 2JLEA 5IYBP 1UA1A 2G8UA 1JL1A 2YHBA 3DLHA 4CJQA 1NK7A 2HHTA 1TGOA 2AJQA 1QHTA 1ZBIA 1RNHA 1QSYA 2HHVA 1REVA 3IH7A 1CDWA 1MU2A 1M3HA 3HSTB 4RW8A 3NHGA 3CQ8A 4BWMA 3QESA 4B9VA 4MQ3A 4KTWA 4F8RA 1RM1A 2VWKA 1BGXT 3NH1A 3DLKA 3TANA 1D9DA 1EKEA 1KCFA 2ZQBA 1IO2A 1BQNA 1W9HA 4UQGA 2HB5A 4JS4A 1KYDA 4FJHA 4CJPA 4FZYA 3HPGA 3NAEA 4F3TA 3A2FA 5JS1A 3RPJA 3TI0A 4FW1A 3KRMA 3NCIA 1WSGA 5AN4A 4GVMA 1HNVA 1WLJA 1TKXA 4GW6A 4CJVA 3NGIA 3PX0A 4CJ3A 4DSJA 4FJGA 2E6MA 2YH5A 4Z4GA 1G15A 4I2PA 1AISA 4DTUA 2DTUA 1JLGA 4B08A 3RTVA 4FLUA 1QN7A 3SCXA 3AVJA 4DFKA 3HXMA 4TPSA 1N39A 4OGCA 5C42A 3CFPA 2HW3A 1J5OA 4H8KA 1T03A 1Q9XA 4QAGA 1T05A 3LPTA 2PYLA 5KRSA 1KLMA 4I9QA 3WNFA 4CIEA 2IGIA 4O0IA 5HBMA 2WOMA 4RODB 3RMDA 3D0PA 4L8RB 3MEGA 3VQAA 5CYMA 4AHCA 3LPUA 3T1AA 4FJ8A 2BGGA 3VA0A 4CGJA 4FJIA 2Z1IA 1RT4A 3P83D 4E19A 4RW6A 3AVKA 3AO2A 4W5RA 3MEEA 2NOLA 2P5OA 4KREA 1C0TA 4HUFA 3HPOA 1FK9A 4KV8A 1S1UA 1WSEA 1X9MA 1ITGA 3I0RA 3F10A 4IFVA 4DG1A 2ITGA 1YQLA 3NF8A 2YHAA 2HMIA 2KFNA 3SYZA 1QNAA 3AVAA 3KLIA 1NH2A 3V9SA 3SQ2A 4DMNA 4FZZA 3M8RA 1VSIA 1E42A 2RPIA 4M3UA 1U45A 1QTPA 3DRSA 2MZ8A 3VQ8A 2F8TA 1TVRA 4E7HA 1UOCA 3C94A 4KKOA 4W5NA 2DFHA 4EZ9A 1YTAA 3EYZA 1VTLE 1B9FA 2GBZA 2KQ2A 3M8QA 4FJKA 1QN5A 1DTTA 1J54A 3OYHA 3QIPA 4W5QA 3M8PA 4DU3A 3F0ZA 1BCOA 3QNOA 4DFPA 3ISNC 4FXDA 1D3UA 3NBPA 4ICLA 3SV3A 2MJ7A 2G30A 4RW7A 2NUBA 3AO3A 4ID1A 3VQ4A 2E6LA 4B8AB 3K57A 4AILC 2OZSA 4FJXA 2OPQA 1NOZA 3AVBA 3PX6A 3QEWA 4M42A 1RTJA 4M3WA 4DS5A 3P5JA 3AVGA 4DLGA 3C6TA 4O0JA 3DM2A 3ZSOA 4OVLA 3AVFA 2HNDA 3MEDA 2IOCA 1KVBA 4OKJA 1NJYA 3L2VA 5FRMA 2VG5A 3V4IA 3EIKA 4NCBA 2DY4A 1NK6A 4FLXA 5CY4A 4N41A 2XRIA 3C6UA 4OKKA 4CJKA 1BHLA 3K5NA 4CHOA 4M3XA 4Z0UA 4KHWA 3OYMA 4JLHA 4FJ5A 4CK3A 3OYIA 4FJ9A 1RDBA 1C1AA 3HP9A 1ZBHA 1WSIA 4G1QA 2ETJA 1UWBA 3KIOA 3MECA 4B3OA 1KVCA 1Q8IA 3I0SA 3O4QA 3AVMA 1TK8A 4M3ZA 3ASMA 3ALYA 3LP0A 3LP1A 3NF6A 4EP5A 4DTMA 3HT3A 1LWWA 1QN3A 2HHWA 3LZIA 2Q3SA 3SI6A 4DSKA 4FLVA 1TAUA 1JLQA 2PYJA 4M3YA 4KO0A 3U3GA 3ULDA 3F73A 1CLQA 3SPYA 1LWVA 3PO5A 4B9NA 5C24A 4E1MA 2A1SA 1UAXA 4NCGA 2VG6A 4BE1A 2XY8A 4C8KA 1LW2A 1RT2A 3PX4A 1JXBA 2F96A 1WNSA 3DMJA 3RRGA 3O4NA 3K5LA 1KVAA 4YNQA 1RBRA 2VG7A 1XHZA 4LY7A 3V1QA 4E7IA 3SUOA 2IAJA 3KKSA 4LD0A 4B9MA 4C8MA 4FLZA 4DU1A 3AO1A 3V6DA 3CG7A 4B9SA 2KW4A 3QEXA 2NOEA 2O4IA 1DTQA 4EZ6A 3VN5A 1QTMA 4NCAA 3NDKA 3OYBA 1U4BA 4BACA 1EBMA 4KTQA 1TL1A 4CEDA 1HU0A 1QTSA 4FW2A 4CF2A 2G8IA 1NVPA 4HHTA 1RDDA 2NOHA 1Q9YA 4E7LA 2ZD1A 1KLNA 4C8LA 4PA1A 4RW9A 1XWLA 4FJLA 1VSDA 4I7FA 1J9AA 4DSLA 4H4MA 1L5UA 1XC9A 1GOCA 3LALA 3OSMA 2BANA 2X6NA 4AHRA 5J2QA 4Q0BA 2XHIA 2D0CA 1C6VA 4MFBA 3T3FA 4CF8A 1RTDA 3ZT3A 2HZSA 4CEZA 3K59A 4IFYA 4CF0A 2G8FA 1FKPA 3WNGA 2FGTA 1QS4A 1IKWA 3AVNA 4CK1A 3TAPA 4PQUA 4HCBA 1KYFA 1Y97A 4FK4A 3VQ6A 2DFFA 1HJRA 1NK0A 2R7YA 1C0UA 4M3RA 4CEOA 1TK0A 2QKKA 4EJZA 2X6SA 4E7KA 4FK2A 3HS8A 3QLHA 1QSLA 1B9DA 4CEQA 1C1BA 1ASWA 1JLAA 4BDYA 3PUFA 1TBAB 3HYFA 3ZSWA 3U6FA 3S9HA 1S1TA 2BE2A 5K14A 2KFZA 4CEEA 4C8OA 4ELVA 5HP1A 4PWDA 1DLOA 1JL2A 3H08A 4RG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K5O A;  1A5X A;  5JS2 A;  3VQC A;  3QIO A;  3OS2 A;  3LWL A;  1NKE A;  2HVI A;  1C9B B;  1W0H A;  3LAN A;  4M45 A;  3ZSZ A;  3EY1 A;  3V81 A;  2B6A A;  3G0Z A;  1TBP A;  2RF2 A;  3KK3 A;  3SQ4 A;  1NJX A;  3ZCM A;  4CIG A;  4ELU A;  4EP4 A;  1NK4 A;  3RWU A;  1TKZ A;  4JRP A;  3AVC A;  4CHN A;  3OYL A;  4OPK A;  3CYM A;  1RBV A;  2Z1G A;  3V9Z A;  1WSH A;  3S3O A;  2FBX A;  1QE1 A;  3LAK A;  5KGW A;  5I42 A;  1BIS A;  1HYZ A;  1SKR A;  1CXU A;  2P1J A;  1RTH A;  4KHU A;  2HHX A;  3L2W A;  4M3T A;  1I3A A;  4WZS D;  1QQC A;  3VQP A;  3RRH A;  4DF8 A;  4Z4E A;  3L3V A;  2BDP A;  3HVR A;  5C25 A;  3VQ5 A;  2LSN A;  4AHV A;  1RT5 A;  2FBT A;  1JLE A;  3SZ2 A;  4DQS A;  4KAZ A;  4FZX C;  4KHS A;  3IS9 A;  4OJR A;  4CFA A;  2IV9 A;  5IYD P;  1VOK A;  3QET A;  2XY5 A;  4KB0 A;  1U47 A;  2KTQ A;  1QN9 A;  1IKX A;  3RMC A;  2IS3 A;  1TL3 A;  1N5Y A;  1HYV A;  3VQ9 A;  3KLG A;  1C0M A;  4JRQ A;  3AV9 A;  1LAV A;  3V1R A;  3ZT4 A;  2RKI A;  3OY9 A;  4DLE A;  3SUQ A;  3ZSX A;  2WON A;  4IKF A;  3DYA A;  4B0A A;  2GV9 A;  3VQE A;  1S5J A;  4HVJ A;  1EP4 A;  1FKO A;  5E41 A;  3TAR A;  3H1Z A;  4H4O A;  4NYF A;  4CJE A;  3OYA A;  2HVH A;  1LWF A;  1JXE A;  3MXM A;  4KHQ A;  1JLC A;  3I8D A;  3WNE A;  4FLT A;  3OS0 A;  4CJL A;  1RT7 A;  1IKY A;  4FJJ A;  4O5B A;  3QER A;  3K58 A;  2QK9 A;  2IV8 A;  4CJR A;  5KGX A;  3ZSR A;  1EET A;  1VSE A;  3QIN A;  3OS1 A;  4OKE A;  4ID5 A;  1NOY A;  1NJW A;  1KY6 A;  3AA2 A;  1A5V A;  3MXJ A;  4LH5 A;  1R4X A;  3CM5 A;  5KI6 A;  4CK2 A;  5KTQ A;  1IG9 A;  3RR8 A;  3DOL A;  2HHS A;  1UA0 A;  4AHU A;  3OC3 C;  3K5M A;  3AA3 A;  3OCI A;  4HTU A;  1TV6 A;  1B9K A;  2Y1J A;  3BGR A;  3CM6 A;  4WE1 A;  1IH7 A;  2OZM A;  3SUN A;  1RT3 A;  3HPH A;  1RT6 A;  4CJ5 A;  3HO1 A;  4CJW A;  4FJ7 A;  2EHG A;  4DFJ A;  1BCM A;  1XHX A;  4K8X A;  4DQQ A;  3KLE A;  1D9F A;  1BL3 A;  3P1G A;  4AH9 A;  4E89 A;  4KI6 A;  1TAQ A;  5DMR A;  1ZBF A;  1VOL B;  4Y1D A;  5FDL A;  4FM0 A;  5J2N A;  3SPZ A;  1RT1 A;  5EU7 A;  5HRO A;  2YNF A;  1LWC A;  3V9X A;  4QCL A;  3SV4 A;  4CHQ A;  4CJS A;  3S3N A;  1B92 A;  1I39 A;  1VSH A;  3AVI A;  3DLG A;  1YTB A;  5J2M A;  1JLF A;  4GMJ B;  3TAF A;  4W5O A;  4FCY A;  5HRS A;  2G8V A;  1YT3 A;  2OPR A;  4CEA A;  5I3U A;  4N76 A;  1T8E A;  3OYE A;  3MXI A;  4N56 A;  2YNI A;  4BE0 A;  3DOK A;  3L8B A;  1WSF A;  2P5G A;  1CXQ A;  3L3U A;  5CZ1 A;  5DK5 A;  3PO4 A;  1NK9 A;  4J2A A;  4I2Q A;  3ZT1 A;  4O44 A;  2YNG A;  3OJS A;  4CJ4 A;  3V9U A;  3EZ5 A;  1U48 A;  1VSJ A;  3VQQ A;  3OJU A;  4ZTF A;  4J2B A;  1WN7 A;  4DWI A;  3MAQ A;  1SL0 A;  2D0B A;  1S6P A;  4NYN A;  4CF9 A;  4F2S A;  1NGM A;  2OA8 A;  4Q5V A;  1HPZ A;  1VSM A;  4DTP A;  4KHN A;  3NE6 A;  3KK1 A;  2ZE2 A;  4B9U A;  4J2D A;  1LV5 A;  4F2R A;  4HUG A;  3RR7 A;  4KPY A;  5KRT A;  1PZD A;  3B6O A;  4CGG A;  4DQP A;  2B5J A;  1S9E A;  2D0A A;  5HRR A;  2Z1H A;  3CFR A;  3ITH A;  1SL1 A;  1BQM A;  1RBS A;  3OYG A;  1T7P A;  4CES A;  2XO7 A;  1LW0 A;  3OYK A;  1J53 A;  4N5S A;  3PV8 A;  3DRP A;  3VQ7 A;  1JKH A;  1EXQ A;  3NH2 A;  3LZJ A;  4N47 A;  1TKD A;  3HS9 A;  4DF4 A;  2D5R A;  4CJU A;  4DTR A;  4E0D A;  4KRF A;  1KY7 A;  3O3G A;  2F8S A;  2OPS A;  1X9S A;  1QNB A;  4FVM A;  3HVT A;  4CF1 A;  3AVH A;  3KD1 E;  4OPJ A;  3HJF A;  2ATQ A;  4Z4I A;  3LP2 A;  4IG3 A;  1HRH A;  2X74 A;  4KI4 A;  1TGH A;  5IYC P;  1S1X A;  2RN2 A;  3ZSV A;  1X9W A;  1ZYQ A;  1VK0 A;  3TAE A;  4CJT A;  3QEV A;  2Z8U A;  1JFI C;  1KSP A;  1HQU A;  1S1V A;  3DLE A;  5SZT A;  4C8N A;  1U49 A;  4CJF A;  4CEB A;  3HM9 A;  1QN4 A;  1HYS A;  1S1W A;  4FYD A;  1WAJ A;  4PY5 A;  1YVU A;  4KFB A;  4LSN A;  4CFB A;  4KHY A;  2B4J A;  3KK2 A;  3VQB A;  4CGI A;  4DTO A;  1GOA A;  3AA5 X;  3WNH A;  1LAW A;  4HUE A;  4DSE A;  4LSL A;  1HQE A;  1HMV A;  1K6Y A;  4OLA A;  2HHQ A;  3NFA A;  2VJ0 A;  4OGE A;  3G10 A;  4CGF A;  3ZT0 A;  1ASV A;  2YKN A;  2Z1J A;  3D45 A;  4AHS A;  3TAG A;  3TAQ A;  1L3S A;  1RIL A;  4W5T A;  1N6Q A;  2QKB A;  5FRN A;  3NGZ A;  4CEC A;  1QSS A;  4F3O A;  2GUI A;  1BI4 B;  3TAM A;  1S6Q A;  1FXX A;  4Y1C A;  1VSL A;  4BWJ A;  2PY5 A;  4IDK A;  3IRX A;  1R0A A;  4CIF A;  3OYN A;  3LWM A;  1KTQ A;  3IAY A;  1QNC A;  2OPP A;  3KLH A;  4ROE B;  1VSF A;  5FRO A;  2G8H A;  4DTS A;  4FK0 A;  1RBT A;  1NK5 A;  3AO4 A;  3FFI A;  4FLY A;  5D3G A;  4DTN A;  1IKV A;  1SUQ A;  3NF7 A;  5J2P A;  4K8Z A;  2KZM A;  5CZ2 A;  3NF9 A;  1MP9 A;  4IG0 A;  5HRP A;  4R5P A;  3L2R A;  3SQ0 A;  4CFD A;  1O1W A;  1VTO A;  1WAF A;  2Y1I A;  3LDS A;  1CZ9 A;  4CHY A;  3O3F A;  3O3H A;  4JS5 A;  2KZZ A;  4CHP A;  3HK2 A;  3M8S A;  2X78 A;  4CCH A;  4DFM A;  2XY6 A;  1SKW A;  3ZT2 A;  4TSX A;  4KTZ A;  3TR8 A;  4Z4C A;  4BE2 A;  2PZS A;  1L3V A;  3CFO A;  4OLB A;  1RBU A;  1U04 A;  3B6P A;  2XHB A;  1YTF A;  1BIU A;  3NH0 A;  1RDC A;  1D8Y A;  2G8K A;  2DFE A;  4O4G A;  3VA3 A;  1ZBU A;  4M41 A;  3LP3 A;  1JLB A;  3KKR A;  3S3M A;  1BIZ A;  1GOB A;  4DS4 A;  4ZTJ A;  4DU4 A;  2A1R A;  4CHZ A;  1ZBL A;  3AO5 A;  1HNI A;  3VQD A;  4J2E A;  4Z4H A;  3OVN A;  3V9W A;  4O55 A;  3L2Q A;  4I9L A;  1KRP A;  3RMB A;  2IDO A;  3UIQ A;  4IBN A;  1KYU A;  1WSJ A;  3C95 A;  2HHU A;  1X1P A;  3PY8 A;  2EX3 A;  3K2P A;  3QEP A;  4FJM A;  5J1E A;  3OYD A;  3TAB A;  3F9K A;  3SNN A;  1F21 A;  3DRR A;  4DQI A;  3KD5 E;  4DTJ A;  2IC3 A;  3E01 A;  3QO9 A;  4LH4 A;  4YFU A;  1TK5 A;  5SWM A;  5T7B A;  2P51 A;  1RDA A;  3DI6 A;  4F4K A;  3L2U A;  2FBV A;  1XI1 A;  1KFS A;  4FM2 A;  1SV5 A;  3HL8 A;  4DTX A;  4E1N A;  4BDP A;  4AHT A;  5HRN A;  4CE9 A;  1ASU A;  3TWH A;  2I5J A;  4ROC B;  1BI4 A;  1LWE A;  4CEF A;  3OYF A;  3DLB A;  1D5A A;  3ZSQ A;  2OYQ A;  4ZHR A;  4B9T A;  2FC0 A;  2HNZ A;  1RTI A;  1Z26 A;  2YNH A;  3LAM A;  1NKB A;  4CGD A;  1NKC A;  4B9L A;  4B8C A;  5HLF A;  1VRT A;  1QNE A;  3IG1 A;  1TKT A;  4CER A;  4E7J A;  2E4L A;  3SQ1 A;  4FJN A;  3OYJ A;  4FM1 A;  1A5W A;  2YV0 X;  3KJV A;  4FLW A;  1QN8 A;  3HP6 A;  2G8W A;  4PUO A;  3T19 A;  3SUP A;  3NGY A;  2JGU A;  4CGH A;  1NJZ A;  2XY7 A;  1VSK A;  1PCZ A;  1QN6 A;  1CZB A;  3V1O A;  1Z25 A;  1L3U A;  3JSM A;  2O4G A;  1NK8 A;  1S9G A;  3JYT A;  2QXF A;  3BDP A;  1EX4 A;  3U3Y A;  4XIU A;  4CFC A;  3OYC A;  4Z4F A;  4BDZ A;  5CYQ A;  1KFD A;  4RW4 A;  2VWJ A;  4DQR A;  3SJJ A;  1W80 A;  3RMA A;  1RCH A;  3DLR A;  3KLF A;  4E3S A;  4ELT A;  3ZSY A;  3QEI A;  1VRU A;  3AVL A;  2W42 A;  3QNN A;  1L3T A;  3KTQ A;  4QOZ B;  4DSF A;  1SKS A;  3AA4 A;  1C1C A;  3THV A;  4KB1 A;  2HNY A;  1SL2 A;  2YKM A;  4HCC A;  2FBY A;  2JLE A;  5IYB P;  1UA1 A;  2G8U A;  1JL1 A;  2YHB A;  3DLH A;  4CJQ A;  1NK7 A;  2HHT A;  1TGO A;  2AJQ A;  1QHT A;  1ZBI A;  1RNH A;  1QSY A;  2HHV A;  1REV A;  3CQ8 A;  1CDW A;  1MU2 A;  3HST B;  4RW8 A;  3NHG A;  3QES A;  4BWM A;  4B9V A;  4MQ3 A;  4KTW A;  4F8R A;  1RM1 A;  2VWK A;  1BGX T;  3NH1 A;  3DLK A;  3TAN A;  1D9D A;  1EKE A;  1KCF A;  2ZQB A;  1IO2 A;  1BQN A;  1W9H A;  4UQG A;  2HB5 A;  4JS4 A;  1KYD A;  4FJH A;  4CJP A;  4FZY A;  3HPG A;  3NAE A;  4F3T A;  3A2F A;  5JS1 A;  3TI0 A;  4FW1 A;  3NCI A;  1WSG A;  4GVM A;  4DSI A;  1HNV A;  1WLJ A;  1TKX A;  4GW6 A;  4CJV A;  3NGI A;  3PX0 A;  4CJ3 A;  4DSJ A;  4FJG A;  2E6M A;  4Z4G A;  1YTU A;  1G15 A;  4I2P A;  1AIS A;  4DTU A;  2DTU A;  1JLG A;  4B08 A;  3RTV A;  4FLU A;  1QN7 A;  3SCX A;  3AVJ A;  4DFK A;  3HXM A;  4OGC A;  5C42 A;  3CFP A;  2HW3 A;  1J5O A;  4H8K A;  1T03 A;  1Q9X A;  4QAG A;  1T05 A;  3LPT A;  2PYL A;  5KRS A;  1KLM A;  4I9Q A;  3WNF A;  4CIE A;  2IGI A;  4O0I A;  5HBM A;  2WOM A;  4ROD B;  3RMD A;  3D0P A;  4L8R B;  3MEG A;  3VQA A;  5CYM A;  4AHC A;  3LPU A;  3T1A A;  4FJ8 A;  2BGG A;  3VA0 A;  4CGJ A;  4FJI A;  2Z1I A;  1RT4 A;  3P83 D;  4E19 A;  4RW6 A;  3AVK A;  3AO2 A;  4W5R A;  3MEE A;  4KRE A;  2P5O A;  1C0T A;  4HUF A;  3HPO A;  1FK9 A;  4KV8 A;  1S1U A;  1WSE A;  1X9M A;  1ITG A;  3I0R A;  4DG1 A;  4IFV A;  2KFN A;  2ITG A;  3NF8 A;  2HMI A;  2YHA A;  3SYZ A;  1QNA A;  3AVA A;  3KLI A;  1NH2 A;  3V9S A;  3SQ2 A;  4DMN A;  4FZZ A;  3M8R A;  1VSI A;  1E42 A;  2RPI A;  4M3U A;  1U45 A;  1QTP A;  3DRS A;  3VQ8 A;  2F8T A;  1TVR A;  4E7H A;  1UOC A;  3C94 A;  4KKO A;  4W5N A;  2DFH A;  4EZ9 A;  1YTA A;  3EYZ A;  1VTL E;  1B9F A;  2GBZ A;  2KQ2 A;  3M8Q A;  4FJK A;  1QN5 A;  1DTT A;  1J54 A;  3OYH A;  3QIP A;  4W5Q A;  3M8P A;  4DU3 A;  1BCO A;  3QNO A;  4DFP A;  4FXD A;  3ISN C;  1D3U A;  3NBP A;  4ICL A;  3SV3 A;  2MJ7 A;  2G30 A;  4RW7 A;  2NUB A;  3AO3 A;  4ID1 A;  3VQ4 A;  2E6L A;  4B8A B;  3K57 A;  4AIL C;  2OZS A;  4FJX A;  2OPQ A;  1NOZ A;  3AVB A;  3PX6 A;  3QEW A;  4M42 A;  1RTJ A;  4M3W A;  4DS5 A;  3P5J A;  3AVG A;  4DLG A;  3C6T A;  4O0J A;  3DM2 A;  3ZSO A;  4OVL A;  3AVF A;  2HND A;  3MED A;  2IOC A;  1KVB A;  4OKJ A;  1NJY A;  3L2V A;  5FRM A;  2VG5 A;  3V4I A;  3EIK A;  4NCB A;  2DY4 A;  1NK6 A;  4FLX A;  5CY4 A;  4N41 A;  2XRI A;  3C6U A;  4OKK A;  4CJK A;  1BHL A;  3K5N A;  4CHO A;  4M3X A;  4Z0U A;  4KHW A;  3OYM A;  4JLH A;  4FJ5 A;  4CK3 A;  3OYI A;  4FJ9 A;  1RDB A;  1C1A A;  3HP9 A;  1ZBH A;  1WSI A;  4G1Q A;  2ETJ A;  1UWB A;  3KIO A;  3MEC A;  4B3O A;  1KVC A;  1Q8I A;  3I0S A;  3O4Q A;  3AVM A;  1TK8 A;  4M3Z A;  3ASM A;  3ALY A;  3LP0 A;  3LP1 A;  3NF6 A;  4EP5 A;  4DTM A;  3HT3 A;  1QN3 A;  2HHW A;  3LZI A;  2Q3S A;  3SI6 A;  4DSK A;  4FLV A;  1TAU A;  1JLQ A;  2PYJ A;  4M3Y A;  4KO0 A;  3U3G A;  3ULD A;  3F73 A;  1CLQ A;  3SPY A;  3PO5 A;  4B9N A;  5C24 A;  4E1M A;  2A1S A;  1UAX A;  4NCG A;  2VG6 A;  4BE1 A;  2XY8 A;  4C8K A;  1LW2 A;  1RT2 A;  3PX4 A;  1JXB A;  2F96 A;  1WNS A;  3DMJ A;  3RRG A;  3O4N A;  3K5L A;  1KVA A;  4YNQ A;  1RBR A;  2VG7 A;  1XHZ A;  4LY7 A;  3V1Q A;  4E7I A;  3SUO A;  2IAJ A;  3KKS A;  4LD0 A;  4B9M A;  4C8M A;  4FLZ A;  4DU1 A;  3AO1 A;  3V6D A;  3CG7 A;  4B9S A;  2KW4 A;  3QEX A;  2O4I A;  1DTQ A;  4EZ6 A;  3VN5 A;  1QTM A;  4NCA A;  3NDK A;  3OYB A;  1U4B A;  4BAC A;  4KTQ A;  1TL1 A;  4CED A;  1QTS A;  4FW2 A;  4CF2 A;  2G8I A;  1NVP A;  4HHT A;  1RDD A;  1Q9Y A;  4E7L A;  2ZD1 A;  1KLN A;  4C8L A;  4PA1 A;  4RW9 A;  1XWL A;  4FJL A;  1VSD A;  4I7F A;  1J9A A;  4DSL A;  4H4M A;  1L5U A;  1XC9 A;  1GOC A;  3LAL A;  2BAN A;  2X6N A;  4AHR A;  5J2Q A;  4Q0B A;  2D0C A;  1C6V A;  4MFB A;  3T3F A;  4CF8 A;  1RTD A;  3ZT3 A;  4CEZ A;  3K59 A;  4IFY A;  4CF0 A;  2G8F A;  1FKP A;  3WNG A;  1QS4 A;  3AVN A;  1IKW A;  3TAP A;  4CK1 A;  4PQU A;  4HCB A;  1KYF A;  1Y97 A;  4FK4 A;  3VQ6 A;  2DFF A;  1HJR A;  1NK0 A;  2R7Y A;  1C0U A;  4M3R A;  4CEO A;  1TK0 A;  2QKK A;  2X6S A;  4E7K A;  4FK2 A;  3HS8 A;  3QLH A;  1QSL A;  1B9D A;  4CEQ A;  1C1B A;  1ASW A;  1JLA A;  4BDY A;  3PUF A;  1TBA B;  3HYF A;  3ZSW A;  3U6F A;  3S9H A;  1S1T A;  2BE2 A;  5K14 A;  2KFZ A;  4CEE A;  4C8O A;  4ELV A;  5HP1 A;  4PWD A;  1DLO A;  1JL2 A;  3H08 A;  4RG8 A; 
#chains in the Genus database with same CATH topology
 4DV3 K;  2NLV A;  1A5X A;  2Z0F A;  4GNI A;  1C9B B;  4A59 A;  3ZSZ A;  5AQM A;  1QQO A;  4X65 K;  1RFQ A;  4CIG A;  1NJX A;  1HLU A;  4EJY A;  4X66 K;  4OPK A;  3CYM A;  4JN4 A;  1YJN N;  4BRM A;  3C6H A;  2FBX A;  2NRT A;  4WQ5 C;  4O8K A;  1QZ5 A;  4IZ9 A;  5KGW A;  2HST A;  5GAG P;  3O1W A;  1DEJ A;  1SKR A;  1CXU A;  1NGC A;  4M3T A;  3BP8 A;  3CJ1 A;  4WZS D;  1QQC A;  3RRH A;  4DF8 A;  2Q0U A;  4Z4E A;  3L3V A;  3C65 A;  2LSN A;  1RT5 A;  3SZ2 A;  4KHS A;  3AGK A;  5AZJ B;  4OJR A;  2QXL A;  2KTQ A;  2XY5 A;  1IKX A;  2IS3 A;  1TL3 A;  3GG4 A;  3VQ9 A;  3CJC A;  2RKI A;  3SUQ A;  3ZSX A;  2WON A;  2IIR A;  4IKF A;  3VQE A;  4EAG A;  1S5J A;  4HVJ A;  5E41 A;  3TAR A;  1Q86 O;  3H1Z A;  4CJE A;  3OYA A;  2FSK A;  1JXE A;  1JLC A;  3I8D A;  4PKI A;  5C12 A;  2QK9 A;  2IV8 A;  5KGX A;  1UL7 A;  5AFU H;  1LXT A;  4AQY K;  1EET A;  5AQL A;  3OS1 A;  1NOY A;  1NM1 A;  1Q82 O;  1KY6 A;  4A5B A;  1HNW K;  3RR8 A;  1MWM A;  1UA0 A;  1WJW A;  1FN7 A;  3FR0 A;  4FWK A;  3CQX A;  2OZM A;  4D7R A;  3BF1 A;  3HPH A;  4A5A A;  5E26 A;  3D7Q A;  4HWI A;  4CJW A;  4FJ7 A;  4DFJ A;  4DR1 K;  1BCM A;  3EKS A;  4DQQ A;  2OOX A;  3OH9 A;  2O8D B;  1N34 K;  4E89 A;  1TAQ A;  3SPZ A;  1VOL B;  4Y1D A;  2JHJ A;  3VGK A;  4IXC A;  5HRO A;  4CHQ A;  1NGG A;  3DLG A;  1VSH A;  3T1H K;  1JLF A;  1X9J A;  4GMJ B;  4XH1 A;  5M1N A;  2ZGY A;  4CEA A;  3ULE A;  1BA1 A;  3MXI A;  3VTH A;  2YNI A;  3E9L A;  3DOK A;  4WCE L;  4N56 A;  4BE0 A;  2P5G A;  1TUU A;  1CXQ A;  3GDQ A;  1OVQ A;  1WN7 A;  3IUC A;  4J2B A;  3MK6 A;  1SL0 A;  1N36 K;  3UE5 A;  4CF9 A;  4DB3 A;  3CD6 N;  4FWM A;  1HPZ A;  4KHN A;  5LL6 Z;  2GEM A;  2ASM A;  1LV5 A;  5KRT A;  2PWW A;  1U2V A;  4BRL A;  2Z1H A;  3VF2 A;  4CES A;  1QHA A;  1EXQ A;  4N47 A;  3EN9 A;  1S3X A;  5BR8 K;  4DF4 A;  4E0D A;  4KRF A;  5FLX O;  3HVT A;  4CF1 A;  1C0G A;  5BMP A;  3HJF A;  2ATQ A;  2CGJ A;  3QBX A;  1HRH A;  1S1X A;  1ZYQ A;  3TAE A;  2OAN A;  3ENB A;  4H5T A;  4DUY K;  2YX6 A;  5EOY A;  1KSP A;  2YJE A;  4CEB A;  1KQS M;  3J7Z O;  3FZM A;  1WAJ A;  4OPH A;  4PY5 A;  1CZA N;  3ZX2 A;  4KFB A;  4KHY A;  1FW6 A;  2B4J A;  3KK2 A;  2I7P A;  3VQB A;  3BKQ X;  4CGI A;  1GOA A;  4YOX A;  1GLC G;  1M1K O;  2HHQ A;  3G25 A;  4DR7 K;  3TAQ A;  3R9P A;  1N6Q A;  4GV6 A;  4DV0 K;  3NGZ A;  4CEC A;  1QSS A;  4Y1C A;  3CWT A;  1R0A A;  4CIF A;  1KTQ A;  3VEY A;  2HL9 A;  1K8K A;  3SNS A;  1VSF A;  4BG8 A;  5D3G A;  1RBT A;  4BC5 A;  1BU6 O;  5KL0 A;  3A8Y A;  3NF7 A;  4K8Z A;  1VHX A;  3H3O B;  1MP9 A;  3SQ0 A;  4CFD A;  2ZJP L;  1K9M O;  4BRG A;  2Y1I A;  1VKL A;  3LDS A;  1YQR A;  4CHY A;  1YIJ N;  2F7T A;  2HL8 A;  4CCH A;  2PZS A;  4OLB A;  4BJU A;  1RBU A;  2FXU A;  4LFB K;  1BIU A;  1D8Y A;  2G8K A;  4FO0 A;  2AP1 A;  3VA3 A;  4I8O A;  1ZBU A;  4CZM A;  1BIZ A;  3ENC A;  3P39 A;  2QW9 A;  3AO5 A;  4J2E A;  1VQL N;  3OVN A;  3V9W A;  4O55 A;  1KRP A;  4BRP A;  1SAZ A;  1N3A A;  3CJ9 A;  3C95 A;  2HHU A;  3E9O A;  2EX3 A;  3K2P A;  5HL7 L;  2YHX A;  3UB5 A;  3OYD A;  3VET A;  3TAB A;  1Z05 A;  4Y0W A;  4DV2 K;  2IC3 A;  4YFU A;  4JI5 K;  5T7B A;  2E1Z A;  4JKH A;  4B1U B;  1KFS A;  2VGM A;  1SV5 A;  4DTX A;  5AQI A;  4CE9 A;  1ASU A;  1YXQ A;  3LDO A;  1BI4 A;  3OYF A;  4CEF A;  3DLB A;  1D5A A;  4ZHR A;  3U8X A;  4F9O A;  4AM6 A;  3VEX A;  3MCA B;  2ZFD B;  1RTI A;  1Z26 A;  1NKB A;  3OST A;  4CGD A;  2YI1 A;  1Q81 O;  5TKW A;  3MWP A;  4IFE A;  2E4L A;  2YJF A;  2YV0 X;  3CI5 A;  2Q31 A;  2Y8L A;  1VSK A;  3MX5 A;  2P9N A;  1VAZ A;  2O4G A;  1SQK A;  3JSM A;  1NK8 A;  3P31 A;  5AQU A;  2P9I B;  4BDZ A;  3SJJ A;  5AQS A;  3DLR A;  3ZSY A;  3AVL A;  3QNN A;  4IL8 A;  1NWK A;  3THV A;  2YKM A;  1PVS A;  1P90 A;  3QFP A;  1JL1 A;  2YHB A;  2HBJ A;  5ADX A;  2AJQ A;  1RNH A;  4JHD A;  1M3H A;  2E88 A;  3NHG A;  1KAX A;  4X64 K;  4BWM A;  4BRQ A;  4B9V A;  4MQ3 A;  3Q7C A;  3DLK A;  2VCP A;  1BQN A;  1W9H A;  2HB5 A;  3WXI A;  4CJP A;  3HM8 A;  3HPG A;  1WQA A;  2JHN A;  1C4G A;  3RPJ A;  3A2F A;  3TI0 A;  3KRM A;  3NCI A;  4NLB A;  4LF7 K;  1JCF A;  1TKX A;  3PX0 A;  3BEX A;  4FJG A;  4DV4 K;  1YTU A;  4DSJ A;  4GV9 A;  2YH5 A;  4I2P A;  4JK7 A;  4B08 A;  3RTV A;  1Q9U A;  3VGL A;  3SCX A;  3CF5 L;  3CFP A;  4QAG A;  1T05 A;  4BRO A;  3D4V A;  4CIE A;  2IGI A;  4OO1 J;  2KHO A;  5HBM A;  1XMQ K;  4L8R B;  5CYM A;  5I9E B;  1GLB G;  3LPU A;  3T1A A;  3L6Q A;  4FJI A;  4FJ8 A;  5AZI B;  4XH5 A;  1RT4 A;  4E19 A;  1HNZ K;  4RW6 A;  3AVK A;  3WXK A;  3MCP A;  5AQH A;  1XSZ A;  3I0R A;  3MN9 A;  3F10 A;  4ISG A;  1TYQ B;  1YQL A;  3NF8 A;  2HMI A;  5EXW A;  3AVA A;  4FZZ A;  3W3D A;  1TVR A;  4E7H A;  1EWR A;  2PAV A;  1NG9 A;  3MX2 A;  3EYZ A;  1VTL E;  2GBZ A;  4FJK A;  1IJJ A;  3M8P A;  3L0Q A;  3G4S N;  3J7A P;  4ICL A;  3SV3 A;  2P9L A;  2G30 A;  4RW7 A;  3VQ4 A;  4B8A B;  2OZS A;  2E6L A;  1ZC6 A;  3K57 A;  2OPQ A;  3P4I A;  3JAM O;  4M42 A;  3O9S A;  3CER A;  3C6T A;  3ZSO A;  3CCU N;  5H1S Q;  2VG5 A;  3V4I A;  4NCB A;  2DY4 A;  4A2A A;  5GAE P;  4CJK A;  3K5N A;  4Z0U A;  1ZBH A;  1RDB A;  1C1A A;  4G1Q A;  4B3O A;  4LF9 K;  3I0S A;  1TK8 A;  3AVM A;  3ASM A;  1YIT N;  2FF3 B;  2HBM A;  2IVP A;  1LWW A;  3WQU A;  4BR4 A;  3HT3 A;  3P38 A;  3LZI A;  2PYJ A;  1NLV A;  4JV5 K;  4RCH A;  4YOU A;  3ULD A;  4LF6 K;  1CLQ A;  3SLC A;  5LJW A;  1VQK N;  3PO5 A;  4B9N A;  5C24 A;  4E1M A;  4NCG A;  3ATV A;  3PX4 A;  1JXB A;  1WNS A;  3DMJ A;  3RVC A;  1KVA A;  1VQ5 N;  3O9T A;  4LF5 K;  4E7I A;  4DU1 A;  3AO1 A;  4FWR A;  3CG7 A;  1VQ8 N;  2IVN A;  3QEX A;  5AQF A;  3VN5 A;  1QTM A;  4NCA A;  1EBM A;  2Q2R A;  4JK8 A;  2QRE A;  3CWS A;  1KLN A;  4RW9 A;  1XWL A;  1IBM K;  1VSD A;  2RE2 A;  1GOC A;  2BAN A;  4K43 A;  2P9S B;  1C6V A;  4A61 A;  1NGA A;  1QQN A;  1RTD A;  2HZS A;  4CF0 A;  2NLX A;  4HCB A;  1NJI O;  2A3Z A;  1HJR A;  1C0U A;  4BR9 A;  5MLC Q;  2X6S A;  4E7K A;  4FK2 A;  1B9D A;  4CEQ A;  1C1B A;  3HOS A;  3ZEU A;  5JLF A;  3LDQ A;  4BDY A;  2KFZ A;  3HYF A;  4BRH A;  3OA9 A;  2A5X A;  4IEE A;  5CR4 A;  2YHW A;  4RG8 A;  3QIO A;  1NKE A;  2HVI A;  4M45 A;  3ZET B;  2B6A A;  3KK3 A;  3VEZ A;  2UUA K;  3ZCM A;  5M1F A;  4CBX A;  1HR0 K;  3RWU A;  3OYL A;  3DXM A;  1UT7 A;  2Z1G A;  2E2O A;  2NOI A;  1QE1 A;  3VF4 A;  2Y8Q A;  1NGB A;  4EAK A;  1BIS A;  5JLH A;  1HYZ A;  2NRX A;  2P1J A;  1RTH A;  1I3A A;  2GEL A;  3CCV N;  2FKF A;  3IS9 A;  4HTL A;  3H46 O;  4KB0 A;  3EE9 A;  3WQT A;  1QN9 A;  4BRN A;  4MDA A;  1YHQ N;  3RSM A;  3NMU A;  1KAY A;  3KLG A;  1C0M A;  4DLE A;  3ZT4 A;  4ISE A;  4M7X A;  3L4I A;  1FKO A;  2J4R A;  4BQL A;  4JKA A;  4H4O A;  1LCU A;  3S41 A;  4LFA K;  1IBL K;  1LWF A;  3MXM A;  3DWL A;  4FLT A;  5AQY A;  1IKY A;  3K58 A;  5CE3 A;  5E84 A;  4GV3 A;  3CME N;  4DSI A;  3SAH A;  4LH5 A;  1IG9 A;  3H6E A;  2HF4 A;  4FVU A;  2HHS A;  3K5M A;  3OC3 C;  3AA3 A;  3OCI A;  4HTU A;  1TV6 A;  4L3Q A;  3CM6 A;  4A57 A;  2QRC A;  3CMA N;  2OTL N;  1RT3 A;  3WT0 A;  4I6M A;  3THX A;  2EHG A;  3VES A;  4K8X A;  3LDP A;  1BL3 A;  3P1G A;  1D9F A;  4KI6 A;  4NO7 A;  5JMV D;  3IAY A;  3PDK A;  1YF5 L;  2YNF A;  5IWA K;  1LWC A;  4QCL A;  3SV4 A;  5GIN A;  3S3N A;  3R6M A;  4BC3 A;  1YTB A;  4FL9 A;  4W5O A;  3MWT A;  1YT3 A;  1T8E A;  3OYE A;  3L8B A;  3M6G A;  3EL2 A;  3CXC M;  4DKW A;  3IMX A;  2GWK A;  2YNG A;  4H0X B;  4ILG B;  4DWI A;  3MAQ A;  2D0B A;  1S6P A;  5GIP A;  4NYN A;  4Q5V A;  2WFB A;  1VSM A;  4DTP A;  3JXU A;  3NE6 A;  4KPY A;  4B9U A;  2VYP A;  4PKH A;  4IDH A;  3B6O A;  4CGG A;  4DQP A;  2D0A A;  5AQP A;  1WB9 A;  1RBS A;  2V51 B;  4WQ5 A;  4MO4 A;  3OYK A;  1J53 A;  3DRP A;  3VQ7 A;  1JKH A;  3LZJ A;  5M1P A;  4CJU A;  4GKJ K;  1MDU B;  3PLA A;  1QNB A;  4FVM A;  3AVH A;  3KD1 E;  3ID6 A;  4Z4I A;  3LP2 A;  2NOZ A;  2QM1 A;  2ITM A;  3TTC A;  1TGH A;  4CBU A;  2YHY A;  1VK0 A;  4GVE A;  3QEV A;  5F0X A;  2Z8U A;  1HQU A;  4JKE A;  2O8C A;  2VGN A;  2QRD A;  4YHH K;  4FYD A;  1YVU A;  2CH5 A;  3CC4 N;  1OH8 A;  3W0L A;  2HKP A;  5BPL A;  4DSE A;  4LSL A;  2KKZ A;  3GE1 A;  4B1W B;  4DR6 K;  4OGE A;  4IJA A;  4IO9 L;  3I0X A;  2YKN A;  1RIL A;  4BQZ A;  1VQ4 N;  3TAM A;  1S6Q A;  1FXX A;  4BWJ A;  1K73 O;  4H0P A;  2PY5 A;  3OBW A;  3OYN A;  4MDB A;  3KLH A;  4ROE B;  2G8H A;  1T6A A;  1SZ2 A;  1NBW A;  4QS9 A;  3ENH A;  5HRP A;  5JVG L;  3L2R A;  1U6Z A;  4IWV A;  2CGK A;  1O1W A;  1YI2 N;  5FPE A;  3DAW A;  2I5W A;  3WEE A;  1WAF A;  1CZ9 A;  4JS5 A;  4CHP A;  3HK2 A;  3M8S A;  2VQF K;  4DFM A;  1SKW A;  4D7Q A;  4TSX A;  3TR8 A;  3TSP A;  1G99 A;  1U04 A;  3CW7 A;  5BMN A;  2XHB A;  1YTF A;  5FPN A;  3NH0 A;  1RDC A;  4M41 A;  1YJ9 N;  3LP3 A;  1JLB A;  3KKR A;  3S3M A;  1LOT B;  4WYB A;  4I9L A;  5AQQ A;  3RMB A;  3UIQ A;  2P9P A;  3TTF A;  1VQO N;  3PY8 A;  4FJM A;  5J1E A;  2FSJ A;  3SNN A;  3E01 A;  1RDA A;  4K0K K;  3ZX3 A;  5DM6 L;  4E1N A;  4BDP A;  2W6L A;  2UUC K;  1NU0 A;  1Y64 A;  1LWE A;  4FSV A;  2BTF A;  1H1V A;  4JKB A;  3ZSQ A;  2CGL A;  3GBT A;  2YNH A;  3OW2 M;  1WBB A;  4OPA A;  3WXL A;  5HLF A;  1TKT A;  1KO9 A;  2NRZ A;  3SQ1 A;  3OYJ A;  1QN8 A;  1VQP N;  3NVK A;  1NJZ A;  2XY7 A;  1QN6 A;  1CZB A;  1L3U A;  3O9U A;  4X62 K;  2I7N A;  1EX4 A;  4BGA A;  4BR2 A;  1GLJ O;  3O80 A;  4BRF A;  3QML A;  4CFC A;  1WOQ A;  1KFI A;  5CYQ A;  4RW4 A;  2VWJ A;  3L4Q A;  4E3S A;  3KLF A;  4ELT A;  2DPN A;  3QEI A;  3UKR B;  1L3T A;  4QOZ B;  1SKS A;  3AA4 A;  4KB1 A;  2WBN A;  4M7Y A;  5AJ3 K;  4JKG B;  2G8U A;  4CJQ A;  2QA4 N;  3AAP A;  3UKU B;  1TGO A;  3MN7 A;  3ENO C;  2HHV A;  3DXK B;  3IH7 A;  1CDW A;  1REV A;  3QES A;  2V7Z A;  1Q7Y O;  4KTW A;  4F8R A;  2VWK A;  1BGX T;  5KPT A;  3NH1 A;  4KH4 A;  3PSF A;  4CZL A;  4WFN L;  2O8E B;  2E5L K;  4HJH A;  3K9J A;  2H4L X;  2UXB K;  4JS4 A;  3CC7 N;  1X3M A;  4QS8 A;  3Q7B A;  5KQD A;  4CI6 A;  1T6D A;  1WSG A;  2E2P A;  2NZT A;  4CJV A;  2E6M A;  4CZJ A;  2O8B A;  3IDH A;  1E3M A;  3SBT A;  5AQJ A;  1QN7 A;  2O8F B;  4DFK A;  1N39 A;  5C42 A;  4DV6 K;  1J5O A;  3LM9 A;  3D2E B;  2A41 A;  3KWI A;  2PYL A;  4O0I A;  4H0T B;  4ROD B;  5HSH A;  3MEG A;  2R5X A;  2BGG A;  4CGJ A;  3AO2 A;  3SK3 A;  4B3S K;  2QWR A;  1FK9 A;  1S1U A;  3D6R A;  1ITG A;  2KFN A;  1QNA A;  1NH2 A;  3THY A;  2P9K A;  3M8R A;  1VSI A;  1E42 A;  2RPI A;  1U45 A;  3DRS A;  2MZ8 A;  4W5N A;  4KKO A;  2KLA A;  4EZ9 A;  2V7Y A;  3M8Q A;  3CET A;  4DU3 A;  1IBK K;  1J54 A;  3OYH A;  1BCO A;  1T6C A;  2P9U B;  3U4L A;  1P5D X;  4ID1 A;  4FJX A;  4N76 A;  1T3V A;  3MN6 A;  3AVB A;  3EAY A;  4DS5 A;  4CVN E;  4BR0 A;  3J7Y P;  3CJB A;  2FLO A;  1RDU A;  1E4G T;  2NRW A;  3C6U A;  5BN9 A;  4JLH A;  3HP9 A;  4U7B A;  2ETJ A;  1WUA A;  1RDW X;  3VPZ A;  4FWO A;  4C1N K;  3BF3 A;  1ESV A;  3THW B;  5GAH P;  4EP5 A;  4CW7 B;  4M3Y A;  3U3G A;  3F73 A;  1HNX K;  2ASO A;  1LWV A;  2A1S A;  4DUZ K;  2VG6 A;  4AF1 A;  2XY8 A;  1PCM X;  4BVP A;  3RRG A;  1RBR A;  3SAG A;  1RGI A;  3OBY A;  4FLZ A;  2KW4 A;  2NOE A;  1DTQ A;  4KTQ A;  1TL1 A;  2ZGZ A;  3GOI A;  5GAD P;  4HHT A;  2NOH A;  1Q9Y A;  2JWL A;  4JKF A;  4E7L A;  5C15 A;  4PA1 A;  4JI6 K;  4FJL A;  2WC9 A;  4I7F A;  4DSL A;  3WXJ A;  4H4M A;  3LAL A;  3ATU A;  3OSM A;  4YOV A;  3T3F A;  2FF6 A;  4JI7 K;  4CEZ A;  4JI2 K;  1HKG A;  1OH7 A;  4MRQ A;  5CHI A;  1KYF A;  1GLE G;  3VER A;  4FK4 A;  1NK0 A;  4DR2 K;  3LDL A;  4CEO A;  1TK0 A;  1EO1 A;  5AQO A;  2QKK A;  4EJZ A;  3PIP L;  3HS8 A;  3BZK A;  1QSL A;  5FPD A;  1V5S A;  3U6F A;  3PUF A;  1TBA B;  1S1T A;  2BE2 A;  4ELV A;  1W2B M;  3C7N A;  1JL2 A;  3L2V A;  3K5O A;  3LWL A;  3VQC A;  3OS2 A;  5BRD A;  1W0H A;  4WQ4 C;  3EY1 A;  3V81 A;  3G0Z A;  3DJC A;  1W97 L;  4JD2 A;  4EP4 A;  4H5N A;  3ULX A;  1VQ9 N;  2NOF A;  3A5M C;  5AQN A;  4QG5 A;  4CZE A;  3VEV A;  3O8M A;  3GL1 A;  1QVG M;  3CCR N;  2JOI A;  3ULE B;  5C25 A;  4K25 A;  3VQ5 A;  2FKM X;  2FBT A;  1NGF A;  4KAZ A;  4FZX C;  4K42 A;  5BRF A;  4CFA A;  2IV9 A;  5IYD P;  3QET A;  1U47 A;  4FWQ A;  3RMC A;  1N5Y A;  1HYV A;  1OVY A;  3AV9 A;  1M3Q A;  1HKC A;  4B0A A;  1BWF O;  3DYA A;  3CCE N;  4NYF A;  1U2V B;  4KHQ A;  3HTV A;  5LMU K;  3WNE A;  3R8E A;  1RT7 A;  4IOX A;  1N3C A;  4O5B A;  4CJL A;  3QER A;  3D2F A;  2RHK A;  1VSE A;  3QIN A;  4JK9 A;  4ID5 A;  3AA2 A;  1A5V A;  3MXJ A;  4CK2 A;  1R4X A;  1Q18 A;  1TUY A;  5KTQ A;  3RSE A;  1N32 K;  3DOL A;  4JNE A;  4AHU A;  1ATN A;  3OSE A;  3BGR A;  1IH7 A;  3SUN A;  1YQK A;  4C23 A;  1RT6 A;  4CJ5 A;  2Q36 A;  3KLE A;  4AH9 A;  5FDL A;  4FM0 A;  5J2N A;  1RT1 A;  5EU7 A;  1ATS A;  3FGU A;  4B1V A;  3I0W A;  3CCJ N;  3TSQ A;  4CJS A;  4BRI A;  1I39 A;  3I56 N;  3JS6 A;  2G8V A;  4FCY A;  2OPR A;  5I3U A;  3KTU A;  4DUL A;  1WSF A;  5LJV A;  5DK5 A;  3J80 O;  3PO4 A;  2QEX N;  5AZJ A;  3LL3 A;  3ZT1 A;  4O44 A;  3OJS A;  5BR9 A;  4XEI A;  3V9U A;  3EZ5 A;  4MLH A;  1U48 A;  1VSJ A;  3VQQ A;  3T69 A;  1K8K B;  3FFK B;  3KK1 A;  2ZE2 A;  4J2D A;  2WUS A;  4HUG A;  3RR7 A;  1PZD A;  1YQM A;  1SL1 A;  1BQM A;  3HZ6 A;  2VQE K;  4EAI A;  1W7A A;  1T7P A;  4NLC A;  1LW0 A;  3PV8 A;  4B3T K;  3NH2 A;  1V4T A;  1TKD A;  1P5G X;  3HS9 A;  3QB0 A;  2D5R A;  4DTR A;  1KY7 A;  2V8Q A;  1EQY A;  3QBW A;  2OPS A;  1R59 O;  2WTU A;  3G71 N;  2DKD A;  3H1V X;  4OPJ A;  2F7L A;  2O3O A;  4GY2 B;  2X74 A;  4CFF A;  4KI4 A;  5IYC P;  2RN2 A;  3ZSV A;  4BRE A;  3EEQ A;  1X9W A;  3AAR A;  2O8D A;  1S1V A;  1U49 A;  4C8N A;  3CWU A;  1HUX A;  3HM9 A;  1NGH A;  4LFC K;  3QFU A;  3FZK A;  4DV1 K;  4CFB A;  4DR3 K;  1BA0 A;  3E1Y A;  3WNH A;  1LAW A;  5LY3 A;  1OH5 A;  2A42 A;  3NFA A;  2VJ0 A;  3EO3 A;  3H45 C;  3G10 A;  5F1X A;  3CJA A;  1ASV A;  3ZT0 A;  2Z1J A;  5BPM A;  2QKB A;  3O08 A;  3F2K A;  1NGI A;  2GUI A;  1BI4 B;  2A40 A;  1VSL A;  4IDK A;  1IV0 A;  2FUV A;  4DR5 K;  2W6K A;  2OTJ N;  2LAE A;  2OPP A;  4DTS A;  1NK5 A;  3FFI A;  4FLY A;  2ZWH A;  1IKV A;  4WFB L;  2KZM A;  5J2P A;  5CZ2 A;  3NF9 A;  2F9W A;  5EY4 A;  2P9N B;  1VTO A;  1KC8 O;  3O3F A;  3O3H A;  5AQZ A;  2UUB K;  3R3L A;  4QS7 A;  4YOR A;  2XY6 A;  3O9Q A;  1OH6 A;  4BE2 A;  2ZJQ L;  3CFO A;  3B6P A;  4JI4 K;  2DFE A;  4O4G A;  3U9Z A;  4ZTJ A;  1GOB A;  4DS4 A;  2A1R A;  4CHZ A;  1ZBL A;  3IFR A;  4RTF D;  4IBN A;  1KYU A;  1BUP A;  4JHD B;  4DV5 K;  3KD5 E;  3DRR A;  4DTJ A;  3PIO L;  1TK5 A;  5AQX A;  4F4K A;  4C7P A;  2FBV A;  1UT4 A;  3HL8 A;  1S22 A;  5HRN A;  3A5N C;  4B1X B;  2ZJR L;  3TWH A;  3HBT A;  4B9T A;  2FC0 A;  3QIC A;  4PL8 A;  4B8C A;  3IG1 A;  5KPZ A;  3A5L C;  3N89 A;  4FJN A;  4EAJ A;  2QLV A;  3KJV A;  2G8W A;  2H5A X;  3HP6 A;  4PUO A;  3T19 A;  4KBO A;  3NGY A;  2JGU A;  4CGH A;  5IT9 O;  3V1O A;  3T4N A;  3OH6 A;  4H03 B;  5F2R A;  3JYT A;  3BDP A;  1KFQ A;  4XIU A;  3OYC A;  4LF4 K;  2F4V K;  3RMA A;  3NVM A;  1VQ6 N;  2NRR A;  2W42 A;  3DPU A;  2HNY A;  1SL2 A;  4HCC A;  1SS6 A;  2FBY A;  3OHR A;  3R1X A;  5IYB P;  4WF9 L;  1UA1 A;  4O8U A;  1NK7 A;  5AQG A;  4BY9 C;  2HHT A;  5KPR A;  3OLP A;  1QHT A;  1ZBI A;  3VEN A;  5AQV A;  3ZYY X;  3CQ8 A;  1I94 K;  1MU2 A;  3HST B;  3TSU A;  3K0S A;  1RM1 A;  4ILJ A;  1EKE A;  1KCF A;  2ZQB A;  4UQG A;  2P9L B;  2E1Y A;  1WBD A;  4IJN A;  4FJH A;  1XMO K;  4NXM K;  1XQS C;  4FZY A;  3NAE A;  2PFU A;  4ISF A;  4F3T A;  5JS1 A;  3CHW A;  4GVM A;  4WX8 A;  1WLJ A;  4Z4G A;  4FWP A;  4B3R K;  4DTU A;  1E4F T;  4FLU A;  5KQ8 A;  4BVO A;  1VQM N;  4TPS A;  4OGC A;  3VF6 A;  4LF8 K;  4H8K A;  1T03 A;  5DM7 L;  5JVH L;  3A5O C;  3KHY A;  5M1Q A;  1KLM A;  4I9Q A;  2WOM A;  1XUP O;  4DR4 K;  3SMP A;  3CWA A;  2P9I A;  4IOC L;  2Z1I A;  3P83 D;  4CZG A;  3MEE A;  1JCG A;  2NOL A;  4FWN A;  2P5O A;  3HPO A;  4KV8 A;  4PKG A;  1GLA G;  1WSE A;  4WFA L;  1XNR K;  2W41 A;  4FOE A;  3SYZ A;  3KLI A;  4JAX A;  1PCJ X;  1EUV A;  3PSI A;  3TTD A;  4BG9 A;  3VQ8 A;  3CCL N;  1HPM A;  1UOC A;  3LDN A;  2DFH A;  3CJ7 A;  1YTA A;  4BRA A;  4YDU C;  1N8R O;  2HMP A;  3QIP A;  4W5Q A;  3QNO A;  3F0Z A;  4FXD A;  4E1J A;  4PHT X;  2NNW A;  4EHU A;  2MJ7 A;  4EAH D;  1DIZ A;  4RWT A;  2PBD A;  5AQT A;  3ZLJ A;  1NOZ A;  2HOE A;  1RTJ A;  4M3W A;  1YVN A;  3P5J A;  3AVG A;  4FWS A;  3AVF A;  3MED A;  1DT9 A;  4OVL A;  4EIA A;  2IOC A;  1KVB A;  1ZBS A;  3EIK A;  4KHP K;  4FLX A;  2W40 A;  4PL7 A;  1BHL A;  3AGR A;  4CHO A;  3OYM A;  3CCS N;  4FJ9 A;  3TDH A;  1WSI A;  4BR5 A;  4EFH A;  1UWB A;  3FZH A;  1C0F A;  3MEC A;  3BZC A;  4M3Z A;  3O4Q A;  3ZEU B;  3LP0 A;  3OTO K;  3ENO A;  3O4W A;  1QN3 A;  2GWJ A;  2HHW A;  2Q3S A;  3SI6 A;  4FLV A;  4KO0 A;  2JWK A;  3SPY A;  5AZI A;  5AQK A;  2UU9 K;  1KD1 O;  1NGJ A;  4B1Y B;  4C8K A;  1LW2 A;  2NRV A;  4JEP A;  1YUW A;  2F96 A;  2ZM6 K;  1TYQ A;  4MO5 A;  3K5L A;  4YNQ A;  3DXM B;  2VG7 A;  3G6E N;  1XHZ A;  3V1Q A;  3SUO A;  3KK7 A;  4LD0 A;  2HBK A;  4B9M A;  3V6D A;  2O4I A;  2FSN A;  4EZ6 A;  2HBL A;  1EWQ A;  1KXP A;  3PMG A;  3ZX0 A;  3WUH A;  1BOT O;  1HU0 A;  4CED A;  4DV7 K;  1QTS A;  1NVP A;  2UXC K;  2ZD1 A;  4H0V B;  3VEW A;  1J9A A;  1L5U A;  5C2D A;  4Q0B A;  2X6N A;  4AHR A;  5J2Q A;  2XHI A;  2D0C A;  2BH1 A;  5ELZ A;  4MFB A;  4BC4 A;  4CF8 A;  3K59 A;  3TPQ A;  1FKP A;  2D0O A;  2FGT A;  2V92 A;  1QS4 A;  2HF3 A;  3AVN A;  4CK1 A;  5JIC A;  3TAP A;  3CC2 N;  4BC2 A;  1Y97 A;  3O5B A;  1HJO A;  4M3R A;  4UY8 O;  1QZ6 A;  1J6Z A;  5LMN K;  3HI0 A;  5K14 A;  4FPA A;  3KZB A;  1J5E K;  2BUP A;  3L3U A;  5JS2 A;  2YA3 A;  4I6M B;  3LAN A;  3THX B;  3A0I X;  1TBP A;  2RF2 A;  3SQ4 A;  4ELU A;  1NK4 A;  1TKZ A;  4JRP A;  3AVC A;  4CHN A;  1RBV A;  3V9Z A;  1WSH A;  3S3O A;  3LAK A;  5I42 A;  3CCQ N;  4KHU A;  2HHX A;  3L2W A;  3EE8 A;  3HOT A;  2VWB A;  3VQP A;  3M5R A;  2BDP A;  3HVR A;  2JPI A;  3I8B A;  5AQR A;  4AHV A;  2HHH K;  4EAL A;  1JLE A;  4DQS A;  4O5F A;  4IOA L;  2Q97 A;  3AAQ A;  1VOK A;  4H5V A;  5B8H A;  2P9S A;  3TU5 A;  4JRQ A;  1LAV A;  2D4W A;  3E66 A;  3V1R A;  3OY9 A;  2QWM A;  1M90 O;  2GV9 A;  1JJ2 M;  1EP4 A;  2HVH A;  4FPB A;  4NB4 A;  4FOI A;  4J8F A;  3OS0 A;  2GX9 A;  3I3W A;  4FJJ A;  4YOW A;  4CJR A;  4ILH A;  3ZSR A;  5BPN A;  1NMD A;  4OKE A;  3T1Y K;  4AM7 A;  1NJW A;  5KI6 A;  3CM5 A;  4U67 L;  3SBG A;  5M1O A;  2Y1J A;  1B9K A;  1ZXO A;  4WE1 A;  2NRH A;  1JCE A;  2QI2 A;  3HO1 A;  4A62 A;  4H5R A;  3ZET A;  1N33 K;  1XHX A;  5C10 A;  3FZF A;  5DMR A;  1ZBF A;  4BGB A;  2O8C B;  3O9R A;  3C04 A;  3V9X A;  4JI1 K;  1B92 A;  1T44 A;  3AVI A;  4XH4 A;  5J2M A;  3MN5 A;  3VGM A;  3TAF A;  5TKY A;  5HRS A;  3VEO A;  3MMV A;  1IG8 A;  1XNQ K;  4BRD A;  5CZ1 A;  1NK9 A;  4H0Y B;  3WXM B;  4J2A A;  4I2Q A;  4CJ4 A;  4G9Z A;  3MDQ A;  3OJU A;  4ZTF A;  2YCH A;  1Z6R A;  4BR7 A;  4F2S A;  2H3G X;  1NGM A;  2OA8 A;  4WQ4 A;  4F2R A;  5BRH A;  2B5J A;  1S9E A;  3F9M A;  5HRR A;  3CFR A;  3ITH A;  2F9T A;  3SAF A;  3OYG A;  2XO7 A;  3CIP A;  4N5S A;  3WEE B;  4CBW A;  2HZM A;  4DQ8 A;  1NGE A;  3O6W A;  3ID8 A;  4M63 C;  3O3G A;  1S72 N;  2F8S A;  1X9S A;  4OX9 K;  2OCE A;  4YY3 K;  4IG3 A;  5F9C A;  4EHT A;  1ILY A;  1YAG A;  4CJT A;  3HSC A;  3H1Q A;  1NMN A;  1JFI C;  2NWV A;  5M1K A;  3DLE A;  5SZT A;  3M1F A;  4CJF A;  1QN4 A;  2P9P B;  1HYS A;  1S1W A;  2D0P A;  4LSN A;  2GTD A;  3IKM A;  4DTO A;  1J3M A;  4WXA A;  1HKB A;  3AA5 X;  3J8A A;  4DCH A;  4HUE A;  3CVT A;  3N4P A;  1HQE A;  1ATR A;  4MLE A;  2OOY A;  1HMV A;  1K6Y A;  4OLA A;  3VTI A;  3TAG A;  4CGF A;  4F3O A;  3D45 A;  4AHS A;  3B8A X;  1L3S A;  4LC9 B;  4W5T A;  5FRN A;  3BY5 A;  4A2B A;  1M5Q 1;  2ZF5 O;  3KWG A;  4YOT A;  3IRX A;  1VQN N;  3CPE A;  2E8A A;  3LWM A;  4KH6 A;  1QNC A;  5FRO A;  4JI8 K;  4FK0 A;  3AO4 A;  4DTN A;  1SUQ A;  4R5P A;  2D1K A;  4IG0 A;  1YJW N;  1GLL O;  2NOB A;  2KZZ A;  5C0Y A;  3DLL L;  3NA5 A;  2Q1N A;  2X78 A;  2DKA A;  3ZT2 A;  4KTZ A;  4Z4C A;  2ASP A;  2E2Q A;  1L3V A;  3EKU A;  4CJ7 A;  3U9D A;  1QVF M;  4DU4 A;  5JN5 A;  3DPT A;  1HNI A;  3VQD A;  4Z4H A;  3K9K A;  3KVG A;  3L2Q A;  2IDO A;  1WSJ A;  1X1P A;  4B1Z A;  1D4X A;  3QEP A;  3CVS A;  3EZW A;  4DQI A;  3F9K A;  1F21 A;  2DKC A;  5BRE A;  4YOY A;  3QO9 A;  4LH4 A;  5SWM A;  1FJG K;  1OKJ A;  2P51 A;  3DI6 A;  4DHY A;  3L2U A;  3SMS A;  1XI1 A;  4NXN K;  4FM2 A;  1JDY A;  4AHT A;  3QDK A;  2QWL A;  2I5J A;  4Q11 A;  4ROC B;  2OYQ A;  5FPM A;  3N4Q A;  2HNZ A;  3SJH A;  3LAM A;  2O8B B;  1NKC A;  4B9L A;  1VRT A;  1QNE A;  4JI3 K;  4CER A;  3CCM N;  4E7J A;  1MWK A;  2UXD K;  2QWO A;  4FM1 A;  1A5W A;  4FLW A;  3SUP A;  2QR1 A;  4JKC A;  1PCZ A;  3FZL A;  1Z25 A;  1S9G A;  1LWY A;  2QXF A;  3U3Y A;  4Z4F A;  1KFD A;  4DQR A;  1W80 A;  1RCH A;  4K41 A;  1VRU A;  5EVZ A;  4CZH A;  4CD3 A;  3C6A A;  3KTQ A;  4DSF A;  1C1C A;  5ADX H;  4BRK A;  2JLE A;  5EPC A;  3THY B;  4GKK K;  2P9K B;  3DLH A;  5GIO A;  1TUO A;  5AR0 A;  1QSY A;  1P8Z A;  2GUP A;  4RW8 A;  3UW2 A;  4JI0 K;  3TAN A;  1D9D A;  1IO2 A;  1V4S A;  1KYD A;  4IO8 A;  4B3M K;  1X3N A;  4FW1 A;  3VOV A;  5AN4 A;  1HNV A;  4GW6 A;  1O13 A;  3NGI A;  4JKD A;  4CJ3 A;  4CZI A;  1G15 A;  1AIS A;  2DTU A;  1JLG A;  4B9Q A;  3AVJ A;  4CZF A;  3HXM A;  1MA9 B;  5BN8 A;  2HW3 A;  3LM2 A;  1Q9X A;  5JMV A;  3LPT A;  5KRS A;  3BUZ B;  3WNF A;  2QWN A;  3RMD A;  3D0P A;  1KAZ A;  3CPW M;  4FWL A;  1C47 A;  3VQA A;  3OGD A;  5EX5 A;  4CZK A;  4AHC A;  3C0B A;  3VA0 A;  4H0O A;  4W5R A;  4V19 S;  4KRE A;  1C0T A;  4HUF A;  3AY9 A;  3UKR A;  1X9M A;  2IVO A;  3T7Z A;  4DG1 A;  4IFV A;  2ITG A;  2QWQ A;  2YHA A;  3V9S A;  3SQ2 A;  4DMN A;  4JKG A;  2EHB D;  4M3U A;  3UKU A;  1QTP A;  2F8T A;  2QTD A;  1BG3 A;  1DKG D;  3C94 A;  1HX1 A;  3DXK A;  1B9F A;  2KQ2 A;  5AQW A;  3FE1 A;  1QN5 A;  1DTT A;  4DFP A;  2AA4 A;  3ISN C;  1D3U A;  4IEI A;  3NBP A;  2O8E A;  2NUB A;  2Q0R A;  3AO3 A;  4H5W A;  2V9J A;  4AIL C;  3PX6 A;  3VMF B;  3QEW A;  4DLG A;  4O0J A;  3DM2 A;  2HND A;  1K35 A;  1QQM A;  4OKJ A;  1NJY A;  5FRM A;  1NNE A;  5AFU A;  1NK6 A;  5CY4 A;  4N41 A;  2XRI A;  4OKK A;  3E9P A;  3J81 O;  4M3X A;  4KHW A;  4FJ5 A;  4CK3 A;  3OYI A;  2O8F A;  2A6A A;  3KIO A;  1KVC A;  1Q8I A;  3D2E A;  2CH6 A;  3ALY A;  3LP1 A;  3NF6 A;  1MPG A;  4DTM A;  3I33 A;  1GLF O;  2UYT A;  4DSK A;  1TAU A;  1JLQ A;  2QWP A;  3C7N B;  1NGD A;  1UAX A;  4BE1 A;  1RT2 A;  2NVM A;  1GLD G;  4JD2 B;  3F5T A;  3O4N A;  3O1B A;  4CD1 A;  5A2Q O;  4LY7 A;  2IAJ A;  3CQY A;  3KKS A;  3D7E O;  4C8M A;  4B9S A;  5HOO A;  1DGK N;  4C1N I;  2EWS A;  4Z94 A;  3OYB A;  3NDK A;  4BAC A;  1U4B A;  2P9U A;  4FW2 A;  4CF2 A;  2G8I A;  1RDD A;  4C8L A;  3HRG A;  1K2Y X;  1XC9 A;  2E2N A;  3TE5 A;  5C2F A;  3FLC O;  3M3Z A;  3H3N O;  3ZT3 A;  4JYA K;  2G8F A;  4IFY A;  3WNG A;  2V52 B;  4PQU A;  1IKW A;  1XC3 A;  4KH5 A;  3VQ6 A;  2DFF A;  3D2F B;  2R7Y A;  3QLH A;  1K8A O;  1BO5 O;  1VQ7 N;  1ASW A;  3THW A;  1JLA A;  3RSE B;  3ZSW A;  4R79 A;  3I55 N;  3S9H A;  4YDU A;  4CEE A;  4C8O A;  4BRC A;  5HP1 A;  4PWD A;  2E20 A;  1DLO A;  3H08 A;  1BDG A; 
#chains in the Genus database with same CATH homology
 3K5O A;  1A5X A;  5JS2 A;  3VQC A;  3QIO A;  3OS2 A;  3LWL A;  1NKE A;  2HVI A;  1C9B B;  1W0H A;  3LAN A;  4M45 A;  3ZSZ A;  3EY1 A;  3V81 A;  2B6A A;  3G0Z A;  1TBP A;  2RF2 A;  3KK3 A;  3SQ4 A;  1NJX A;  3ZCM A;  4CIG A;  4ELU A;  4EP4 A;  1NK4 A;  3RWU A;  1TKZ A;  4JRP A;  3AVC A;  4EJY A;  4CHN A;  3OYL A;  3ULX A;  4OPK A;  3CYM A;  1UT7 A;  2NOF A;  1RBV A;  2Z1G A;  1WSH A;  2NOI A;  3V9Z A;  3S3O A;  2FBX A;  1QE1 A;  3LAK A;  5KGW A;  5I42 A;  1BIS A;  1HYZ A;  1SKR A;  1CXU A;  2P1J A;  1RTH A;  4KHU A;  2HHX A;  3L2W A;  4M3T A;  2JOI A;  1I3A A;  4WZS D;  1QQC A;  3VQP A;  3RRH A;  4DF8 A;  4Z4E A;  3L3V A;  2BDP A;  3HVR A;  5C25 A;  3VQ5 A;  2LSN A;  4AHV A;  1RT5 A;  2FBT A;  1JLE A;  3SZ2 A;  4DQS A;  4KAZ A;  4FZX C;  4KHS A;  3IS9 A;  4OJR A;  4CFA A;  2IV9 A;  5IYD P;  1VOK A;  3QET A;  2XY5 A;  4KB0 A;  1U47 A;  2KTQ A;  1QN9 A;  1IKX A;  3RMC A;  2IS3 A;  1TL3 A;  1N5Y A;  1HYV A;  3VQ9 A;  3KLG A;  1C0M A;  4JRQ A;  3AV9 A;  1LAV A;  1M3Q A;  3V1R A;  2RKI A;  3ZT4 A;  3OY9 A;  4DLE A;  3ZSX A;  3SUQ A;  2WON A;  4IKF A;  3DYA A;  4B0A A;  2GV9 A;  3VQE A;  1S5J A;  4HVJ A;  1EP4 A;  1FKO A;  5E41 A;  3TAR A;  3H1Z A;  4H4O A;  4NYF A;  4CJE A;  3OYA A;  2HVH A;  1LWF A;  1JXE A;  3MXM A;  4KHQ A;  1JLC A;  3I8D A;  3WNE A;  4FLT A;  3OS0 A;  4CJL A;  1RT7 A;  1IKY A;  1N3C A;  4O5B A;  3QER A;  3K58 A;  4FJJ A;  2QK9 A;  2IV8 A;  4CJR A;  5KGX A;  3ZSR A;  1EET A;  1VSE A;  3QIN A;  3OS1 A;  4OKE A;  4ID5 A;  1NOY A;  1NJW A;  1KY6 A;  3AA2 A;  1A5V A;  3MXJ A;  4LH5 A;  1R4X A;  3CM5 A;  5KI6 A;  4CK2 A;  5KTQ A;  1IG9 A;  3RR8 A;  3DOL A;  2HHS A;  1UA0 A;  4AHU A;  3OC3 C;  1FN7 A;  3K5M A;  3AA3 A;  3OCI A;  4HTU A;  1TV6 A;  1B9K A;  2Y1J A;  3BGR A;  3CM6 A;  4WE1 A;  1IH7 A;  2OZM A;  3SUN A;  1RT3 A;  1YQK A;  3HPH A;  1RT6 A;  4CJ5 A;  3HO1 A;  4CJW A;  4FJ7 A;  2EHG A;  4DFJ A;  1BCM A;  1XHX A;  4K8X A;  4DQQ A;  3KLE A;  1D9F A;  1BL3 A;  3P1G A;  4AH9 A;  4E89 A;  4KI6 A;  1TAQ A;  5DMR A;  1ZBF A;  1VOL B;  4Y1D A;  5FDL A;  4FM0 A;  5J2N A;  3SPZ A;  1RT1 A;  5EU7 A;  5HRO A;  2YNF A;  3I0W A;  1LWC A;  3V9X A;  4QCL A;  3SV4 A;  4CHQ A;  4CJS A;  3S3N A;  1B92 A;  1I39 A;  1VSH A;  3AVI A;  3DLG A;  1YTB A;  5J2M A;  1JLF A;  4GMJ B;  3TAF A;  4W5O A;  4FCY A;  5HRS A;  2G8V A;  1YT3 A;  2OPR A;  4CEA A;  3KTU A;  5I3U A;  1T8E A;  3OYE A;  4N76 A;  3MXI A;  4N56 A;  2YNI A;  4BE0 A;  3DOK A;  3L8B A;  4DUL A;  1WSF A;  2P5G A;  1CXQ A;  3L3U A;  5CZ1 A;  5DK5 A;  3PO4 A;  1NK9 A;  4J2A A;  4I2Q A;  3ZT1 A;  4O44 A;  2YNG A;  3OJS A;  4CJ4 A;  3V9U A;  3EZ5 A;  1U48 A;  1VSJ A;  3VQQ A;  3OJU A;  4ZTF A;  4J2B A;  1WN7 A;  4DWI A;  3MAQ A;  1SL0 A;  2D0B A;  1S6P A;  4NYN A;  4CF9 A;  4F2S A;  1NGM A;  2OA8 A;  4Q5V A;  1HPZ A;  1VSM A;  4DTP A;  4KHN A;  3NE6 A;  3KK1 A;  2ZE2 A;  4B9U A;  4J2D A;  1LV5 A;  4F2R A;  4HUG A;  3RR7 A;  4KPY A;  5KRT A;  1PZD A;  3B6O A;  4CGG A;  4DQP A;  2B5J A;  1S9E A;  2D0A A;  5HRR A;  1YQM A;  2Z1H A;  3CFR A;  3ITH A;  1SL1 A;  1BQM A;  1RBS A;  3OYG A;  1T7P A;  4CES A;  2XO7 A;  1LW0 A;  3OYK A;  1J53 A;  4N5S A;  3PV8 A;  3DRP A;  3VQ7 A;  1JKH A;  1EXQ A;  2HZM A;  3NH2 A;  4N47 A;  3LZJ A;  1TKD A;  3HS9 A;  4DF4 A;  2D5R A;  4CJU A;  4DTR A;  4E0D A;  4KRF A;  1KY7 A;  3O3G A;  2F8S A;  2OPS A;  1X9S A;  1QNB A;  4FVM A;  3HVT A;  4CF1 A;  3AVH A;  3KD1 E;  4OPJ A;  3HJF A;  2ATQ A;  4Z4I A;  3LP2 A;  2NOZ A;  2O3O A;  4IG3 A;  1HRH A;  2X74 A;  4KI4 A;  1TGH A;  5IYC P;  1S1X A;  2RN2 A;  3ZSV A;  1X9W A;  1ZYQ A;  1VK0 A;  3TAE A;  4CJT A;  3QEV A;  2Z8U A;  1JFI C;  1KSP A;  1HQU A;  1S1V A;  3DLE A;  5SZT A;  4C8N A;  1U49 A;  4CJF A;  4CEB A;  3HM9 A;  1QN4 A;  1HYS A;  1S1W A;  4FYD A;  1WAJ A;  4PY5 A;  1YVU A;  4KFB A;  4LSN A;  4CFB A;  4KHY A;  2B4J A;  3KK2 A;  3VQB A;  4CGI A;  4DTO A;  1GOA A;  3AA5 X;  3WNH A;  1LAW A;  4HUE A;  4DSE A;  4LSL A;  1HQE A;  1HMV A;  1K6Y A;  4OLA A;  2HHQ A;  3NFA A;  2VJ0 A;  4OGE A;  3G10 A;  4CGF A;  3ZT0 A;  3I0X A;  1ASV A;  2YKN A;  2Z1J A;  3D45 A;  4AHS A;  3TAG A;  3TAQ A;  1RIL A;  4W5T A;  1L3S A;  1N6Q A;  5FRN A;  3NGZ A;  2QKB A;  4CEC A;  1QSS A;  4F3O A;  2GUI A;  1BI4 B;  3TAM A;  1S6Q A;  1FXX A;  4Y1C A;  1VSL A;  4BWJ A;  2PY5 A;  4IDK A;  3IRX A;  1R0A A;  4CIF A;  3OYN A;  3LWM A;  1KTQ A;  3IAY A;  1QNC A;  2LAE A;  2OPP A;  3KLH A;  3SNS A;  4ROE B;  1VSF A;  5FRO A;  2G8H A;  4DTS A;  4FK0 A;  1RBT A;  1NK5 A;  3AO4 A;  3FFI A;  4FLY A;  5D3G A;  4DTN A;  1IKV A;  1SUQ A;  3NF7 A;  5J2P A;  4K8Z A;  2KZM A;  5CZ2 A;  3NF9 A;  1MP9 A;  4IG0 A;  5HRP A;  4R5P A;  3L2R A;  3SQ0 A;  4CFD A;  1O1W A;  2I5W A;  1VTO A;  2NOB A;  1WAF A;  2Y1I A;  3LDS A;  1YQR A;  1CZ9 A;  4CHY A;  3O3H A;  3O3F A;  4JS5 A;  4CHP A;  3HK2 A;  3M8S A;  2KZZ A;  2X78 A;  4CCH A;  4DFM A;  2XY6 A;  1SKW A;  3ZT2 A;  4TSX A;  4KTZ A;  3TR8 A;  4Z4C A;  4BE2 A;  2PZS A;  1L3V A;  3CFO A;  4OLB A;  1U04 A;  1RBU A;  3B6P A;  2XHB A;  1YTF A;  1BIU A;  3NH0 A;  1RDC A;  1D8Y A;  2G8K A;  2DFE A;  4O4G A;  3VA3 A;  4I8O A;  1ZBU A;  4M41 A;  3LP3 A;  1JLB A;  3KKR A;  3S3M A;  1BIZ A;  1GOB A;  4DS4 A;  4ZTJ A;  4DU4 A;  2A1R A;  4CHZ A;  3DPT A;  1ZBL A;  3AO5 A;  1HNI A;  3VQD A;  4J2E A;  4Z4H A;  3OVN A;  3V9W A;  4O55 A;  3L2Q A;  4I9L A;  1KRP A;  3RMB A;  2IDO A;  3UIQ A;  4IBN A;  1N3A A;  1KYU A;  1WSJ A;  3C95 A;  2HHU A;  1X1P A;  3PY8 A;  2EX3 A;  3K2P A;  3QEP A;  4FJM A;  5J1E A;  3OYD A;  4DSI A;  3TAB A;  3F9K A;  3SNN A;  1F21 A;  3DRR A;  4DQI A;  3KD5 E;  4DTJ A;  2IC3 A;  3E01 A;  3QO9 A;  4LH4 A;  4YFU A;  1TK5 A;  5SWM A;  5T7B A;  2P51 A;  1RDA A;  3DI6 A;  4F4K A;  3L2U A;  2FBV A;  1XI1 A;  1KFS A;  1UT4 A;  4FM2 A;  1SV5 A;  3HL8 A;  4DTX A;  4E1N A;  4BDP A;  4AHT A;  5HRN A;  4CE9 A;  1ASU A;  3TWH A;  2I5J A;  4Q11 A;  4ROC B;  1BI4 A;  1LWE A;  4CEF A;  3OYF A;  3DLB A;  1D5A A;  3ZSQ A;  2OYQ A;  4ZHR A;  4B9T A;  2FC0 A;  1YTU A;  2HNZ A;  1RTI A;  1Z26 A;  2YNH A;  3LAM A;  1NKB A;  3OST A;  4CGD A;  1NKC A;  4B9L A;  4B8C A;  5HLF A;  1VRT A;  1QNE A;  3IG1 A;  1TKT A;  1KO9 A;  4CER A;  3N89 A;  4E7J A;  2E4L A;  3SQ1 A;  4FJN A;  3OYJ A;  4FM1 A;  1A5W A;  2YV0 X;  3KJV A;  4FLW A;  1QN8 A;  3HP6 A;  2G8W A;  4PUO A;  3T19 A;  3SUP A;  3NGY A;  2JGU A;  4CGH A;  1NJZ A;  2XY7 A;  1VSK A;  1PCZ A;  1QN6 A;  1CZB A;  3V1O A;  1Z25 A;  1L3U A;  3JSM A;  2O4G A;  1NK8 A;  1S9G A;  1LWY A;  3JYT A;  2QXF A;  3BDP A;  1EX4 A;  3U3Y A;  4XIU A;  4CFC A;  3OYC A;  4Z4F A;  4BDZ A;  5CYQ A;  1KFD A;  4RW4 A;  2VWJ A;  4DQR A;  3SJJ A;  1W80 A;  3RMA A;  1RCH A;  3DLR A;  3KLF A;  4E3S A;  4ELT A;  3ZSY A;  3QEI A;  1VRU A;  3AVL A;  2W42 A;  3QNN A;  1L3T A;  3DPU A;  3KTQ A;  4QOZ B;  4DSF A;  1SKS A;  3AA4 A;  1C1C A;  3THV A;  4KB1 A;  2HNY A;  1SL2 A;  2YKM A;  4HCC A;  2FBY A;  2JLE A;  5IYB P;  1UA1 A;  2G8U A;  1JL1 A;  2YHB A;  3DLH A;  4CJQ A;  1NK7 A;  2HHT A;  1TGO A;  2AJQ A;  1QHT A;  1ZBI A;  1RNH A;  1QSY A;  2HHV A;  1REV A;  3IH7 A;  1CDW A;  1MU2 A;  1M3H A;  3HST B;  4RW8 A;  3NHG A;  3CQ8 A;  4BWM A;  3QES A;  4B9V A;  4MQ3 A;  4KTW A;  4F8R A;  1RM1 A;  2VWK A;  1BGX T;  3NH1 A;  3DLK A;  3TAN A;  1D9D A;  1EKE A;  1KCF A;  2ZQB A;  1IO2 A;  1BQN A;  1W9H A;  4UQG A;  2HB5 A;  4JS4 A;  1KYD A;  4FJH A;  4CJP A;  4FZY A;  3HPG A;  3NAE A;  4F3T A;  3A2F A;  5JS1 A;  3RPJ A;  3TI0 A;  4FW1 A;  3KRM A;  3NCI A;  1WSG A;  5AN4 A;  4GVM A;  1HNV A;  1WLJ A;  1TKX A;  4GW6 A;  4CJV A;  3NGI A;  3PX0 A;  4CJ3 A;  4DSJ A;  4FJG A;  2E6M A;  2YH5 A;  4Z4G A;  1G15 A;  4I2P A;  1AIS A;  4DTU A;  2DTU A;  1JLG A;  4B08 A;  3RTV A;  4FLU A;  1QN7 A;  3SCX A;  3AVJ A;  4DFK A;  3HXM A;  4TPS A;  1N39 A;  4OGC A;  5C42 A;  3CFP A;  2HW3 A;  1J5O A;  4H8K A;  1T03 A;  1Q9X A;  4QAG A;  1T05 A;  3LPT A;  2PYL A;  5KRS A;  1KLM A;  4I9Q A;  3WNF A;  4CIE A;  2IGI A;  4O0I A;  5HBM A;  2WOM A;  4ROD B;  3RMD A;  3D0P A;  4L8R B;  3MEG A;  3VQA A;  5CYM A;  4AHC A;  3LPU A;  3T1A A;  4FJ8 A;  2BGG A;  3VA0 A;  4CGJ A;  4FJI A;  2Z1I A;  1RT4 A;  3P83 D;  4E19 A;  4RW6 A;  3AVK A;  3AO2 A;  4W5R A;  3MEE A;  2NOL A;  2P5O A;  4KRE A;  1C0T A;  4HUF A;  3HPO A;  1FK9 A;  4KV8 A;  1S1U A;  1WSE A;  1X9M A;  1ITG A;  3I0R A;  3F10 A;  4IFV A;  4DG1 A;  2ITG A;  1YQL A;  3NF8 A;  2YHA A;  2HMI A;  2KFN A;  3SYZ A;  1QNA A;  3AVA A;  3KLI A;  1NH2 A;  3V9S A;  3SQ2 A;  4DMN A;  4FZZ A;  3M8R A;  1VSI A;  1E42 A;  2RPI A;  4M3U A;  1U45 A;  1QTP A;  3DRS A;  2MZ8 A;  3VQ8 A;  2F8T A;  1TVR A;  4E7H A;  1UOC A;  3C94 A;  4KKO A;  4W5N A;  2DFH A;  4EZ9 A;  1YTA A;  3EYZ A;  1VTL E;  1B9F A;  2GBZ A;  2KQ2 A;  3M8Q A;  4FJK A;  1QN5 A;  1DTT A;  1J54 A;  3OYH A;  3QIP A;  4W5Q A;  3M8P A;  4DU3 A;  3F0Z A;  1BCO A;  3QNO A;  4DFP A;  3ISN C;  4FXD A;  1D3U A;  3NBP A;  4ICL A;  3SV3 A;  2MJ7 A;  2G30 A;  4RW7 A;  2NUB A;  3AO3 A;  4ID1 A;  3VQ4 A;  2E6L A;  4B8A B;  3K57 A;  4AIL C;  2OZS A;  4FJX A;  2OPQ A;  1NOZ A;  3AVB A;  3PX6 A;  3QEW A;  4M42 A;  1RTJ A;  4M3W A;  4DS5 A;  3P5J A;  3AVG A;  4DLG A;  3C6T A;  4O0J A;  3DM2 A;  3ZSO A;  4OVL A;  3AVF A;  2HND A;  3MED A;  2IOC A;  1KVB A;  4OKJ A;  1NJY A;  3L2V A;  5FRM A;  2VG5 A;  3V4I A;  3EIK A;  4NCB A;  2DY4 A;  1NK6 A;  4FLX A;  5CY4 A;  4N41 A;  2XRI A;  3C6U A;  4OKK A;  4CJK A;  1BHL A;  3K5N A;  4CHO A;  4M3X A;  4Z0U A;  4KHW A;  3OYM A;  4JLH A;  4FJ5 A;  4CK3 A;  3OYI A;  4FJ9 A;  1RDB A;  1C1A A;  3HP9 A;  1ZBH A;  1WSI A;  4G1Q A;  2ETJ A;  1UWB A;  3KIO A;  3MEC A;  4B3O A;  1KVC A;  1Q8I A;  3I0S A;  3O4Q A;  3AVM A;  1TK8 A;  4M3Z A;  3ASM A;  3ALY A;  3LP0 A;  3LP1 A;  3NF6 A;  4EP5 A;  4DTM A;  3HT3 A;  1LWW A;  1QN3 A;  2HHW A;  3LZI A;  2Q3S A;  3SI6 A;  4DSK A;  4FLV A;  1TAU A;  1JLQ A;  2PYJ A;  4M3Y A;  4KO0 A;  3U3G A;  3ULD A;  3F73 A;  1CLQ A;  3SPY A;  1LWV A;  3PO5 A;  4B9N A;  5C24 A;  4E1M A;  2A1S A;  1UAX A;  4NCG A;  2VG6 A;  4BE1 A;  2XY8 A;  4C8K A;  1LW2 A;  1RT2 A;  3PX4 A;  1JXB A;  2F96 A;  1WNS A;  3DMJ A;  3RRG A;  3O4N A;  3K5L A;  1KVA A;  4YNQ A;  1RBR A;  2VG7 A;  1XHZ A;  4LY7 A;  3V1Q A;  4E7I A;  3SUO A;  2IAJ A;  3KKS A;  4LD0 A;  4B9M A;  4C8M A;  4FLZ A;  4DU1 A;  3AO1 A;  3V6D A;  3CG7 A;  4B9S A;  2KW4 A;  3QEX A;  2NOE A;  2O4I A;  1DTQ A;  4EZ6 A;  3VN5 A;  1QTM A;  4NCA A;  3NDK A;  3OYB A;  1U4B A;  4BAC A;  1EBM A;  4KTQ A;  1TL1 A;  4CED A;  1HU0 A;  1QTS A;  4FW2 A;  4CF2 A;  2G8I A;  1NVP A;  4HHT A;  1RDD A;  2NOH A;  1Q9Y A;  4E7L A;  2ZD1 A;  1KLN A;  4C8L A;  4PA1 A;  4RW9 A;  1XWL A;  4FJL A;  1VSD A;  4I7F A;  1J9A A;  4DSL A;  4H4M A;  1L5U A;  1XC9 A;  1GOC A;  3LAL A;  3OSM A;  2BAN A;  2X6N A;  4AHR A;  5J2Q A;  4Q0B A;  2XHI A;  2D0C A;  1C6V A;  4MFB A;  3T3F A;  4CF8 A;  1RTD A;  3ZT3 A;  2HZS A;  4CEZ A;  3K59 A;  4IFY A;  4CF0 A;  2G8F A;  1FKP A;  3WNG A;  2FGT A;  1QS4 A;  1IKW A;  3AVN A;  4CK1 A;  3TAP A;  4PQU A;  4HCB A;  1KYF A;  1Y97 A;  4FK4 A;  3VQ6 A;  2DFF A;  1HJR A;  1NK0 A;  2R7Y A;  1C0U A;  4M3R A;  4CEO A;  1TK0 A;  2QKK A;  4EJZ A;  2X6S A;  4E7K A;  4FK2 A;  3HS8 A;  3QLH A;  1QSL A;  1B9D A;  4CEQ A;  1C1B A;  1ASW A;  1JLA A;  4BDY A;  3PUF A;  1TBA B;  3HYF A;  3ZSW A;  3U6F A;  3S9H A;  1S1T A;  2BE2 A;  5K14 A;  2KFZ A;  4CEE A;  4C8O A;  4ELV A;  5HP1 A;  4PWD A;  1DLO A;  1JL2 A;  3H08 A;  4RG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...