2D0BA

Crystal structure of bst-rnase hiii in complex with mg2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ribonuclease HIII
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0bA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0bA02
3KLFA 5C42A 1I39A 4WZSD 4KFBA 4O0IA 3QLHA 4E0DA 4CFCA 1HQEA 3RMAA 1YTUA 1SL0A 3TARA 3DLRA 4KB0A 3C6TA 1KY7A 3AVAA 4DQRA 4BDPA 1C1BA 4MQ3A 1NK0A 1GOCA 3RWUA 3ZT4A 4PQUA 3AVHA 4DWIA 3EIKA 3SCXA 4DQQA 4DTMA 4ICLA 1XC9A 1U45A 1WSGA 2YHBA 4DSKA 1W9HA 4FJ9A 1RDAA 3MXJA 2KFNA 2PY5A 1ASVA 1UAXA 3DLGA 1BQMA 3DRPA 1TBAB 3OS2A 4CHNA 3K5NA 1L3TA 3NE6A 1QSSA 3AVMA 1NJZA 4DF4A 4KHNA 2RF2A 3VQ4A 1RT4A 3K5MA 3TAQA 1SL2A 1JLFA 3LWMA 3VA3A 3AVLA 3F9KA 4I9LA 1IKWA 3SUOA 1QSYA 1BHLA 2OA8A 3CM6A 2HHXA 4O55A 3L2UA 1KFDA 3VQ7A 4ELTA 1BI4A 5JS1A 3V1RA 1DTTA 1FK9A 2ZD1A 4FLUA 1BI4B 2OPQA 4O0JA 3I0SA 5SZTA 1RTIA 2YKNA 4KHWA 4CGJA 1VTOA 3TAPA 4CEDA 1KRPA 4ELVA 4JRQA 4J2BA 3JYTA 4E7HA 4KAZA 4CHPA 1HMVA 4JRPA 3C94A 1HQUA 3P5JA 1NOZA 4O5BA 4CF9A 4M42A 4OGCA 4DU4A 3SUNA 2Z1HA 1REVA 1HJRA 2G8KA 4FK0A 3FFIA 3MEGA 1TBPA 2BE2A 1RBSA 5K14A 3OYAA 2QK9A 1HYVA 1S5JA 1SV5A 2HVHA 4F3OA 1S6PA 3ZSXA 3AA3A 3HSTB 3ZSRA 4AHUA 1WSIA 4CJEA 4OPKA 2XY7A 4M3YA 4QAGA 2D0CA 5DMRA 3SJJA 2YNIA 4I2PA 4CGGA 4KKOA 4DFPA 1C6VA 1FKPA 1KVAA 1F21A 3DI6A 3M8RA 4HUFA 3V9SA 3QEPA 4RW6A 4B9VA 3ZCMA 2OPRA 2G30A 1S6QA 3KIOA 1VSIA 5FDLA 4CIGA 4JS5A 1ZBLA 5SWMA 4M3UA 1QN4A 3V9ZA 2E6LA 3NH2A 5J2MA 4UQGA 1RBTA 4W5RA 3NGIA 1DLOA 1QTPA 1EKEA 2HHSA 1SL1A 3TAMA 3VQ6A 1JXBA 5HRSA 4AILC 3KLIA 5DK5A 5I3UA 4FLVA 3H1ZA 4AH9A 1C1CA 1D8YA 2QKKA 2YNGA 1RT3A 2B6AA 2ZQBA 4C8LA 1KYUA 1CDWA 4IG3A 1Z25A 2ZE2A 4BWJA 4BE0A 3THVA 4E7IA 1VOKA 1QN9A 3LZIA 2HVIA 3SI6A 4FJNA 1S1TA 1UOCA 3IS9A 3RRHA 3HT3A 3L2RA 1RT1A 3AVCA 1LWFA 1T7PA 3AVFA 2VG5A 2E6MA 4ID1A 4IKFA 3D45A 3TI0A 2D0AA 4FLYA 1L3SA 3HS9A 2BANA 1NK5A 2DTUA 4M3WA 1JLEA 3RMBA 4KO0A 2OYQA 3L8BA 4GMJB 1G15A 1ZYQA 1KVCA 3O4QA 3WNHA 4E1NA 3OS1A 4F4KA 2IC3A 3DOKA 4PY5A 1VSLA 3ZSQA 1XHXA 1NJWA 2OPSA 1A5VA 1TKDA 4B9SA 5IYBP 1IH7A 4CIEA 3HPOA 1WNSA 2BDPA 2IAJA 4RW9A 2YHAA 3I0RA 1Z26A 3O4NA 3JSMA 5J1EA 2IGIA 3L3VA 3NDKA 1EX4A 4BACA 2WONA 4HCBA 3ISNC 3AO1A 3QEVA 4FZXC 5HRRA 3TAGA 1BL3A 4I2QA 1CZ9A 3KK3A 3CFRA 1WLJA 3M8PA 3HO1A 4FZZA 4CHYA 3RR8A 1VRTA 1KFSA 3OS0A 2X78A 3NFAA 3S3MA 2DFHA 2HMIA 3TANA 4RW7A 3NH1A 4DTSA 2X6NA 1Q8IA 4FLTA 4OVLA 4CEOA 5J2NA 3OYJA 3V81A 1RTJA 3CYMA 3AVGA 3KLEA 2XY6A 1QHTA 2Z1IA 3KD1E 3UIQA 2RN2A 2MJ7A 1X1PA 4ROCB 2B5JA 3M8QA 5JS2A 1JLBA 3VQ9A 3OYEA 3HM9A 3VQQA 4FLZA 3PY8A 4KHYA 2HHQA 4CJ4A 2AJQA 1RBRA 1WSFA 2HW3A 3QEWA 1MP9A 3KTQA 4Z4HA 2KZZA 4FLXA 4FZYA 3P83D 4RW4A 1RILA 1RDCA 4DLEA 2P1JA 1KSPA 4BDYA 1R0AA 3OC3C 3LP3A 2EHGA 4HVJA 3K58A 1EETA 3EY1A 4FJ5A 2XY8A 4CF1A 3AA2A 1AISA 4AHRA 4DG1A 4E7JA 3TABA 4E7LA 3ZSYA 4ID5A 4BWMA 1NK9A 1NKCA 1W80A 3V1QA 3QIOA 4CHZA 3DRSA 1JXEA 3C95A 3TAEA 3SV4A 1IG9A 1BQNA 4FW1A 3L2WA 4DTUA 2G8IA 2KFZA 4HTUA 4EP5A 4M3XA 2Z1JA 3K2PA 2Z1GA 3L3UA 4OKKA 2ITGA 3VQBA 4DU3A 4DFKA 2VJ0A 1VRUA 3V9UA 3LP0A 2WOMA 4IDKA 1NKBA 1W0HA 3ITHA 2G8FA 5FRMA 3HXMA 4CESA 4BDZA 2Y1JA 3S3OA 1QTMA 1EXQA 2X74A 3KK1A 1T8EA 4C8OA 1VSDA 1L3UA 1J9AA 4NCGA 1KLMA 2VWJA 3CQ8A 1S1WA 4EZ9A 3V4IA 2VG6A 4CJTA 1WSHA 1KCFA 3LANA 3DRRA 4E1MA 4ZTFA 4FJJA 1TAUA 3QIPA 4CHQA 1RDDA 3QETA 1BCOA 3P1GA 3KLHA 2D0BA 3DLBA 4CCHA 4Z4GA 3OVNA 4XIUA 2X6SA 1QNAA 4CF8A 1TL1A 4ZTJA 4DS5A 3DYAA 3AA5X 4FK2A 1VSJA 4CEBA 3LDSA 1ZBIA 2HNZA 3SPZA 4CJPA 3V1OA 1YVUA 3MEEA 4RW8A 4AHVA 2RKIA 4W5QA 3ULDA 3TWHA 5HBMA 4CE9A 4KI4A 1JL2A 4ELUA 1YTAA 2E4LA 2A1RA 3NGZA 3QEIA 2I5JA 2OPPA 1LWCA 3RMCA 1FKOA 2NUBA 3KKRA 3WNFA 4KHQA 4FXDA 1GOBA 2D5RA 2VG7A 3KKSA 1FXXA 4KTZA 4NYFA 4E19A 3EYZA 1D9FA 1NGMA 1B9DA 2GBZA 4ROEB 3BDPA 3PO4A 4YNQA 3QESA 1U4BA 1VK0A 2Q3SA 3SYZA 4JS4A 2IOCA 3PX4A 3ZSOA 3M8SA 1L5UA 2P5OA 1JL1A 4DTPA 4LH5A 4FJKA 3HK2A 4KV8A 4CK3A 3DLEA 1C0TA 4LSLA 1PZDA 4LH4A 3QERA 1E42A 4CERA 3LPUA 4IBNA 4CEFA 3CFOA 3MXIA 4DSEA 1GOAA 1NKEA 4DQIA 1KVBA 1KY6A 4GW6A 3B6OA 4GVMA 3KLGA 1TK5A 1T05A 1QN3A 5CYQA 3SUPA 3QINA 2FBXA 3VQ8A 4J2DA 5FROA 3HPHA 1JKHA 2HB5A 3HYFA 1NK8A 3SQ1A 2DY4A 1BIUA 1NK7A 2G8VA 3ZT3A 1QTSA 4CJSA 4W5OA 4KRFA 1J5OA 1XWLA 3AVNA 1C0UA 3NCIA 2ETJA 2XY5A 1TK8A 2G8WA 3NAEA 4DFJA 3DM2A 4OKJA 1X9SA 3NHGA 1C9BB 4OLBA 4KREA 3U3GA 4BE2A 4PA1A 1IKYA 4K8XA 4OKEA 1VSEA 3HPGA 3LALA 4CIFA 1JLQA 2QXFA 1NJXA 1I3AA 3OYCA 3OYKA 1EP4A 3DLHA 2Z8UA 4CK2A 1BCMA 3OYIA 4IG0A 1X9WA 4FJLA 1JLCA 3LP2A 5IYCP 1KLNA 1QN8A 4B8AB 3LPTA 1VSFA 5CYMA 4FJHA 4FCYA 5CZ2A 1UWBA 4B3OA 3U3YA 3PX0A 4EZ6A 4FJMA 1QS4A 4E7KA 1SKSA 2KW4A 4CJLA 5D3GA 1WSJA 4DSJA 3EZ5A 3VQPA 3U6FA 2HHUA 4CGFA 1MU2A 3H08A 5C24A 3SUQA 1U49A 1CXUA 3AVKA 5C25A 1RCHA 4G1QA 2PYJA 4FK4A 1IKXA 1B92A 1QQCA 5HRNA 4Q5VA 3NF7A 4NYNA 1KYDA 1SUQA 1XI1A 1RT7A 4B9LA 4BE1A 1D3UA 4CJRA 2F96A 2OZMA 1WN7A 3IG1A 4CGDA 1YTBA 2YNHA 1LW0A 2YV0X 4JLHA 3SQ0A 3OYNA 1ASWA 4Y1DA 4C8KA 5HRPA 4OJRA 1QE1A 3OYBA 3VQCA 3AO5A 3NH0A 4AHSA 2YKMA 4KTWA 1JFIC 1KTQA 1QN5A 2PYLA 4C8NA 4RG8A 4CFBA 4LSNA 4DTRA 1DTQA 4Z4IA 1IKVA 3SQ4A 4AHCA 3LP1A 4CJQA 3MEDA 4DTNA 3NF8A 4CJWA 4TSXA 4FJIA 4J2AA 4CJ3A 3ASMA 4LD0A 3K59A 1U48A 2IS3A 3PV8A 2PZSA 4DTXA 4LY7A 4W5TA 4FYDA 3L2QA 4QOZB 4J2EA 3T19A 2OZSA 1HNIA 4DSIA 3RMDA 4NCBA 3VQEA 4NCAA 3PUFA 4PUOA 1RTHA 1CZBA 4I7FA 4FJ7A 2HNYA 2GUIA 5J2QA 4FJXA 4RODB 1SKWA 4DS4A 3A2FA 1QSLA 3DMJA 4KTQA 1IO2A 1Y97A 3C6UA 3OYFA 4CJVA 3K5OA 4CFAA 2Y1IA 4CJ5A 1RBUA 4C8MA 3TAFA 2DFFA 4CFDA 1LAWA 4H4MA 4Z0UA 5J2PA 1LAVA 2IDOA 3AVJA 1Q9XA 2A1SA 4L8RB 4M3TA 2F8SA 3LAKA 2KQ2A 4FJ8A 1TKZA 3WNEA 1U47A 4E3SA 3IAYA 4CJKA 3SZ2A 4KHSA 2W42A 1QNCA 1CXQA 2LSNA 2DFEA 5KGWA 3ZSZA 3F73A 4DSFA 3OCIA 1NJYA 4E89A 2HHVA 1TKXA 1ITGA 4M3ZA 2BGGA 4M45A 3SNNA 3MXMA 3QNOA 3ALYA 4KPYA 1D9DA 4Z4FA 3DLKA 4CECA 2P51A 1TVRA 2XO7A 4HHTA 4DQSA 2RPIA 4OGEA 4DMNA 5IYDP 3AA4A 1NK6A 1Q9YA 1HYZA 3RR7A 2O4IA 4CGIA 4IFVA 4Z4CA 3L2VA 5I42A 2FC0A 1A5WA 3RTVA 1TL3A 1UA1A 1A5XA 3MAQA 3T3FA 1QN7A 1LWEA 4FW2A 3QEXA 4B9TA 4ZHRA 3PX6A 3WNGA 4DSLA 5HP1A 1HYSA 2G8HA 1QNEA 4FVMA 1PCZA 2FBVA 4DF8A 3ZT1A 1BIZA 2EX3A 3OYMA 4B8CA 3CG7A 1YTFA 4O44A 4H4OA 4F2RA 4KI6A 2QKBA 4PWDA 4CK1A 1O1WA 1J53A 1C0MA 1VSKA 4CEEA 4FM1A 4DQPA 4B08A 3ZT2A 5FRNA 3O3GA 3ZSWA 2O4GA 4N56A 4CEAA 3B6PA 1HNVA 1QNBA 3AO4A 3OY9A 3G10A 4HUGA 5KRSA 1NVPA 1WSEA 1T03A 5KGXA 5E41A 3VQ5A 3OYHA 3LZJA 3VA0A 1L3VA 1VOLB 1K6YA 3AO3A 1NK4A 2F8TA 1JLAA 4WE1A 2KZMA 2YNFA 1X9MA 3LAMA 4K8ZA 3VQDA 1ZBHA 3E01A 2B4JA 3AVIA 3D0PA 1RDBA 2IV9A 1S1VA 1JLGA 2JGUA 3NF9A 3NF6A 5CZ1A 1RT2A 4M3RA 4CGHA 4OPJA 4CJFA 4M41A 2FBTA 1RBVA 1SKRA 4MFBA 3V6DA 4F8RA 3KK2A 4FM0A 1CLQA 3OJUA 4CJUA 3V9WA 1TK0A 1YT3A 3ZT0A 1WAJA 5EU7A 4CF0A 4I9QA 2VWKA 3HS8A 1BGXT 2ATQA 2XHBA 2R7YA 3S9HA 1S1XA 3O3HA 2HHTA 3VQAA 3HVRA 3AO2A 1VTLE 3CFPA 3BGRA 1BISA 4CEQA 4B0AA 3OYLA 4Z4EA 3G0ZA 4HUEA 5HLFA 4N41A 4QCLA 1RTDA 4F2SA 2FBYA 2P5GA 5KI6A 4KB1A 1C1AA 1ZBUA 5HROA 1NH2A 4CF2A 3OJSA 3AVBA 3IRXA 3CM5A 4H8KA 3S3NA 4O4GA 4R5PA 5CY4A 4W5NA 3DOLA 1B9FA 1UA0A 4EP4A 4Q0BA 3T1AA 5KRTA 1S9EA 1RT6A 3OYGA 2G8UA 3PO5A 1RT5A 4AHTA 1D5AA 4FLWA 1S1UA 4N47A 3QO9A 3SV3A 1NOYA 3HL8A 3SQ2A 3RRGA 3HJFA 4FM2A 4DTOA 1WAFA 3AV9A 3SPYA 2KTQA 3NGYA 4OLAA 1TAQA 1KYFA 3K57A 2HHWA 2GV9A 1R4XA 3ZSVA 4YFUA 3LWLA 1RM1A 3K5LA 3KD5E 1HRHA 1VSMA 4IFYA 1XHZA 2IV8A 1QN6A 4DLGA 4DU1A 4HCCA 1RNHA 4F3TA 1U04A 4B9UA 5KTQA 1TGHA 1LV5A 3TR8A 2HNDA 1TKTA 3MECA 4N5SA 3OYDA 1J54A 3QNNA 4N76A 4FJGA 1TV6A 2JLEA 3NBPA 3HP9A 1N5YA 3V9XA 4CHOA 3VN5A 1LW2A 4B9NA 1ASUA 3HVTA 1ZBFA 4Y1CA 2XRIA 3KJVA 3I8DA 4DTJA 1N6QA 4CEZA 4DFMA 3HP6A 1B9KA 1S9GA 5T7BA 4KHUA 4B9MA 1HPZA 3O3FA 1VSHA 1TGOA
chains in the Genus database with same CATH superfamily
4BR0A 1I39A 4KFBA 3QLHA 4WFAL 4E0DA 4FWKA 3BF3A 3DLRA 2XHIA 3C6TA 4JEPA 1YJNN 4BDPA 4XH4A 1C1BA 4MQ3A 3QICA 4WCEL 3HOSA 3MWPA 1U45A 4DSKA 1WSGA 2YHBA 4FJ9A 2O8CA 1HNXK 2PY5A 3CCQN 3UB5A 1NGGA 1L3TA 3H45C 3D4VA 3AVMA 5BREA 4BGBA 3TSQA 3LWMA 1IKWA 4FWQA 1WBDA 3ATUA 3CM6A 3SJHA 2QWRA 4ELTA 1NGFA 1DTTA 5F2RA 2ZD1A 3AAPA 4FLUA 2OPQA 1OH6A 5SZTA 4JI1K 3FZMA 4KHWA 3TAPA 1KRPA 3JYTA 4E7HA 4KAZA 4JRPA 4BG9A 1HQUA 3IDHA 4CF9A 1NOZA 1I94K 4M42A 4DU4A 3SUNA 1ATRA 1DIZA 4FK0A 3FFIA 3OYAA 1TBPA 1EUVA 3D6RA 4RTFD 3CMAN 3LM9A 3E1YA 3ZSXA 4OPKA 3M1FA 4QAGA 5H1SQ 4KKOA 3J80O 5HOOA 1KVAA 3M8RA 5LY3A 3V9SA 3SNSA 1K8KA 3QEPA 1E4FT 4RW6A 4B9VA 4M7XA 2NRHA 5FDLA 4CIGA 4MLEA 4BRQA 4JS5A 4M3UA 1QN4A 2EWSA 5AQTA 4JKGB 4DR6K 3GOIA 5LMNK 1QTPA 2WFBA 3VGLA 1EKEA 2HHHK 5I3UA 4FLVA 2Q31A 1D8YA 1KYUA 1CDWA 4BE0A 1QQNA 1YHQN 1S1TA 3IS9A 2AP1A 5AZIA 3AVFA 2VG5A 2E6MA 1QQMA 3THXB 4FLYA 1L3SA 3HS9A 2I7PA 4YOUA 1H1VA 3ULEA 4KO0A 3A0IX 3L8BA 4GMJB 4F4KA 1DT9A 1VQKN 1VSLA 3LDOA 1XHXA 1TKDA 4WF9L 4YOTA 1WNSA 2IAJA 2YHAA 3JSMA 4LF7K 4BRAA 3L3VA 3ENOC 4BACA 4HCBA 3AO1A 4L3QA 5F0XA 4FZXC 3U4LA 1WLJA 2A40A 3WXLA 3NFAA 1VQLN 1RDUA 1J6ZA 3NH1A 4CEOA 5J2NA 3CYMA 5E84A 3UIQA 1QHTA 2HOEA 4ROCB 2RHKA 3OYEA 1JLBA 1O13A 3GE1A 3U9ZA 2AJQA 1BG3A 4Z4HA 1P90A 3MWTA 1IV0A 1RILA 1JJ2M 4BDYA 2ZFDB 3R8EA 3LP3A 2NWVA 4AHRA 4DG1A 3TABA 3ZSYA 1NKCA 1VKLA 1JXEA 3C95A 3SV4A 4F9OA 3KWGA 3VMFB 2FF6A 4DTUA 3T1HK 1MWKA 3ZYYX 5LMUK 4HTUA 4FWMA 4M3XA 2Z1JA 4OKKA 4DU3A 4DFKA 2VJ0A 3WEEB 3CPWM 2WOMA 4EHTA 3VEYA 3ITHA 3HXMA 4CESA 1HNZK 3UE5A 4X62K 1QTMA 3KK1A 4DV3K 1VQ7N 3ZETA 4BRDA 3V4IA 2VG6A 1KCFA 2ZJRL 4ZTFA 3L0QA 4FJJA 4CHQA 3QETA 1RDDA 1YAGA 4CCHA 2D0BA 3DLBA 4NLBA 2O8EB 3BP8A 3HBTA 1GLLO 5AQPA 2HNZA 4OO1J 4AF1A 3MEEA 4JI0K 4JKEA 4EALA 4DV2K 4W5QA 2PAVA 4B3MK 3P31A 3QEIA 1LWCA 4KHQA 2V51B 1ILYA 4JI5K 4NYFA 1GOBA 2VG7A 3LDPA 1FXXA 4KTZA 3EYZA 4E19A 1ZC6A 5GIPA 4ROEB 3BDPA 3HI0A 3PO4A 4YNQA 1U4BA 3O9QA 2Q3SA 1R59O 3Q7CA 4KBOA 4FJKA 1BDGA 4KV8A 4EJYA 4JHDB 4BC2A 1MWMA 3CC4N 1Q81O 4DSEA 1NKEA 4DQIA 3CCEN 2VGNA 4LFCK 3KLGA 1T05A 2H5AX 4H5VA 4ILGB 3SUPA 4D7RA 2FBXA 4V19S 5FROA 3HPHA 3TTDA 3ZT3A 1KO9A 1J5OA 3AVNA 3L6QA 4CBUA 5AN4A 4I6MA 1QVGM 1IKYA 5AQFA 1VSEA 3HPGA 3LALA 2QXFA 2VQFK 5C0YA 1I3AA 4DR5K 5EXWA 4H5TA 2P9LA 3MCAB 4IG0A 3P4IA 3OTOK 3HM8A 3VEOA 3LP2A 2OTLN 5IYCP 1HNWK 3CCLN 4Q11A 3L4IA 5CZ2A 4B3OA 3U3YA 3PX0A 4H0TB 1QS4A 4DV6K 4E7KA 3IKMA 2KW4A 4CJLA 4DSJA 3EZ5A 2HHUA 2QRCA 1MU2A 5C24A 3KD5E 3ULEB 3CD6N 4K0KK 1JCEA 1EQYA 3EZWA 1NBWA 3O4WA 5HRNA 1T3VA 3NF7A 1SUQA 4CJRA 2OZMA 1WN7A 2YV0X 1LW0A 4JI6K 1ASWA 4Y1DA 5CE3A 2OCEA 1VQPN 2OOXA 4KTWA 2NOIA 4RG8A 5ELZA 4DTRA 1HPMA 1IKVA 4WQ4A 3SQ4A 4AHCA 3A5OC 4DTNA 3FGUA 4YOYA 4CJWA 1YQLA 3EE9A 1FJGK 4TPSA 3UKRA 3TE5A 4LC9B 4J2EA 1Q18A 2E88A 3T19A 4NCBA 4NCAA 4I7FA 4FJXA 2HNYA 2GUIA 3G25A 5J2QA 1QSLA 2QR1A 3DMJA 4KTQA 1NGDA 2ASPA 1JDYA 4CJ5A 2UYTA 3TAFA 4CFDA 5BPNA 1LAWA 1LAVA 2F8SA 1Q9XA 4WQ4C 3RVCA 3WNEA 1U47A 4E3SA 3IAYA 4EAGA 4EFHA 3I56N 3OCIA 4E89A 2HHVA 1YQRA 4M45A 3VGMA 3SNNA 3ALYA 4YOXA 2UXBK 2KKZA 4CECA 2P51A 1TVRA 4A62A 4DQSA 2RPIA 4OGEA 5IYDP 5KPRA 4CGIA 4C23A 3L2VA 2FC0A 1A5WA 1UA1A 3CETA 3MAQA 3T3FA 3EAYA 2V7YA 4FW2A 4B9TA 4J8FA 5FPDA 3PX6A 3WNGA 5AR0A 1QNEA 3T7ZA 3ZT1A 1VQ5N 3OYMA 2O8BA 4PKGA 4KI6A 4H4OA 4F2RA 1O1WA 4DQPA 2FLOA 3ZT2A 3B6PA 3AO4A 3CCJN 4HUGA 1T03A 3A5NC 3WQTA 2QWMA 1PCJX 4WYBA 5KGXA 5E41A 1HJOA 3LZJA 1L3VA 1VOLB 1K6YA 4C1NI 3J7YP 1X9MA 3LAMA 5FLXO 3O9UA 2B4JA 1RDBA 1S1VA 4M3RA 4GV9A 4CJFA 1V5SA 2A42A 4FM0A 1CLQA 3DXKB 4CJUA 4IWVA 4JKGA 3ZEUA 4I9QA 2VWKA 4PHTX 2H3GX 2QW9A 3J8AA 3CCSN 3O3HA 2HHTA 3HVRA 1VTLE 4K42A 3O5BA 4Z4EA 2CH6A 4JK9A 4HUEA 4QCLA 2UUAK 1RTDA 5KI6A 3CQYA 5EY4A 4JHDA 3OJSA 2W6LA 5AQLA 3S3NA 4R5PA 4AM6A 5JN5A 1B9FA 4JI7K 4EP4A 5KRTA 3SAFA 4GKKK 4IJNA 3PO5A 3RWUA 4AHTA 1D5AA 4GNIA 1BA0A 4FM2A 3NGYA 3JXUA 3K57A 2HHWA 5AQWA 1R4XA 4YFUA 4LF6K 1X3MA 3K5LA 1XHZA 1VSMA 4CZJA 4DU1A 4B9UA 1TGHA 1IBKK 1J54A 3OW2M 4N76A 1ZXOA 4BRKA 4X64K 3V9XA 4CHOA 4QS9A 4WQ5A 3CWSA 1ZBFA 4DTJA 1NGIA 2HF3A 2NRXA 5T7BA 4JK7A 4C1NK 1VSHA 4CGDA 3O3FA 1TGOA 4CZHA 2A3ZA 5M1FA 2HKPA 1Z05A 1YITN 1YTUA 5EX5A 1KY7A 2WBNA 3AVAA 4PQUA 1NK0A 3ZT4A 4DWIA 3EIKA 3CCVN 4DQQA 4EIAA 1XC9A 1ASVA 1BQMA 1TBAB 2JHJA 4BR9A 1QSSA 2NNWA 4FL9A 1YIJN 1NJZA 2P9LB 1JLFA 1E3MA 2NOZA 3SUOA 4JKDA 4ISFA 2HHXA 1KFDA 1BI4A 1S22A 1T6DA 4LFBK 1Q86O 4UY8O 1T44A 5AQNA 3QBXA 4O0JA 4CGJA 3DLLL 3O9RA 4DHYA 4JRQA 1HMVA 2BUPA 3C94A 5BR9A 2QI2A 2NLVA 2J4RA 1N3CA 4O5BA 4OGCA 1WQAA 1REVA 1C0FA 2G8KA 5K14A 2BE2A 1K2YX 2QK9A 1SV5A 5AJ3K 1NMDA 4F3OA 3AA3A 3HSTB 4AHUA 1FN7A 5F1XA 2I7NA 2QM1A 2YNIA 4I2PA 4CGGA 1UL7A 2CGLA 1DGKN 3F2KA 3KIOA 1N33K 4WQ5C 4AM7A 5DM7L 3DXKA 5BRHA 3NH2A 4UQGA 2QTDA 4W5RA 2OANA 1DLOA 2NOFA 1SL1A 5HRSA 3H1ZA 4AH9A 2QKKA 2YNGA 1V4TA 3LDNA 4IG3A 4BWJA 4E7IA 1QN9A 2HVIA 2E1ZA 3RRHA 3L2RA 3EEQA 2ZJPL 4BREA 3GBTA 4ID1A 4PL7A 2O8EA 3VETA 2D0AA 5GINA 1NK5A 3DWLA 4M3WA 1JLEA 1G99A 1KVCA 3O4QA 3WNHA 4E1NA 2A5XA 3OS1A 4PY5A 1NM1A 1NJWA 2OPSA 4B9SA 4LFAK 1K8AO 5IYBP 3HPOA 5BPLA 2UXDK 3VGKA 3QB0A 2P9UB 3FZHA 3I0RA 3C04A 1EX4A 2WONA 1NGEA 1BL3A 3CFRA 3KK3A 4PKIA 2IVNA 3ATVA 1VRTA 2P9KB 1KFSA 3OS0A 2X78A 3NMUA 1VQNN 3TDHA 5JVHL 3ENHA 4RW7A 4FLTA 4OVLA 1RTJA 4CZKA 3KD1E 1MA9B 2RN2A 2MJ7A 1QQOA 1X1PA 3M8QA 3VQ9A 4FLZA 3ID8A 4KHYA 4XEIA 4FPBA 1RBRA 1K9MO 2HW3A 3QEWA 1MP9A 3DXMA 3P83D 3FR0A 1KSPA 2CGKA 2EHGA 5FPEA 4JKBA 3PLAA 5AQKA 1AISA 4DV7K 2V52B 3HTVA 4ID5A 3BY5A 4BWMA 3DRSA 1S72N 3DPTA 4OX9K 4IOXA 1IG9A 1BQNA 2G8IA 3BZKA 2HBMA 5AQYA 3VQBA 1EO1A 1VRUA 3E9LA 4BR4A 4LF4K 3LP0A 4IDKA 2W40A 4U67L 4BROA 3CCMN 1VSDA 1L3UA 2VWJA 3CQ8A 4EZ9A 2UUBK 3CJCA 1WSHA 2VQEK 3R6MA 4E1MA 4JNEA 3QIPA 3GG4A 1BCOA 3P1GA 4Z94A 3KLHA 4DV4K 2X6SA 3ZX3A 4CF8A 3AARA 2FXUA 3NA5A 4IEEA 5IWAK 2V9JA 4ZTJA 2EHBD 3H1QA 4BRIA 5KQDA 1W7AA 4CJPA 1OKJA 4AHVA 3K9JA 4B9QA 3ULDA 5HBMA 4CE9A 2ZGYA 5BRDA 4FPAA 3PIOL 4FWPA 1FKOA 2V92A 2NUBA 3KKRA 3KKSA 1D9FA 4IFEA 5C2DA 1B9DA 2GWKA 1HKBA 5AQRA 4KHPK 2HBLA 4H5NA 4BR5A 3SYZA 3VERA 1HKCA 2IOCA 2QWNA 3O6WA 3VPZA 1L5UA 2V7ZA 3S41A 4LH5A 3HK2A 1ATSA 1PZDA 3QERA 4CERA 2E2PA 3CQXA 3MXIA 1KVBA 4GVMA 3B6OA 3EKSA 3C65A 2HSTA 3VQ8A 3A5MC 2YHWA 3SQ1A 3O1WA 2DY4A 1NK7A 3FLCO 3HSCA 4DV1K 4CBXA 1W97L 2WTUA 3NAEA 4DFJA 2HBKA 4OLBA 1BWFO 3OSEA 4PA1A 4K8XA 4LF5K 5C12A 1NJXA 1HX1A 3OYCA 3OYKA 1EP4A 3DLHA 5MLCQ 3C7NA 1YI2N 3WXJA 3T4NA 4BC3A 5CYMA 2YX6A 3O9TA 1NMNA 4EZ6A 3AGRA 4WX8A 4CGFA 3ZETB 3SUQA 4G1QA 2KHOA 1IKXA 4CD3A 4BG8A 4NYNA 1KYDA 1RT7A 4FO0A 4HWIA 4JLHA 3F9MA 3OYNA 4OJRA 1QE1A 3UKUB 3OYBA 4HJHA 4AHSA 1QN5A 2E20A 2PYLA 2VWBA 3LP1A 4CJQA 2P9SB 3OH6A 5M1PA 1TYQB 4TSXA 4EAIA 4CJ3A 4LD0A 3K59A 2IS3A 3PV8A 4DTXA 1HKGA 1NGJA 4MO4A 3L2QA 2OZSA 1CZBA 4FJ7A 4GV6A 3U9DA 3B8AX 1ATNA 3C6UA 4CJVA 3K5OA 4FWLA 1RBUA 3I33A 3VF2A 3CWAA 4YOVA 3F10A 3RSMA 3AVJA 4L8RB 4M3TA 3BUZB 5BPMA 4FJ8A 1M90O 2O3OA 5AQHA 1P5GX 2W42A 1CXQA 2LSNA 3ZSZA 5LJWA 1OVYA 1OH5A 3OH9A 4M3ZA 2BGGA 1LWYA 2NOBA 3AAQA 4CZEA 1KAYA 2ZF5O 4DMNA 5C10A 1Q9YA 5M1QA 2HBJA 3CWUA 4WFNL 4IFVA 2Q2RA 5I42A 3MN9A 4NLCA 5EPCA 3PMGA 3VF4A 3RSEA 1A5XA 5C15A 4ZHRA 1TUUA 2NRVA 3TSPA 1SZ2A 2NRTA 3D7QA 2FBVA 1BIZA 2EX3A 4QG5A 3MK6A 2QKBA 4PWDA 3N4QA 3H3NO 1J53A 1VSKA 5FRNA 3O3GA 3ZSWA 4N56A 3OY9A 1NG9A 3G10A 1W2BM 1WSEA 3FZFA 4JI4K 3RPJA 3AO3A 3THWB 2QXLA 4K8ZA 4CZLA 3VQDA 3K0SA 3E01A 2JOIA 3AVIA 3NF9A 1JLGA 1RT2A 1WBBA 2P9SA 3WT0A 3ENOA 3VTIA 1RBVA 1SKRA 3V6DA 3KK2A 3TPQA 1OH7A 1YT3A 3ZT0A 4DUZK 3EO3A 3HS8A 2ATQA 1KAXA 1S1XA 4GKJK 3E9OA 5GAGP 3CFPA 4JYAK 2VGMA 1BISA 3SMPA 3OYLA 3I55N 3G0ZA 1PCMX 5HLFA 1QVFM 2P5GA 1C1AA 4CF2A 3IRXA 4H0XB 1S3XA 4JAXA 3DOLA 5BMNA 1UA0A 2R5XA 1HU0A 5KL0A 2G8UA 5TKYA 4FLWA 1S1UA 3QO9A 1NOYA 2F9TA 4DTOA 3QFPA 1KYFA 3WXKA 4MO5A 3LWLA 3J7ZO 5EOYA 2IV8A 1QN6A 4F3TA 3H1VX 2HNDA 1TKTA 4A57A 3MECA 5GADP 2FKMX 3QNNA 3CVTA 1N5YA 4FWRA 1C0GA 2NOHA 1LW2A 1HR0K 4Y1CA 4CEZA 3HP6A 3AGKA 2IIRA 4KH6A 1B9KA 1S9GA 2RE2A 4KHUA 2IVPA 3KLFA 5C42A 2O8BB 4WZSD 4CW7B 4O0IA 4BRMA 4CFCA 1XUPO 5AZJA 2QRDA 4KB0A 3SAGA 4DQRA 3I3WA 4JI2K 3AVHA 3SCXA 4B3TK 5AZIB 4RCHA 4ICLA 4DTMA 4A61A 3VESA 3TSUA 3KZBA 3OHRA 2KFNA 3OS2A 3DLGA 3O1BA 4BVOA 3K5NA 4ISGA 5GIOA 2RF2A 3VQ4A 1RT4A 3TAQA 3VA3A 3AVLA 3F9KA 3DAWA 4I9LA 1BHLA 1BU6O 2GEMA 4O55A 3VQ7A 3FFKB 1FK9A 1BI4B 1N3AA 1YQMA 2Q0UA 4CEDA 1SQKA 2FKFA 3BKQX 3CCUN 3CJBA 2AA4A 1ESVA 3P5JA 1BOTO 2Z1HA 1KC8O 3MEGA 4A59A 2HF4A 1HYVA 1S5JA 4B1XB 3ZX0A 3C7NB 1WSIA 4QS7A 3R1XA 3OLPA 3N89A 1C6VA 1FKPA 3DI6A 3SAHA 2OPRA 3RSEB 2HZMA 1VSIA 4DULA 2FSKA 1ZBLA 3EL2A 1M5Q1 3EN9A 3V9ZA 3ZX2A 3EKUA 3NGIA 4DV0K 4YOWA 2HHSA 5KPTA 2PBDA 4AILC 3VEXA 3Q7BA 3KLIA 5DK5A 2BH1A 5M1KA 2JPIA 4C8LA 3HOTA 3THVA 1Z25A 2ZE2A 1VOKA 3LZIA 3CC7N 4FJNA 3ENCA 1RT1A 1T7PA 3C6AA 3TI0A 3THXA 2DTUA 4B1UB 2H4LX 1JCFA 3CHWA 2FGTA 3ZSQA 2W6KA 2UXCK 1GLDG 3SBGA 4FVUA 3QFUA 4RW9A 3VEVA 1Z26A 5J1EA 3KRMA 2IGIA 1WOQA 1VQ9N 4B1VA 4MDBA 1CZ9A 3M8PA 3N4PA 4FZZA 4CHYA 3VEWA 3LL3A 2HMIA 3VEZA 3TANA 4DTSA 2X6NA 1Q8IA 3PSIA 4B1ZA 4YDUC 3V81A 3THYA 2A6AA 3QMLA 2E8AA 2B5JA 4DKWA 5JS2A 1WB9A 4BR2A 1X9JA 2JWLA 4CJ4A 4YDUA 3KTQA 1FW6A 4FLXA 4FZYA 2IVOA 4DLEA 3ULXA 2P1JA 4FWSA 1R0AA 4FJ5A 4HVJA 4D7QA 1EETA 2NRZA 3R9PA 3EY1A 4CF1A 4J2BA 4E7JA 3O9SA 4E7LA 4CHZA 5JLHA 3VF6A 4IOAL 3TAEA 1Y64A 3L2WA 3O80A 2KFZA 1VQMN 5IT9O 3WEEA 2Z1GA 2ITGA 3D2FA 4K41A 1EWQA 1PVSA 2D4WA 3D2FB 2Y1JA 2X74A 1T8EA 4C8OA 3G6EN 2F7LA 1KLMA 2UUCK 4CJTA 3LANA 3DRRA 3IMXA 4O5FA 1GLFO 2CGJA 5AQOA 4Z4GA 3OVNA 1TL1A 5E26A 4DS5A 5AQMA 3AA5X 4FK2A 1JCGA 1VSJA 3CERA 2E2NA 1ZBIA 3SPZA 3V1OA 2P9KA 4EJZA 1Q7YO 2RKIA 3H46O 4KI4A 1JL2A 1YTAA 4OPAA 2A1RA 2OPPA 1X3NA 3RMCA 3WNFA 4FXDA 4CJ7A 3HO1A 3CWTA 2ZM6K 4EAKA 2GBZA 2NVMA 3E9PA 5AFUH 3CJAA 1XSZA 4JKFA 1VK0A 3CVSA 4JS4A 4YY3K 3M8SA 2P5OA 3CW7A 1JL1A 4DTPA 3F0ZA 1C0TA 4LH4A 3LPUA 4CEFA 3CFOA 2Q1NA 1GOAA 3PDKA 1K73O 3T69A 4CBWA 4FSVA 1TK5A 3CC2N 1VHXA 1BO5O 2QWQA 4OPHA 4DR2K 1JKHA 2HB5A 3HYFA 1NK8A 1N34K 1WUAA 2G8VA 1QTSA 4CJSA 4KRFA 1DKGD 2P9NA 3NCIA 4IO8A 2XY5A 1TK8A 1XNQK 3CJ9A 1C4GA 3DM2A 4NO7A 3NHGA 3CF5L 3A5LC 4BGAA 1KFIA 3ENBA 4BE2A 5A2QO 4CIFA 1JLQA 1SS6A 4EAHD 3LM2A 2Z8UA 4EHUA 3JS6A 5GAEP 2Q36A 4FJLA 1LXTA 1QN8A 1XQSC 3LPTA 1VSFA 3O08A 4FCYA 4FJMA 1YVNA 3L4QA 1J3MA 1SKSA 4LF8K 2O8DA 2QWOA 3VQPA 3U6FA 5AQIA 1VAZA 4BRPA 2UU9K 1U49A 1CXUA 1RCHA 2BTFA 1B92A 5CR4A 1OVQA 4Q5VA 2HL8A 4BRNA 1XI1A 1YUWA 1OH8A 4B9LA 1D3UA 4BR7A 3IG1A 1YTBA 3SQ0A 1NGCA 1GLAG 3VQCA 3AO5A 3NH0A 4XH1A 1JFIC 4CZIA 1KTQA 4JKAA 3UKRB 4CFBA 1V4SA 4LSNA 3UW2A 4Z4IA 2NRRA 4ISEA 1NGHA 3NF8A 2MZ8A 4YORA 3H3OB 4FJIA 1DEJA 1U48A 3ASMA 3JAMO 2PZSA 4J2AA 4X66K 4I8OA 4W5TA 4FYDA 4QOZB 1IBLK 1HNIA 1QZ6A 2FSNA 4DSIA 3VQEA 3PUFA 4ILHA 1RTHA 3QBWA 4RODB 4DS4A 1XMOK 1IO2A 2ZGZA 3WXIA 3R3LA 3D2EA 1VQ6N 4IDHA 3K9KA 4Z0UA 5J2PA 2IDOA 2A1SA 1NGBA 1TKZA 4H0OA 4CJKA 4KHSA 1RFQA 1QNCA 3FZLA 5KGWA 1NJYA 2E1YA 1ITGA 1TKXA 1GLCG 3MXMA 1YQKA 3QNOA 4KPYA 4BRLA 3I8BA 5ADXA 1N36K 2F4VK 3TTFA 2XO7A 4JV5K 3OSMA 1NK6A 1HYZA 2O4IA 4Z4CA 1XC3A 4E1JA 1SAZA 3RTVA 2OTJN 1TL3A 1LWEA 5HP1A 4QS8A 2O8FB 2GWJA 2G8HA 1HUXA 1PCZA 4DF8A 5AQSA 4CI6A 4O44A 1YTFA 2GUPA 4CK1A 4FM1A 3CPEA 4B08A 2Y8LA 4DUYK 4IXCA 2O8FA 4CFFA 3VQ5A 2F8TA 1CZAN 5F9CA 1NK4A 2YNFA 2ASOA 2IV9A 4CGHA 4OPJA 2E2QA 3IFRA 2NLXA 3TU5A 1MDUB 2HMPA 4MFBA 3CIPA 4F8RA 1NU0A 4GVEA 3C6HA 4X65K 3E66A 5BRFA 5AQJA 3IUCA 4BRFA 1VQ4N 3CI5A 2XHBA 3S9HA 3DPUA 3VQAA 3AO2A 2ZJQL 3KHYA 4CEQA 1KFQA 3MN7A 4B0AA 3HZ6A 4Y0WA 4N41A 1ZBUA 3DXMB 3CM5A 5KPZA 4W5NA 1N39A 3OYGA 1RT6A 4IZ9A 4N47A 4JI3K 3RRGA 3HL8A 3SQ2A 3SPYA 1WAFA 3H6EA 5KQ8A 4OLAA 1TAQA 2GV9A 2QWPA 3LDLA 5AQQA 1RM1A 5M1OA 2QA4N 1RNHA 1U04A 1TUOA 5KTQA 1GLJO 1VQ8N 5HSHA 2OOYA 3CMEN 4N5SA 1YJ9N 3CJ1A 4FJGA 1TV6A 2PWWA 4B9NA 1IG8A 3KJVA 2WC9A 4DFMA 1U2VA 3TTCA 2P9PB 4O8UA 4B9MA 1HPZA 1NGAA 2NRWA 3SBTA 4BRCA 4WXAA 1HQEA 3RMAA 1SL0A 3TARA 3MDQA 1GOCA 4H5WA 5JMVD 4NB4A 1W9HA 3BZCA 1RDAA 3MXJA 5FPMA 1UAXA 3DRPA 2QLVA 3P38A 3FE1A 4CHNA 4FWNA 2DPNA 3NE6A 4KHNA 4DF4A 1K35A 3K5MA 1SL2A 4FOIA 2P9UA 5BN9A 1IBMK 1QSYA 4B3SK 2OA8A 2O8CB 3M6GA 4A5AA 3L2UA 5JS1A 3A8YA 3V1RA 4DR3K 2FF3B 3I0SA 1RTIA 2YKNA 1VTOA 4CD1A 3I0XA 4ELVA 1XNRK 1YF5L 2YH5A 4CHPA 1KXPA 2P9IA 3CCRN 4K25A 4JD2A 3CJ7A 1HJRA 4O8KA 3THYB 1RBSA 2HVHA 1S6PA 4CJEA 3ZSRA 2XY7A 4M3YA 2YHXA 2D0CA 3KWIA 5DMRA 3SJJA 4DFPA 2FSJA 4HUFA 1F21A 1LWVA 3LDQA 1N32K 3PSFA 4XH5A 3ZCMA 2G30A 1S6QA 2D0PA 5AQGA 5SWMA 2LAEA 5AQZA 2HZSA 2E6LA 1BA1A 5J2MA 1RBTA 2GELA 1GLBG 1Q9UA 1U6ZA 3TAMA 3VQ6A 1JXBA 4FWOA 1KAZA 1BUPA 1C1CA 1RT3A 2B6AA 2ZQBA 3MX5A 4BY9C 3J7AP 3WUHA 3UKUA 1J5EK 4DR4K 3GDQA 3SI6A 1UOCA 3HT3A 1TUYA 1LWFA 3AVCA 4IKFA 3D45A 3M3ZA 4IEIA 2BANA 3RMBA 2W41A 4FOEA 2OYQA 1G15A 1ZYQA 1NJIO 4B1WB 4ILJA 2IC3A 2D1KA 4WFBL 3MMVA 3DOKA 1MPGA 2NOLA 1RGIA 1A5VA 2F7TA 1M3QA 1IH7A 4CIEA 3CXCM 4IO9L 3PIPL 2BDPA 3O4NA 1KQSM 2JHNA 1LOTB 2YJEA 4KH5A 3NDKA 3ISNC 3QEVA 5HRRA 3TAGA 4I2QA 3RR8A 3S3MA 3MX2A 1M1KO 2DFHA 4U7BA 3OYJA 3KLEA 3C0BA 3AVGA 4A2AA 2XY6A 2Z1IA 3I8DA 3HM9A 2HHQA 3VQQA 3PY8A 2YA3A 3P39A 4BRGA 1WSFA 3I0WA 2KZZA 3OSTA 2D0OA 2DKCA 3OA9A 4RW4A 1Q82O 1RDCA 4B1YB 3OC3C 4FK4A 3K58A 2XY8A 4PL8A 3AA2A 2P9IB 1NK9A 1W80A 4IJAA 3QIOA 3V1QA 4YHHK 5AQUA 2YJFA 4FW1A 3ZEUB 4EP5A 3L3UA 3K2PA 5EVZA 3V9UA 4GV3A 2Q97A 3T1YK 1NKBA 1W0HA 2NZTA 2G8FA 5FRMA 3G71N 4BDZA 3S3OA 1EXQA 4I6MB 1J9AA 4NXNK 4NCGA 1S1WA 5AZJB 4BC5A 5GAHP 1TAUA 5JMVA 4XIUA 1QNAA 2O8DB 3EE8A 1NLVA 3DYAA 3DJCA 4CEBA 1WJWA 3KTUA 4NXMK 3LDSA 2GTDA 5B8HA 1C47A 3MN6A 1YVUA 2ZWHA 4RW8A 2P9PA 4BJUA 2JWKA 3TWHA 4ELUA 2E4LA 3NGZA 2I5JA 4H0YB 3OBWA 4IL8A 5TKWA 2D5RA 2P9NB 2DKDA 1NGMA 4BQLA 3QESA 3W0LA 3ZSOA 3PX4A 5BN8A 3IH7A 4BC4A 4CK3A 3DLEA 4LSLA 5HL7L 1HLUA 2E5LK 1E42A 1N8RO 4IBNA 1UT7A 3GL1A 5BMPA 1KY6A 4GW6A 1QN3A 2Q0RA 5CYQA 3QINA 4J2DA 1P5DX 3VENA 5FPNA 1BIUA 3D2EB 5AQXA 4W5OA 1XWLA 4BRHA 3O8MA 1GLEG 1C0UA 2ETJA 2G8WA 3AY9A 3J81O 4OKJA 1X9SA 1C9BB 4KREA 3U3GA 4OKEA 1VQON 5ADXH 2KLAA 1Z6RA 3KK7A 5JLFA 4CK2A 1BCMA 3OYIA 1X9WA 1NNEA 5LL6Z 1UT4A 1JLCA 1KLNA 4B8AB 2QWLA 1M3HA 4FJHA 2A41A 2PFUA 4B3RK 4DR7K 1UWBA 2NOEA 4H03B 4G9ZA 3MN5A 5D3GA 1WSJA 3VOVA 4IOCL 3H08A 4EAJA 3AVKA 5C25A 2PYJA 1EWRA 3SK3A 4H0PA 1QQCA 4JD2B 1QZ5A 4BE1A 2F96A 4JI8K 2V8QA 2YNHA 1NWKA 4C8KA 5HRPA 3WXMB 4A2BA 1XMQK 2YKMA 1KD1O 2GX9A 4C8NA 1DTQA 4PKHA 5BR8K 3MEDA 3QDKA 2HL9A 4LY7A 3W3DA 4RWTA 3RMDA 4BQZA 4PUOA 5DM6L 1SKWA 3SMSA 3A2FA 4JN4A 3VTHA 4DQ8A 1Y97A 4GY2B 3OYFA 4CVNE 4JKHA 4CFAA 2Y1IA 5I9EB 4M63C 4C8MA 2DFFA 2YI1A 2F9WA 4H4MA 3KVGA 2FUVA 2VCPA 3LAKA 2KQ2A 1U2VB 3SZ2A 3F73A 2DFEA 3FZKA 4DSFA 1YJWN 2WUSA 4BVPA 4R79A 1D9DA 2QEXN 4Z4FA 3BF1A 3DLKA 4JKCA 4HHTA 1QHAA 3AA4A 3RR7A 4CZMA 4DV5K 1T6AA 3NVMA 1QN7A 3QEXA 4DSLA 3G4SN 1HYSA 5JVGL 2QREA 4FVMA 4K43A 4B8CA 4H0VB 3CG7A 2CH5A 3ZLJA 3THWA 1C0MA 4CEEA 2O4GA 4CEAA 4LF9K 1HNVA 1QNBA 2Z0FA 5KRSA 1NVPA 4AQYK 4CZGA 2ASMA 3OYHA 3VA0A 1JLAA 4WE1A 2KZMA 1ZBHA 3D0PA 2JGUA 3NF6A 5CZ1A 4HTLA 3BEXA 2E2OA 4M41A 2FBTA 1D4XA 3F5TA 5LJVA 3OJUA 3V9WA 1TK0A 2YCHA 1WAJA 2Y8QA 5EU7A 4CF0A 4C7PA 1BGXT 4A5BA 3OGDA 2R7YA 1EBMA 3NVKA 2I5WA 2ITMA 3MCPA 3ID6A 4MDAA 1LWWA 3BGRA 3M5RA 4DB3A 1T6CA 4F2SA 4JK8A 2FBYA 5AQVA 4KB1A 2YHYA 5HROA 1NH2A 4DR1K 3AVBA 4H8KA 4O4GA 5CY4A 1RDWX 1YXQA 4Q0BA 1P8ZA 3T1AA 1S9EA 1RT5A 3SV3A 3SLCA 1ZBSA 4DCHA 3HJFA 2KTQA 3AV9A 5JICA 3ZSVA 1HRHA 3HRGA 4IFYA 4HCCA 4DLGA 2DKAA 4H5RA 1LV5A 3TR8A 2VYPA 3OYDA 3D7EO 3WQUA 5AFUA 3U8XA 1TYQA 5CHIA 4KH4A 4M7YA 4MRQA 2JLEA 3NBPA 1LCUA 3HP9A 3VN5A 3OBYA 5C2FA 4MLHA 5M1NA 1ASUA 1K8KB 1IJJA 3HVTA 2XRIA 1N6QA 1E4GT 4CZFA
chains in the Genus database with same CATH topology
3KLFA 5C42A 1I39A 4WZSD 4KFBA 4O0IA 3QLHA 4E0DA 4CFCA 1HQEA 3RMAA 1YTUA 1SL0A 3TARA 3DLRA 4KB0A 2XHIA 3C6TA 1KY7A 3AVAA 4DQRA 4BDPA 1C1BA 4MQ3A 1NK0A 1GOCA 3RWUA 3ZT4A 4PQUA 3AVHA 4DWIA 3EIKA 3SCXA 4DQQA 4DTMA 4ICLA 1XC9A 1U45A 1WSGA 2YHBA 4DSKA 1W9HA 4FJ9A 1RDAA 3MXJA 2KFNA 2PY5A 1ASVA 1UAXA 3DLGA 1BQMA 3DRPA 1TBAB 3OS2A 4CHNA 3K5NA 1L3TA 3NE6A 1QSSA 3AVMA 1NJZA 4DF4A 4KHNA 2RF2A 3VQ4A 1RT4A 3K5MA 3TAQA 1SL2A 1JLFA 3LWMA 3VA3A 3AVLA 3F9KA 4I9LA 1IKWA 2NOZA 3SUOA 1BHLA 1QSYA 2OA8A 3CM6A 2HHXA 4O55A 3L2UA 1KFDA 3VQ7A 4ELTA 1BI4A 5JS1A 3V1RA 1DTTA 1FK9A 2ZD1A 4FLUA 1BI4B 2OPQA 1N3AA 1YQMA 4O0JA 3I0SA 5SZTA 1RTIA 2YKNA 4KHWA 4CGJA 1VTOA 3TAPA 4CEDA 3I0XA 1KRPA 4ELVA 4JRQA 4J2BA 3JYTA 2YH5A 4E7HA 4KAZA 4CHPA 1HMVA 4JRPA 3C94A 1HQUA 3P5JA 1NOZA 1N3CA 4O5BA 4CF9A 4OGCA 4M42A 4DU4A 3SUNA 2Z1HA 1REVA 1HJRA 2G8KA 4FK0A 3FFIA 3MEGA 1TBPA 2BE2A 1RBSA 5K14A 3OYAA 2QK9A 1HYVA 1S5JA 1SV5A 2HVHA 4F3OA 1S6PA 3ZSXA 3AA3A 3HSTB 3ZSRA 4AHUA 1WSIA 4CJEA 4OPKA 2XY7A 4M3YA 1FN7A 4QAGA 2D0CA 5DMRA 3SJJA 2YNIA 3N89A 4I2PA 4CGGA 4KKOA 4DFPA 1C6VA 1FKPA 1KVAA 1F21A 3DI6A 3SNSA 3M8RA 4HUFA 1LWVA 4RW6A 3V9SA 3QEPA 3ZCMA 2OPRA 2G30A 1S6QA 2HZMA 1VSIA 3KIOA 5FDLA 4CIGA 4DULA 4JS5A 1ZBLA 5SWMA 2LAEA 4M3UA 2HZSA 1QN4A 3V9ZA 2E6LA 3NH2A 5J2MA 4UQGA 1RBTA 4W5RA 3NGIA 1DLOA 1QTPA 1EKEA 2HHSA 2NOFA 1SL1A 3TAMA 3VQ6A 1JXBA 5HRSA 4AILC 3KLIA 5DK5A 5I3UA 4FLVA 3H1ZA 4AH9A 1C1CA 1D8YA 2QKKA 2YNGA 1RT3A 2B6AA 2ZQBA 4C8LA 1KYUA 1CDWA 4IG3A 1Z25A 2ZE2A 4BWJA 4BE0A 3THVA 4E7IA 1VOKA 1QN9A 3LZIA 2HVIA 3SI6A 4FJNA 1S1TA 1UOCA 3IS9A 3RRHA 3HT3A 3L2RA 1RT1A 3AVCA 1LWFA 1T7PA 3AVFA 2VG5A 2E6MA 4ID1A 4IKFA 3D45A 3TI0A 2D0AA 4FLYA 1L3SA 3HS9A 2BANA 1NK5A 2DTUA 4M3WA 1JLEA 3RMBA 4KO0A 2OYQA 3L8BA 4GMJB 1G15A 1ZYQA 1KVCA 3O4QA 3WNHA 4E1NA 3OS1A 4F4KA 2IC3A 3DOKA 2FGTA 4PY5A 1VSLA 2NOLA 1XHXA 3ZSQA 1NJWA 2OPSA 1A5VA 1TKDA 4B9SA 5IYBP 1IH7A 1M3QA 4CIEA 3HPOA 1WNSA 2BDPA 2IAJA 4RW9A 2YHAA 3I0RA 1Z26A 3O4NA 3JSMA 5J1EA 3KRMA 2IGIA 3L3VA 1EX4A 3NDKA 2WONA 4BACA 3ISNC 3AO1A 4HCBA 3QEVA 4FZXC 5HRRA 3TAGA 1BL3A 4I2QA 1CZ9A 3KK3A 3CFRA 1WLJA 3M8PA 3HO1A 4FZZA 4CHYA 3RR8A 1VRTA 1KFSA 3OS0A 2X78A 3NFAA 3S3MA 2DFHA 2HMIA 3TANA 4RW7A 3NH1A 4DTSA 2X6NA 1Q8IA 4FLTA 4OVLA 4CEOA 5J2NA 3OYJA 3V81A 1RTJA 3CYMA 3AVGA 3KLEA 2XY6A 1QHTA 2Z1IA 3KD1E 3UIQA 2RN2A 2MJ7A 1X1PA 4ROCB 2B5JA 3M8QA 5JS2A 1JLBA 3VQ9A 3OYEA 3HM9A 3VQQA 4FLZA 3PY8A 4KHYA 2HHQA 4CJ4A 2AJQA 1RBRA 1WSFA 2HW3A 3I0WA 3QEWA 1MP9A 3KTQA 4Z4HA 2KZZA 3OSTA 4FLXA 4FZYA 3P83D 4RW4A 1RILA 1RDCA 4DLEA 3ULXA 2P1JA 1KSPA 4BDYA 1R0AA 3OC3C 3LP3A 2EHGA 4HVJA 3K58A 1EETA 3EY1A 4FJ5A 2XY8A 4CF1A 3AA2A 1AISA 4AHRA 4DG1A 4E7JA 3TABA 4E7LA 3ZSYA 4ID5A 4BWMA 1NK9A 1NKCA 1W80A 3V1QA 3QIOA 4CHZA 3DRSA 1JXEA 3DPTA 3C95A 3TAEA 3SV4A 1IG9A 1BQNA 4FW1A 3L2WA 4DTUA 2G8IA 2KFZA 4HTUA 4EP5A 4M3XA 2Z1JA 3K2PA 2Z1GA 3L3UA 4OKKA 2ITGA 3VQBA 4DU3A 4DFKA 2VJ0A 1VRUA 3V9UA 3LP0A 2WOMA 4IDKA 1NKBA 1W0HA 3ITHA 2G8FA 5FRMA 3HXMA 4CESA 4BDZA 2Y1JA 3S3OA 1QTMA 1EXQA 2X74A 3KK1A 1T8EA 4C8OA 1VSDA 1L3UA 1J9AA 4NCGA 1KLMA 2VWJA 3CQ8A 1S1WA 4EZ9A 3V4IA 2VG6A 4CJTA 1WSHA 1KCFA 3LANA 3DRRA 4E1MA 4ZTFA 4FJJA 1TAUA 3QIPA 4CHQA 1RDDA 3QETA 1BCOA 3P1GA 3KLHA 2D0BA 3DLBA 4CCHA 4Z4GA 3OVNA 4XIUA 2X6SA 1QNAA 4CF8A 1TL1A 4ZTJA 4DS5A 3DYAA 3AA5X 4FK2A 1VSJA 4CEBA 3KTUA 3LDSA 2HNZA 1ZBIA 3SPZA 4CJPA 3V1OA 1YVUA 3MEEA 4EJZA 4RW8A 4AHVA 2RKIA 4W5QA 3ULDA 3TWHA 5HBMA 4CE9A 4KI4A 1JL2A 4ELUA 1YTAA 2E4LA 2A1RA 3NGZA 3QEIA 2I5JA 2OPPA 1LWCA 3RMCA 1FKOA 2NUBA 3KKRA 3WNFA 4KHQA 4FXDA 1GOBA 2D5RA 2VG7A 3KKSA 1FXXA 4KTZA 4NYFA 4E19A 3EYZA 1D9FA 1NGMA 1B9DA 2GBZA 4ROEB 3BDPA 3PO4A 4YNQA 3QESA 1U4BA 1VK0A 2Q3SA 3SYZA 4JS4A 2IOCA 3PX4A 3ZSOA 3M8SA 1L5UA 2P5OA 1JL1A 4DTPA 4LH5A 3F0ZA 3IH7A 4FJKA 3HK2A 4KV8A 4CK3A 4EJYA 1C0TA 3DLEA 4LSLA 1PZDA 4LH4A 3QERA 1E42A 4CERA 3LPUA 4IBNA 4CEFA 3CFOA 1UT7A 4DSEA 3MXIA 1GOAA 1NKEA 4DQIA 1KVBA 1KY6A 4GW6A 3B6OA 4GVMA 3KLGA 1TK5A 1T05A 1QN3A 5CYQA 3SUPA 3QINA 2FBXA 3VQ8A 4J2DA 5FROA 3HPHA 1JKHA 2HB5A 3HYFA 1NK8A 3SQ1A 2DY4A 1BIUA 1NK7A 2G8VA 3ZT3A 1QTSA 4CJSA 4W5OA 1KO9A 1J5OA 1XWLA 4KRFA 3AVNA 1C0UA 3NCIA 2ETJA 2XY5A 1TK8A 2G8WA 5AN4A 3NAEA 4DFJA 3DM2A 4OKJA 1X9SA 3NHGA 1C9BB 4OLBA 4KREA 3U3GA 4BE2A 4PA1A 1IKYA 4K8XA 4OKEA 1VSEA 3HPGA 3LALA 4CIFA 1JLQA 2QXFA 1NJXA 1I3AA 3OYCA 3OYKA 1EP4A 3DLHA 2Z8UA 4CK2A 1BCMA 3OYIA 4IG0A 1X9WA 4FJLA 1UT4A 1JLCA 3LP2A 5IYCP 1KLNA 1QN8A 4B8AB 3LPTA 4Q11A 1VSFA 1M3HA 5CYMA 4FJHA 4FCYA 5CZ2A 1UWBA 4B3OA 3U3YA 3PX0A 4EZ6A 4FJMA 1QS4A 4E7KA 2NOEA 1SKSA 2KW4A 4CJLA 5D3GA 1WSJA 4DSJA 3EZ5A 3VQPA 3U6FA 2HHUA 4CGFA 1MU2A 3H08A 5C24A 3SUQA 1U49A 1CXUA 3AVKA 5C25A 1RCHA 4G1QA 2PYJA 4FK4A 1IKXA 1B92A 1QQCA 5HRNA 4Q5VA 3NF7A 4NYNA 1KYDA 1SUQA 1XI1A 1RT7A 4B9LA 4BE1A 1D3UA 4CJRA 2F96A 2OZMA 1WN7A 3IG1A 4CGDA 1YTBA 2YNHA 1LW0A 2YV0X 4JLHA 3SQ0A 3OYNA 1ASWA 4Y1DA 4C8KA 5HRPA 4OJRA 1QE1A 3OYBA 3VQCA 3AO5A 3NH0A 4AHSA 2YKMA 4KTWA 1JFIC 1KTQA 1QN5A 2PYLA 2NOIA 4C8NA 4RG8A 4CFBA 4LSNA 4DTRA 1DTQA 4Z4IA 1IKVA 3SQ4A 4AHCA 3LP1A 4CJQA 3MEDA 4DTNA 3NF8A 2MZ8A 4CJWA 4TSXA 4FJIA 4J2AA 1YQLA 4CJ3A 3ASMA 4LD0A 3K59A 1U48A 4TPSA 2IS3A 3PV8A 2PZSA 4DTXA 4LY7A 4I8OA 4W5TA 3L2QA 4QOZB 4FYDA 4J2EA 3T19A 2OZSA 1HNIA 4DSIA 3RMDA 4NCBA 3VQEA 4NCAA 3PUFA 4PUOA 1RTHA 1CZBA 4I7FA 4FJ7A 2HNYA 2GUIA 5J2QA 4FJXA 4RODB 1SKWA 4DS4A 3A2FA 1QSLA 3DMJA 4KTQA 1IO2A 4B9VA 1Y97A 3C6UA 3OYFA 4CJVA 3K5OA 4CFAA 2Y1IA 4CJ5A 1RBUA 4C8MA 3TAFA 2DFFA 4CFDA 1LAWA 4H4MA 4Z0UA 5J2PA 3F10A 1LAVA 2IDOA 3AVJA 1Q9XA 2A1SA 4L8RB 4M3TA 2F8SA 3LAKA 2KQ2A 4FJ8A 1TKZA 3WNEA 1U47A 4E3SA 3IAYA 4CJKA 2O3OA 3SZ2A 4KHSA 2W42A 1QNCA 1CXQA 2LSNA 2DFEA 5KGWA 3ZSZA 3F73A 4DSFA 3OCIA 1NJYA 4E89A 2HHVA 1TKXA 1ITGA 4M3ZA 2BGGA 1YQRA 1LWYA 4M45A 3SNNA 1YQKA 3MXMA 3QNOA 3ALYA 4KPYA 1D9DA 2NOBA 4Z4FA 3DLKA 4CECA 2P51A 1TVRA 2XO7A 4HHTA 4DQSA 2RPIA 4OGEA 4DMNA 5IYDP 3OSMA 3AA4A 1NK6A 1Q9YA 1HYZA 3RR7A 2O4IA 4CGIA 4IFVA 4Z4CA 3L2VA 5I42A 2FC0A 1A5WA 3RTVA 1TL3A 1UA1A 1A5XA 3MAQA 3T3FA 1QN7A 1LWEA 4FW2A 3QEXA 4B9TA 4ZHRA 3PX6A 3WNGA 4DSLA 5HP1A 1HYSA 2G8HA 1QNEA 4FVMA 1PCZA 2FBVA 4DF8A 3ZT1A 1BIZA 2EX3A 3OYMA 4B8CA 3CG7A 1YTFA 4O44A 4H4OA 4F2RA 4KI6A 2QKBA 4PWDA 4CK1A 1O1WA 1J53A 1C0MA 1VSKA 4CEEA 4FM1A 4DQPA 4B08A 3ZT2A 5FRNA 3O3GA 3ZSWA 2O4GA 4N56A 4CEAA 3B6PA 1HNVA 1QNBA 3AO4A 3OY9A 3G10A 4HUGA 5KRSA 1NVPA 1WSEA 1T03A 5KGXA 5E41A 3RPJA 3VQ5A 3OYHA 3LZJA 3VA0A 1L3VA 1VOLB 1K6YA 3AO3A 1NK4A 2F8TA 1JLAA 4WE1A 2KZMA 2YNFA 1X9MA 3LAMA 4K8ZA 3VQDA 1ZBHA 4Q0BA 3E01A 2JOIA 2B4JA 3AVIA 3D0PA 1RDBA 2IV9A 1S1VA 1JLGA 2JGUA 3NF9A 3NF6A 5CZ1A 1RT2A 4M3RA 4CGHA 4OPJA 4CJFA 4M41A 2FBTA 1RBVA 1SKRA 4MFBA 3V6DA 4F8RA 3KK2A 4FM0A 1CLQA 3OJUA 4CJUA 3V9WA 1TK0A 1YT3A 3ZT0A 1WAJA 5EU7A 4CF0A 4I9QA 2VWKA 3HS8A 1BGXT 2ATQA 2XHBA 2R7YA 3S9HA 1EBMA 3DPUA 2I5WA 1S1XA 3O3HA 2HHTA 3VQAA 3HVRA 3AO2A 1VTLE 1LWWA 3BGRA 3CFPA 1BISA 4CEQA 4B0AA 3OYLA 4Z4EA 3G0ZA 4HUEA 5HLFA 4N41A 4QCLA 1RTDA 4F2SA 2FBYA 2P5GA 5KI6A 4KB1A 1C1AA 1ZBUA 5HROA 1NH2A 4CF2A 3OJSA 3AVBA 3IRXA 3CM5A 4H8KA 3S3NA 4O4GA 4R5PA 5CY4A 4W5NA 3DOLA 1B9FA 1UA0A 1HU0A 1N39A 4EP4A 3T1AA 5KRTA 1S9EA 1RT6A 3OYGA 2G8UA 3PO5A 1RT5A 4AHTA 1D5AA 4FLWA 1S1UA 4N47A 3QO9A 3SV3A 1NOYA 3HL8A 3SQ2A 3RRGA 3HJFA 4FM2A 4DTOA 1WAFA 3AV9A 3SPYA 2KTQA 3NGYA 4OLAA 1TAQA 1KYFA 3K57A 2HHWA 2GV9A 1R4XA 3ZSVA 4YFUA 3LWLA 1RM1A 3K5LA 3KD5E 1HRHA 1VSMA 4IFYA 1XHZA 2IV8A 1QN6A 4DLGA 4DU1A 4HCCA 1RNHA 4F3TA 1U04A 4B9UA 5KTQA 1TGHA 1LV5A 3TR8A 2HNDA 1TKTA 3MECA 4N5SA 3OYDA 1J54A 3QNNA 4N76A 4FJGA 1TV6A 2JLEA 3NBPA 3HP9A 1N5YA 3V9XA 4CHOA 3VN5A 2NOHA 1LW2A 4B9NA 1ASUA 3HVTA 1ZBFA 4Y1CA 2XRIA 3KJVA 3I8DA 4DTJA 1N6QA 4CEZA 4DFMA 3HP6A 1B9KA 1S9GA 5T7BA 4KHUA 4B9MA 1HPZA 3O3FA 1VSHA 1TGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLF A;  5C42 A;  1I39 A;  4WZS D;  4KFB A;  4O0I A;  3QLH A;  4E0D A;  4CFC A;  1HQE A;  3RMA A;  1YTU A;  1SL0 A;  3TAR A;  3DLR A;  4KB0 A;  3C6T A;  1KY7 A;  3AVA A;  4DQR A;  4BDP A;  1C1B A;  4MQ3 A;  1NK0 A;  1GOC A;  3RWU A;  3ZT4 A;  4PQU A;  3AVH A;  4DWI A;  3EIK A;  3SCX A;  4DQQ A;  4DTM A;  4ICL A;  1XC9 A;  1U45 A;  1WSG A;  2YHB A;  4DSK A;  1W9H A;  4FJ9 A;  1RDA A;  3MXJ A;  2KFN A;  2PY5 A;  1ASV A;  1UAX A;  3DLG A;  1BQM A;  3DRP A;  1TBA B;  3OS2 A;  4CHN A;  3K5N A;  1L3T A;  3NE6 A;  1QSS A;  3AVM A;  1NJZ A;  4DF4 A;  4KHN A;  2RF2 A;  3VQ4 A;  1RT4 A;  3K5M A;  3TAQ A;  1SL2 A;  1JLF A;  3LWM A;  3VA3 A;  3AVL A;  3F9K A;  4I9L A;  1IKW A;  3SUO A;  1QSY A;  1BHL A;  2OA8 A;  3CM6 A;  2HHX A;  4O55 A;  3L2U A;  1KFD A;  3VQ7 A;  4ELT A;  1BI4 A;  5JS1 A;  3V1R A;  1DTT A;  1FK9 A;  2ZD1 A;  4FLU A;  1BI4 B;  2OPQ A;  4O0J A;  3I0S A;  5SZT A;  1RTI A;  2YKN A;  4KHW A;  4CGJ A;  1VTO A;  3TAP A;  4CED A;  1KRP A;  4ELV A;  4JRQ A;  4J2B A;  3JYT A;  4E7H A;  4KAZ A;  4CHP A;  1HMV A;  4JRP A;  3C94 A;  1HQU A;  3P5J A;  1NOZ A;  4O5B A;  4CF9 A;  4M42 A;  4OGC A;  4DU4 A;  3SUN A;  2Z1H A;  1REV A;  1HJR A;  2G8K A;  4FK0 A;  3FFI A;  3MEG A;  1TBP A;  2BE2 A;  1RBS A;  5K14 A;  3OYA A;  2QK9 A;  1HYV A;  1S5J A;  1SV5 A;  2HVH A;  4F3O A;  1S6P A;  3ZSX A;  3AA3 A;  3HST B;  3ZSR A;  4AHU A;  1WSI A;  4CJE A;  4OPK A;  2XY7 A;  4M3Y A;  4QAG A;  2D0C A;  5DMR A;  3SJJ A;  2YNI A;  4I2P A;  4CGG A;  4KKO A;  4DFP A;  1C6V A;  1FKP A;  1KVA A;  1F21 A;  3DI6 A;  3M8R A;  4HUF A;  3V9S A;  3QEP A;  4RW6 A;  4B9V A;  3ZCM A;  2OPR A;  2G30 A;  1S6Q A;  3KIO A;  1VSI A;  5FDL A;  4CIG A;  4JS5 A;  1ZBL A;  5SWM A;  4M3U A;  1QN4 A;  3V9Z A;  2E6L A;  3NH2 A;  5J2M A;  4UQG A;  1RBT A;  4W5R A;  3NGI A;  1DLO A;  1QTP A;  1EKE A;  2HHS A;  1SL1 A;  3TAM A;  3VQ6 A;  1JXB A;  5HRS A;  4AIL C;  3KLI A;  5DK5 A;  5I3U A;  4FLV A;  3H1Z A;  4AH9 A;  1C1C A;  1D8Y A;  2QKK A;  2YNG A;  1RT3 A;  2B6A A;  2ZQB A;  4C8L A;  1KYU A;  1CDW A;  4IG3 A;  1Z25 A;  2ZE2 A;  4BWJ A;  4BE0 A;  3THV A;  4E7I A;  1VOK A;  1QN9 A;  3LZI A;  2HVI A;  3SI6 A;  4FJN A;  1S1T A;  1UOC A;  3IS9 A;  3RRH A;  3HT3 A;  3L2R A;  1RT1 A;  3AVC A;  1LWF A;  1T7P A;  3AVF A;  2VG5 A;  2E6M A;  4ID1 A;  4IKF A;  3D45 A;  3TI0 A;  2D0A A;  4FLY A;  1L3S A;  3HS9 A;  2BAN A;  1NK5 A;  2DTU A;  4M3W A;  1JLE A;  3RMB A;  4KO0 A;  2OYQ A;  3L8B A;  4GMJ B;  1G15 A;  1ZYQ A;  1KVC A;  3O4Q A;  3WNH A;  4E1N A;  3OS1 A;  4F4K A;  2IC3 A;  3DOK A;  4PY5 A;  1VSL A;  3ZSQ A;  1XHX A;  1NJW A;  2OPS A;  1A5V A;  1TKD A;  4B9S A;  5IYB P;  1IH7 A;  4CIE A;  3HPO A;  1WNS A;  2BDP A;  2IAJ A;  4RW9 A;  2YHA A;  3I0R A;  1Z26 A;  3O4N A;  3JSM A;  5J1E A;  2IGI A;  3L3V A;  3NDK A;  1EX4 A;  4BAC A;  2WON A;  4HCB A;  3ISN C;  3AO1 A;  3QEV A;  4FZX C;  5HRR A;  3TAG A;  1BL3 A;  4I2Q A;  1CZ9 A;  3KK3 A;  3CFR A;  1WLJ A;  3M8P A;  3HO1 A;  4FZZ A;  4CHY A;  3RR8 A;  1VRT A;  1KFS A;  3OS0 A;  2X78 A;  3NFA A;  3S3M A;  2DFH A;  2HMI A;  3TAN A;  4RW7 A;  3NH1 A;  4DTS A;  2X6N A;  1Q8I A;  4FLT A;  4OVL A;  4CEO A;  5J2N A;  3OYJ A;  3V81 A;  1RTJ A;  3CYM A;  3AVG A;  3KLE A;  2XY6 A;  1QHT A;  2Z1I A;  3KD1 E;  3UIQ A;  2RN2 A;  2MJ7 A;  1X1P A;  4ROC B;  2B5J A;  3M8Q A;  5JS2 A;  1JLB A;  3VQ9 A;  3OYE A;  3HM9 A;  3VQQ A;  4FLZ A;  3PY8 A;  4KHY A;  2HHQ A;  4CJ4 A;  2AJQ A;  1RBR A;  1WSF A;  2HW3 A;  3QEW A;  1MP9 A;  3KTQ A;  4Z4H A;  2KZZ A;  4FLX A;  4FZY A;  3P83 D;  4RW4 A;  1RIL A;  1RDC A;  4DLE A;  2P1J A;  1KSP A;  4BDY A;  1R0A A;  3OC3 C;  3LP3 A;  2EHG A;  4HVJ A;  3K58 A;  1EET A;  3EY1 A;  4FJ5 A;  2XY8 A;  4CF1 A;  3AA2 A;  1AIS A;  4AHR A;  4DG1 A;  4E7J A;  3TAB A;  4E7L A;  3ZSY A;  4ID5 A;  4BWM A;  1NK9 A;  1NKC A;  1W80 A;  3V1Q A;  3QIO A;  4CHZ A;  3DRS A;  1JXE A;  3C95 A;  3TAE A;  3SV4 A;  1IG9 A;  1BQN A;  4FW1 A;  3L2W A;  4DTU A;  2G8I A;  2KFZ A;  4HTU A;  4EP5 A;  4M3X A;  2Z1J A;  3K2P A;  2Z1G A;  3L3U A;  4OKK A;  2ITG A;  3VQB A;  4DU3 A;  4DFK A;  2VJ0 A;  1VRU A;  3V9U A;  3LP0 A;  2WOM A;  4IDK A;  1NKB A;  1W0H A;  3ITH A;  2G8F A;  5FRM A;  3HXM A;  4CES A;  4BDZ A;  2Y1J A;  3S3O A;  1QTM A;  1EXQ A;  2X74 A;  3KK1 A;  1T8E A;  4C8O A;  1VSD A;  1L3U A;  1J9A A;  4NCG A;  1KLM A;  2VWJ A;  3CQ8 A;  1S1W A;  4EZ9 A;  3V4I A;  2VG6 A;  4CJT A;  1WSH A;  1KCF A;  3LAN A;  3DRR A;  4E1M A;  4ZTF A;  4FJJ A;  1TAU A;  3QIP A;  4CHQ A;  1RDD A;  3QET A;  1BCO A;  3P1G A;  3KLH A;  2D0B A;  3DLB A;  4CCH A;  4Z4G A;  3OVN A;  4XIU A;  2X6S A;  1QNA A;  4CF8 A;  1TL1 A;  4ZTJ A;  4DS5 A;  3DYA A;  3AA5 X;  4FK2 A;  1VSJ A;  4CEB A;  3LDS A;  1ZBI A;  2HNZ A;  3SPZ A;  4CJP A;  3V1O A;  1YVU A;  3MEE A;  4RW8 A;  4AHV A;  2RKI A;  4W5Q A;  3ULD A;  3TWH A;  5HBM A;  4CE9 A;  4KI4 A;  1JL2 A;  4ELU A;  1YTA A;  2E4L A;  2A1R A;  3NGZ A;  3QEI A;  2I5J A;  2OPP A;  1LWC A;  3RMC A;  1FKO A;  2NUB A;  3KKR A;  3WNF A;  4KHQ A;  4FXD A;  1GOB A;  2D5R A;  2VG7 A;  3KKS A;  1FXX A;  4KTZ A;  4NYF A;  4E19 A;  3EYZ A;  1D9F A;  1NGM A;  1B9D A;  2GBZ A;  4ROE B;  3BDP A;  3PO4 A;  4YNQ A;  3QES A;  1U4B A;  1VK0 A;  2Q3S A;  3SYZ A;  4JS4 A;  2IOC A;  3PX4 A;  3ZSO A;  3M8S A;  1L5U A;  2P5O A;  1JL1 A;  4DTP A;  4LH5 A;  4FJK A;  3HK2 A;  4KV8 A;  4CK3 A;  3DLE A;  1C0T A;  4LSL A;  1PZD A;  4LH4 A;  3QER A;  1E42 A;  4CER A;  3LPU A;  4IBN A;  4CEF A;  3CFO A;  3MXI A;  4DSE A;  1GOA A;  1NKE A;  4DQI A;  1KVB A;  1KY6 A;  4GW6 A;  3B6O A;  4GVM A;  3KLG A;  1TK5 A;  1T05 A;  1QN3 A;  5CYQ A;  3SUP A;  3QIN A;  2FBX A;  3VQ8 A;  4J2D A;  5FRO A;  3HPH A;  1JKH A;  2HB5 A;  3HYF A;  1NK8 A;  3SQ1 A;  2DY4 A;  1BIU A;  1NK7 A;  2G8V A;  3ZT3 A;  1QTS A;  4CJS A;  4W5O A;  4KRF A;  1J5O A;  1XWL A;  3AVN A;  1C0U A;  3NCI A;  2ETJ A;  2XY5 A;  1TK8 A;  2G8W A;  3NAE A;  4DFJ A;  3DM2 A;  4OKJ A;  1X9S A;  3NHG A;  1C9B B;  4OLB A;  4KRE A;  3U3G A;  4BE2 A;  4PA1 A;  1IKY A;  4K8X A;  4OKE A;  1VSE A;  3HPG A;  3LAL A;  4CIF A;  1JLQ A;  2QXF A;  1NJX A;  1I3A A;  3OYC A;  3OYK A;  1EP4 A;  3DLH A;  2Z8U A;  4CK2 A;  1BCM A;  3OYI A;  4IG0 A;  1X9W A;  4FJL A;  1JLC A;  3LP2 A;  5IYC P;  1KLN A;  1QN8 A;  4B8A B;  3LPT A;  1VSF A;  5CYM A;  4FJH A;  4FCY A;  5CZ2 A;  1UWB A;  4B3O A;  3U3Y A;  3PX0 A;  4EZ6 A;  4FJM A;  1QS4 A;  4E7K A;  1SKS A;  2KW4 A;  4CJL A;  5D3G A;  1WSJ A;  4DSJ A;  3EZ5 A;  3VQP A;  3U6F A;  2HHU A;  4CGF A;  1MU2 A;  3H08 A;  5C24 A;  3SUQ A;  1U49 A;  1CXU A;  3AVK A;  5C25 A;  1RCH A;  4G1Q A;  2PYJ A;  4FK4 A;  1IKX A;  1B92 A;  1QQC A;  5HRN A;  4Q5V A;  3NF7 A;  4NYN A;  1KYD A;  1SUQ A;  1XI1 A;  1RT7 A;  4B9L A;  4BE1 A;  1D3U A;  4CJR A;  2F96 A;  2OZM A;  1WN7 A;  3IG1 A;  4CGD A;  1YTB A;  2YNH A;  1LW0 A;  2YV0 X;  4JLH A;  3SQ0 A;  3OYN A;  1ASW A;  4Y1D A;  4C8K A;  5HRP A;  4OJR A;  1QE1 A;  3OYB A;  3VQC A;  3AO5 A;  3NH0 A;  4AHS A;  2YKM A;  4KTW A;  1JFI C;  1KTQ A;  1QN5 A;  2PYL A;  4C8N A;  4RG8 A;  4CFB A;  4LSN A;  4DTR A;  1DTQ A;  4Z4I A;  1IKV A;  3SQ4 A;  4AHC A;  3LP1 A;  4CJQ A;  3MED A;  4DTN A;  3NF8 A;  4CJW A;  4TSX A;  4FJI A;  4J2A A;  4CJ3 A;  3ASM A;  4LD0 A;  3K59 A;  1U48 A;  2IS3 A;  3PV8 A;  2PZS A;  4DTX A;  4LY7 A;  4W5T A;  4FYD A;  3L2Q A;  4QOZ B;  4J2E A;  3T19 A;  2OZS A;  1HNI A;  4DSI A;  3RMD A;  4NCB A;  3VQE A;  4NCA A;  3PUF A;  4PUO A;  1RTH A;  1CZB A;  4I7F A;  4FJ7 A;  2HNY A;  2GUI A;  5J2Q A;  4FJX A;  4ROD B;  1SKW A;  4DS4 A;  3A2F A;  1QSL A;  3DMJ A;  4KTQ A;  1IO2 A;  1Y97 A;  3C6U A;  3OYF A;  4CJV A;  3K5O A;  4CFA A;  2Y1I A;  4CJ5 A;  1RBU A;  4C8M A;  3TAF A;  2DFF A;  4CFD A;  1LAW A;  4H4M A;  4Z0U A;  5J2P A;  1LAV A;  2IDO A;  3AVJ A;  1Q9X A;  2A1S A;  4L8R B;  4M3T A;  2F8S A;  3LAK A;  2KQ2 A;  4FJ8 A;  1TKZ A;  3WNE A;  1U47 A;  4E3S A;  3IAY A;  4CJK A;  3SZ2 A;  4KHS A;  2W42 A;  1QNC A;  1CXQ A;  2LSN A;  2DFE A;  5KGW A;  3ZSZ A;  3F73 A;  4DSF A;  3OCI A;  1NJY A;  4E89 A;  2HHV A;  1TKX A;  1ITG A;  4M3Z A;  2BGG A;  4M45 A;  3SNN A;  3MXM A;  3QNO A;  3ALY A;  4KPY A;  1D9D A;  4Z4F A;  3DLK A;  4CEC A;  2P51 A;  1TVR A;  2XO7 A;  4HHT A;  4DQS A;  2RPI A;  4OGE A;  4DMN A;  5IYD P;  3AA4 A;  1NK6 A;  1Q9Y A;  1HYZ A;  3RR7 A;  2O4I A;  4CGI A;  4IFV A;  4Z4C A;  3L2V A;  5I42 A;  2FC0 A;  1A5W A;  3RTV A;  1TL3 A;  1UA1 A;  1A5X A;  3MAQ A;  3T3F A;  1QN7 A;  1LWE A;  4FW2 A;  3QEX A;  4B9T A;  4ZHR A;  3PX6 A;  3WNG A;  4DSL A;  5HP1 A;  1HYS A;  2G8H A;  1QNE A;  4FVM A;  1PCZ A;  2FBV A;  4DF8 A;  3ZT1 A;  1BIZ A;  2EX3 A;  3OYM A;  4B8C A;  3CG7 A;  1YTF A;  4O44 A;  4H4O A;  4F2R A;  4KI6 A;  2QKB A;  4PWD A;  4CK1 A;  1O1W A;  1J53 A;  1C0M A;  1VSK A;  4CEE A;  4FM1 A;  4DQP A;  4B08 A;  3ZT2 A;  5FRN A;  3O3G A;  3ZSW A;  2O4G A;  4N56 A;  4CEA A;  3B6P A;  1HNV A;  1QNB A;  3AO4 A;  3OY9 A;  3G10 A;  4HUG A;  5KRS A;  1NVP A;  1WSE A;  1T03 A;  5KGX A;  5E41 A;  3VQ5 A;  3OYH A;  3LZJ A;  3VA0 A;  1L3V A;  1VOL B;  1K6Y A;  3AO3 A;  1NK4 A;  2F8T A;  1JLA A;  4WE1 A;  2KZM A;  2YNF A;  1X9M A;  3LAM A;  4K8Z A;  3VQD A;  1ZBH A;  3E01 A;  2B4J A;  3AVI A;  3D0P A;  1RDB A;  2IV9 A;  1S1V A;  1JLG A;  2JGU A;  3NF9 A;  3NF6 A;  5CZ1 A;  1RT2 A;  4M3R A;  4CGH A;  4OPJ A;  4CJF A;  4M41 A;  2FBT A;  1RBV A;  1SKR A;  4MFB A;  3V6D A;  4F8R A;  3KK2 A;  4FM0 A;  1CLQ A;  3OJU A;  4CJU A;  3V9W A;  1TK0 A;  1YT3 A;  3ZT0 A;  1WAJ A;  5EU7 A;  4CF0 A;  4I9Q A;  2VWK A;  3HS8 A;  1BGX T;  2ATQ A;  2XHB A;  2R7Y A;  3S9H A;  1S1X A;  3O3H A;  2HHT A;  3VQA A;  3HVR A;  3AO2 A;  1VTL E;  3CFP A;  3BGR A;  1BIS A;  4CEQ A;  4B0A A;  3OYL A;  4Z4E A;  3G0Z A;  4HUE A;  5HLF A;  4N41 A;  4QCL A;  1RTD A;  4F2S A;  2FBY A;  2P5G A;  5KI6 A;  4KB1 A;  1C1A A;  1ZBU A;  5HRO A;  1NH2 A;  4CF2 A;  3OJS A;  3AVB A;  3IRX A;  3CM5 A;  4H8K A;  3S3N A;  4O4G A;  4R5P A;  5CY4 A;  4W5N A;  3DOL A;  1B9F A;  1UA0 A;  4EP4 A;  4Q0B A;  3T1A A;  5KRT A;  1S9E A;  1RT6 A;  3OYG A;  2G8U A;  3PO5 A;  1RT5 A;  4AHT A;  1D5A A;  4FLW A;  1S1U A;  4N47 A;  3QO9 A;  3SV3 A;  1NOY A;  3HL8 A;  3SQ2 A;  3RRG A;  3HJF A;  4FM2 A;  4DTO A;  1WAF A;  3AV9 A;  3SPY A;  2KTQ A;  3NGY A;  4OLA A;  1TAQ A;  1KYF A;  3K57 A;  2HHW A;  2GV9 A;  1R4X A;  3ZSV A;  4YFU A;  3LWL A;  1RM1 A;  3K5L A;  3KD5 E;  1HRH A;  1VSM A;  4IFY A;  1XHZ A;  2IV8 A;  1QN6 A;  4DLG A;  4DU1 A;  4HCC A;  1RNH A;  4F3T A;  1U04 A;  4B9U A;  5KTQ A;  1TGH A;  1LV5 A;  3TR8 A;  2HND A;  1TKT A;  3MEC A;  4N5S A;  3OYD A;  1J54 A;  3QNN A;  4N76 A;  4FJG A;  1TV6 A;  2JLE A;  3NBP A;  3HP9 A;  1N5Y A;  3V9X A;  4CHO A;  3VN5 A;  1LW2 A;  4B9N A;  1ASU A;  3HVT A;  1ZBF A;  4Y1C A;  2XRI A;  3KJV A;  3I8D A;  4DTJ A;  1N6Q A;  4CEZ A;  4DFM A;  3HP6 A;  1B9K A;  1S9G A;  5T7B A;  4KHU A;  4B9M A;  1HPZ A;  3O3F A;  1VSH A;  1TGO A; 
#chains in the Genus database with same CATH topology
 4BR0 A;  1I39 A;  4KFB A;  3QLH A;  4WFA L;  4E0D A;  4FWK A;  3BF3 A;  3DLR A;  2XHI A;  3C6T A;  4JEP A;  1YJN N;  4BDP A;  4XH4 A;  1C1B A;  4MQ3 A;  3QIC A;  4WCE L;  3HOS A;  3MWP A;  1U45 A;  4DSK A;  1WSG A;  2YHB A;  4FJ9 A;  2O8C A;  1HNX K;  2PY5 A;  3CCQ N;  3UB5 A;  1NGG A;  1L3T A;  3H45 C;  3D4V A;  3AVM A;  5BRE A;  4BGB A;  3TSQ A;  3LWM A;  1IKW A;  4FWQ A;  1WBD A;  3ATU A;  3CM6 A;  3SJH A;  2QWR A;  4ELT A;  1NGF A;  1DTT A;  5F2R A;  2ZD1 A;  3AAP A;  4FLU A;  2OPQ A;  1OH6 A;  5SZT A;  4JI1 K;  3FZM A;  4KHW A;  3TAP A;  1KRP A;  3JYT A;  4E7H A;  4KAZ A;  4JRP A;  4BG9 A;  1HQU A;  3IDH A;  4CF9 A;  1NOZ A;  1I94 K;  4M42 A;  4DU4 A;  3SUN A;  1ATR A;  1DIZ A;  4FK0 A;  3FFI A;  3OYA A;  1TBP A;  1EUV A;  3D6R A;  4RTF D;  3CMA N;  3LM9 A;  3E1Y A;  3ZSX A;  4OPK A;  3M1F A;  4QAG A;  5H1S Q;  4KKO A;  3J80 O;  5HOO A;  1KVA A;  3M8R A;  5LY3 A;  3V9S A;  3SNS A;  1K8K A;  3QEP A;  1E4F T;  4RW6 A;  4B9V A;  4M7X A;  2NRH A;  5FDL A;  4CIG A;  4MLE A;  4BRQ A;  4JS5 A;  4M3U A;  1QN4 A;  2EWS A;  5AQT A;  4JKG B;  4DR6 K;  3GOI A;  5LMN K;  1QTP A;  2WFB A;  3VGL A;  1EKE A;  2HHH K;  5I3U A;  4FLV A;  2Q31 A;  1D8Y A;  1KYU A;  1CDW A;  4BE0 A;  1QQN A;  1YHQ N;  1S1T A;  3IS9 A;  2AP1 A;  5AZI A;  3AVF A;  2VG5 A;  2E6M A;  1QQM A;  3THX B;  4FLY A;  1L3S A;  3HS9 A;  2I7P A;  4YOU A;  1H1V A;  3ULE A;  4KO0 A;  3A0I X;  3L8B A;  4GMJ B;  4F4K A;  1DT9 A;  1VQK N;  1VSL A;  3LDO A;  1XHX A;  1TKD A;  4WF9 L;  4YOT A;  1WNS A;  2IAJ A;  2YHA A;  3JSM A;  4LF7 K;  4BRA A;  3L3V A;  3ENO C;  4BAC A;  4HCB A;  3AO1 A;  4L3Q A;  5F0X A;  4FZX C;  3U4L A;  1WLJ A;  2A40 A;  3WXL A;  3NFA A;  1VQL N;  1RDU A;  1J6Z A;  3NH1 A;  4CEO A;  5J2N A;  3CYM A;  5E84 A;  3UIQ A;  1QHT A;  2HOE A;  4ROC B;  2RHK A;  3OYE A;  1JLB A;  1O13 A;  3GE1 A;  3U9Z A;  2AJQ A;  1BG3 A;  4Z4H A;  1P90 A;  3MWT A;  1IV0 A;  1RIL A;  1JJ2 M;  4BDY A;  2ZFD B;  3R8E A;  3LP3 A;  2NWV A;  4AHR A;  4DG1 A;  3TAB A;  3ZSY A;  1NKC A;  1VKL A;  1JXE A;  3C95 A;  3SV4 A;  4F9O A;  3KWG A;  3VMF B;  2FF6 A;  4DTU A;  3T1H K;  1MWK A;  3ZYY X;  5LMU K;  4HTU A;  4FWM A;  4M3X A;  2Z1J A;  4OKK A;  4DU3 A;  4DFK A;  2VJ0 A;  3WEE B;  3CPW M;  2WOM A;  4EHT A;  3VEY A;  3ITH A;  3HXM A;  4CES A;  1HNZ K;  3UE5 A;  4X62 K;  1QTM A;  3KK1 A;  4DV3 K;  1VQ7 N;  3ZET A;  4BRD A;  3V4I A;  2VG6 A;  1KCF A;  2ZJR L;  4ZTF A;  3L0Q A;  4FJJ A;  4CHQ A;  3QET A;  1RDD A;  1YAG A;  4CCH A;  2D0B A;  3DLB A;  4NLB A;  2O8E B;  3BP8 A;  3HBT A;  1GLL O;  5AQP A;  2HNZ A;  4OO1 J;  4AF1 A;  3MEE A;  4JI0 K;  4JKE A;  4EAL A;  4DV2 K;  4W5Q A;  2PAV A;  4B3M K;  3P31 A;  3QEI A;  1LWC A;  4KHQ A;  2V51 B;  1ILY A;  4JI5 K;  4NYF A;  1GOB A;  2VG7 A;  3LDP A;  1FXX A;  4KTZ A;  3EYZ A;  4E19 A;  1ZC6 A;  5GIP A;  4ROE B;  3BDP A;  3HI0 A;  3PO4 A;  4YNQ A;  1U4B A;  3O9Q A;  2Q3S A;  1R59 O;  3Q7C A;  4KBO A;  4FJK A;  1BDG A;  4KV8 A;  4EJY A;  4JHD B;  4BC2 A;  1MWM A;  3CC4 N;  1Q81 O;  4DSE A;  1NKE A;  4DQI A;  3CCE N;  2VGN A;  4LFC K;  3KLG A;  1T05 A;  2H5A X;  4H5V A;  4ILG B;  3SUP A;  4D7R A;  2FBX A;  4V19 S;  5FRO A;  3HPH A;  3TTD A;  3ZT3 A;  1KO9 A;  1J5O A;  3AVN A;  3L6Q A;  4CBU A;  5AN4 A;  4I6M A;  1QVG M;  1IKY A;  5AQF A;  1VSE A;  3HPG A;  3LAL A;  2QXF A;  2VQF K;  5C0Y A;  1I3A A;  4DR5 K;  5EXW A;  4H5T A;  2P9L A;  3MCA B;  4IG0 A;  3P4I A;  3OTO K;  3HM8 A;  3VEO A;  3LP2 A;  2OTL N;  5IYC P;  1HNW K;  3CCL N;  4Q11 A;  3L4I A;  5CZ2 A;  4B3O A;  3U3Y A;  3PX0 A;  4H0T B;  1QS4 A;  4DV6 K;  4E7K A;  3IKM A;  2KW4 A;  4CJL A;  4DSJ A;  3EZ5 A;  2HHU A;  2QRC A;  1MU2 A;  5C24 A;  3KD5 E;  3ULE B;  3CD6 N;  4K0K K;  1JCE A;  1EQY A;  3EZW A;  1NBW A;  3O4W A;  5HRN A;  1T3V A;  3NF7 A;  1SUQ A;  4CJR A;  2OZM A;  1WN7 A;  2YV0 X;  1LW0 A;  4JI6 K;  1ASW A;  4Y1D A;  5CE3 A;  2OCE A;  1VQP N;  2OOX A;  4KTW A;  2NOI A;  4RG8 A;  5ELZ A;  4DTR A;  1HPM A;  1IKV A;  4WQ4 A;  3SQ4 A;  4AHC A;  3A5O C;  4DTN A;  3FGU A;  4YOY A;  4CJW A;  1YQL A;  3EE9 A;  1FJG K;  4TPS A;  3UKR A;  3TE5 A;  4LC9 B;  4J2E A;  1Q18 A;  2E88 A;  3T19 A;  4NCB A;  4NCA A;  4I7F A;  4FJX A;  2HNY A;  2GUI A;  3G25 A;  5J2Q A;  1QSL A;  2QR1 A;  3DMJ A;  4KTQ A;  1NGD A;  2ASP A;  1JDY A;  4CJ5 A;  2UYT A;  3TAF A;  4CFD A;  5BPN A;  1LAW A;  1LAV A;  2F8S A;  1Q9X A;  4WQ4 C;  3RVC A;  3WNE A;  1U47 A;  4E3S A;  3IAY A;  4EAG A;  4EFH A;  3I56 N;  3OCI A;  4E89 A;  2HHV A;  1YQR A;  4M45 A;  3VGM A;  3SNN A;  3ALY A;  4YOX A;  2UXB K;  2KKZ A;  4CEC A;  2P51 A;  1TVR A;  4A62 A;  4DQS A;  2RPI A;  4OGE A;  5IYD P;  5KPR A;  4CGI A;  4C23 A;  3L2V A;  2FC0 A;  1A5W A;  1UA1 A;  3CET A;  3MAQ A;  3T3F A;  3EAY A;  2V7Y A;  4FW2 A;  4B9T A;  4J8F A;  5FPD A;  3PX6 A;  3WNG A;  5AR0 A;  1QNE A;  3T7Z A;  3ZT1 A;  1VQ5 N;  3OYM A;  2O8B A;  4PKG A;  4KI6 A;  4H4O A;  4F2R A;  1O1W A;  4DQP A;  2FLO A;  3ZT2 A;  3B6P A;  3AO4 A;  3CCJ N;  4HUG A;  1T03 A;  3A5N C;  3WQT A;  2QWM A;  1PCJ X;  4WYB A;  5KGX A;  5E41 A;  1HJO A;  3LZJ A;  1L3V A;  1VOL B;  1K6Y A;  4C1N I;  3J7Y P;  1X9M A;  3LAM A;  5FLX O;  3O9U A;  2B4J A;  1RDB A;  1S1V A;  4M3R A;  4GV9 A;  4CJF A;  1V5S A;  2A42 A;  4FM0 A;  1CLQ A;  3DXK B;  4CJU A;  4IWV A;  4JKG A;  3ZEU A;  4I9Q A;  2VWK A;  4PHT X;  2H3G X;  2QW9 A;  3J8A A;  3CCS N;  3O3H A;  2HHT A;  3HVR A;  1VTL E;  4K42 A;  3O5B A;  4Z4E A;  2CH6 A;  4JK9 A;  4HUE A;  4QCL A;  2UUA K;  1RTD A;  5KI6 A;  3CQY A;  5EY4 A;  4JHD A;  3OJS A;  2W6L A;  5AQL A;  3S3N A;  4R5P A;  4AM6 A;  5JN5 A;  1B9F A;  4JI7 K;  4EP4 A;  5KRT A;  3SAF A;  4GKK K;  4IJN A;  3PO5 A;  3RWU A;  4AHT A;  1D5A A;  4GNI A;  1BA0 A;  4FM2 A;  3NGY A;  3JXU A;  3K57 A;  2HHW A;  5AQW A;  1R4X A;  4YFU A;  4LF6 K;  1X3M A;  3K5L A;  1XHZ A;  1VSM A;  4CZJ A;  4DU1 A;  4B9U A;  1TGH A;  1IBK K;  1J54 A;  3OW2 M;  4N76 A;  1ZXO A;  4BRK A;  4X64 K;  3V9X A;  4CHO A;  4QS9 A;  4WQ5 A;  3CWS A;  1ZBF A;  4DTJ A;  1NGI A;  2HF3 A;  2NRX A;  5T7B A;  4JK7 A;  4C1N K;  1VSH A;  4CGD A;  3O3F A;  1TGO A;  4CZH A;  2A3Z A;  5M1F A;  2HKP A;  1Z05 A;  1YIT N;  1YTU A;  5EX5 A;  1KY7 A;  2WBN A;  3AVA A;  4PQU A;  1NK0 A;  3ZT4 A;  4DWI A;  3EIK A;  3CCV N;  4DQQ A;  4EIA A;  1XC9 A;  1ASV A;  1BQM A;  1TBA B;  2JHJ A;  4BR9 A;  1QSS A;  2NNW A;  4FL9 A;  1YIJ N;  1NJZ A;  2P9L B;  1JLF A;  1E3M A;  2NOZ A;  3SUO A;  4JKD A;  4ISF A;  2HHX A;  1KFD A;  1BI4 A;  1S22 A;  1T6D A;  4LFB K;  1Q86 O;  4UY8 O;  1T44 A;  5AQN A;  3QBX A;  4O0J A;  4CGJ A;  3DLL L;  3O9R A;  4DHY A;  4JRQ A;  1HMV A;  2BUP A;  3C94 A;  5BR9 A;  2QI2 A;  2NLV A;  2J4R A;  1N3C A;  4O5B A;  4OGC A;  1WQA A;  1REV A;  1C0F A;  2G8K A;  5K14 A;  2BE2 A;  1K2Y X;  2QK9 A;  1SV5 A;  5AJ3 K;  1NMD A;  4F3O A;  3AA3 A;  3HST B;  4AHU A;  1FN7 A;  5F1X A;  2I7N A;  2QM1 A;  2YNI A;  4I2P A;  4CGG A;  1UL7 A;  2CGL A;  1DGK N;  3F2K A;  3KIO A;  1N33 K;  4WQ5 C;  4AM7 A;  5DM7 L;  3DXK A;  5BRH A;  3NH2 A;  4UQG A;  2QTD A;  4W5R A;  2OAN A;  1DLO A;  2NOF A;  1SL1 A;  5HRS A;  3H1Z A;  4AH9 A;  2QKK A;  2YNG A;  1V4T A;  3LDN A;  4IG3 A;  4BWJ A;  4E7I A;  1QN9 A;  2HVI A;  2E1Z A;  3RRH A;  3L2R A;  3EEQ A;  2ZJP L;  4BRE A;  3GBT A;  4ID1 A;  4PL7 A;  2O8E A;  3VET A;  2D0A A;  5GIN A;  1NK5 A;  3DWL A;  4M3W A;  1JLE A;  1G99 A;  1KVC A;  3O4Q A;  3WNH A;  4E1N A;  2A5X A;  3OS1 A;  4PY5 A;  1NM1 A;  1NJW A;  2OPS A;  4B9S A;  4LFA K;  1K8A O;  5IYB P;  3HPO A;  5BPL A;  2UXD K;  3VGK A;  3QB0 A;  2P9U B;  3FZH A;  3I0R A;  3C04 A;  1EX4 A;  2WON A;  1NGE A;  1BL3 A;  3CFR A;  3KK3 A;  4PKI A;  2IVN A;  3ATV A;  1VRT A;  2P9K B;  1KFS A;  3OS0 A;  2X78 A;  3NMU A;  1VQN N;  3TDH A;  5JVH L;  3ENH A;  4RW7 A;  4FLT A;  4OVL A;  1RTJ A;  4CZK A;  3KD1 E;  1MA9 B;  2RN2 A;  2MJ7 A;  1QQO A;  1X1P A;  3M8Q A;  3VQ9 A;  4FLZ A;  3ID8 A;  4KHY A;  4XEI A;  4FPB A;  1RBR A;  1K9M O;  2HW3 A;  3QEW A;  1MP9 A;  3DXM A;  3P83 D;  3FR0 A;  1KSP A;  2CGK A;  2EHG A;  5FPE A;  4JKB A;  3PLA A;  5AQK A;  1AIS A;  4DV7 K;  2V52 B;  3HTV A;  4ID5 A;  3BY5 A;  4BWM A;  3DRS A;  1S72 N;  3DPT A;  4OX9 K;  4IOX A;  1IG9 A;  1BQN A;  2G8I A;  3BZK A;  2HBM A;  5AQY A;  3VQB A;  1EO1 A;  1VRU A;  3E9L A;  4BR4 A;  4LF4 K;  3LP0 A;  4IDK A;  2W40 A;  4U67 L;  4BRO A;  3CCM N;  1VSD A;  1L3U A;  2VWJ A;  3CQ8 A;  4EZ9 A;  2UUB K;  3CJC A;  1WSH A;  2VQE K;  3R6M A;  4E1M A;  4JNE A;  3QIP A;  3GG4 A;  1BCO A;  3P1G A;  4Z94 A;  3KLH A;  4DV4 K;  2X6S A;  3ZX3 A;  4CF8 A;  3AAR A;  2FXU A;  3NA5 A;  4IEE A;  5IWA K;  2V9J A;  4ZTJ A;  2EHB D;  3H1Q A;  4BRI A;  5KQD A;  1W7A A;  4CJP A;  1OKJ A;  4AHV A;  3K9J A;  4B9Q A;  3ULD A;  5HBM A;  4CE9 A;  2ZGY A;  5BRD A;  4FPA A;  3PIO L;  4FWP A;  1FKO A;  2V92 A;  2NUB A;  3KKR A;  3KKS A;  1D9F A;  4IFE A;  5C2D A;  1B9D A;  2GWK A;  1HKB A;  5AQR A;  4KHP K;  2HBL A;  4H5N A;  4BR5 A;  3SYZ A;  3VER A;  1HKC A;  2IOC A;  2QWN A;  3O6W A;  3VPZ A;  1L5U A;  2V7Z A;  3S41 A;  4LH5 A;  3HK2 A;  1ATS A;  1PZD A;  3QER A;  4CER A;  2E2P A;  3CQX A;  3MXI A;  1KVB A;  4GVM A;  3B6O A;  3EKS A;  3C65 A;  2HST A;  3VQ8 A;  3A5M C;  2YHW A;  3SQ1 A;  3O1W A;  2DY4 A;  1NK7 A;  3FLC O;  3HSC A;  4DV1 K;  4CBX A;  1W97 L;  2WTU A;  3NAE A;  4DFJ A;  2HBK A;  4OLB A;  1BWF O;  3OSE A;  4PA1 A;  4K8X A;  4LF5 K;  5C12 A;  1NJX A;  1HX1 A;  3OYC A;  3OYK A;  1EP4 A;  3DLH A;  5MLC Q;  3C7N A;  1YI2 N;  3WXJ A;  3T4N A;  4BC3 A;  5CYM A;  2YX6 A;  3O9T A;  1NMN A;  4EZ6 A;  3AGR A;  4WX8 A;  4CGF A;  3ZET B;  3SUQ A;  4G1Q A;  2KHO A;  1IKX A;  4CD3 A;  4BG8 A;  4NYN A;  1KYD A;  1RT7 A;  4FO0 A;  4HWI A;  4JLH A;  3F9M A;  3OYN A;  4OJR A;  1QE1 A;  3UKU B;  3OYB A;  4HJH A;  4AHS A;  1QN5 A;  2E20 A;  2PYL A;  2VWB A;  3LP1 A;  4CJQ A;  2P9S B;  3OH6 A;  5M1P A;  1TYQ B;  4TSX A;  4EAI A;  4CJ3 A;  4LD0 A;  3K59 A;  2IS3 A;  3PV8 A;  4DTX A;  1HKG A;  1NGJ A;  4MO4 A;  3L2Q A;  2OZS A;  1CZB A;  4FJ7 A;  4GV6 A;  3U9D A;  3B8A X;  1ATN A;  3C6U A;  4CJV A;  3K5O A;  4FWL A;  1RBU A;  3I33 A;  3VF2 A;  3CWA A;  4YOV A;  3F10 A;  3RSM A;  3AVJ A;  4L8R B;  4M3T A;  3BUZ B;  5BPM A;  4FJ8 A;  1M90 O;  2O3O A;  5AQH A;  1P5G X;  2W42 A;  1CXQ A;  2LSN A;  3ZSZ A;  5LJW A;  1OVY A;  1OH5 A;  3OH9 A;  4M3Z A;  2BGG A;  1LWY A;  2NOB A;  3AAQ A;  4CZE A;  1KAY A;  2ZF5 O;  4DMN A;  5C10 A;  1Q9Y A;  5M1Q A;  2HBJ A;  3CWU A;  4WFN L;  4IFV A;  2Q2R A;  5I42 A;  3MN9 A;  4NLC A;  5EPC A;  3PMG A;  3VF4 A;  3RSE A;  1A5X A;  5C15 A;  4ZHR A;  1TUU A;  2NRV A;  3TSP A;  1SZ2 A;  2NRT A;  3D7Q A;  2FBV A;  1BIZ A;  2EX3 A;  4QG5 A;  3MK6 A;  2QKB A;  4PWD A;  3N4Q A;  3H3N O;  1J53 A;  1VSK A;  5FRN A;  3O3G A;  3ZSW A;  4N56 A;  3OY9 A;  1NG9 A;  3G10 A;  1W2B M;  1WSE A;  3FZF A;  4JI4 K;  3RPJ A;  3AO3 A;  3THW B;  2QXL A;  4K8Z A;  4CZL A;  3VQD A;  3K0S A;  3E01 A;  2JOI A;  3AVI A;  3NF9 A;  1JLG A;  1RT2 A;  1WBB A;  2P9S A;  3WT0 A;  3ENO A;  3VTI A;  1RBV A;  1SKR A;  3V6D A;  3KK2 A;  3TPQ A;  1OH7 A;  1YT3 A;  3ZT0 A;  4DUZ K;  3EO3 A;  3HS8 A;  2ATQ A;  1KAX A;  1S1X A;  4GKJ K;  3E9O A;  5GAG P;  3CFP A;  4JYA K;  2VGM A;  1BIS A;  3SMP A;  3OYL A;  3I55 N;  3G0Z A;  1PCM X;  5HLF A;  1QVF M;  2P5G A;  1C1A A;  4CF2 A;  3IRX A;  4H0X B;  1S3X A;  4JAX A;  3DOL A;  5BMN A;  1UA0 A;  2R5X A;  1HU0 A;  5KL0 A;  2G8U A;  5TKY A;  4FLW A;  1S1U A;  3QO9 A;  1NOY A;  2F9T A;  4DTO A;  3QFP A;  1KYF A;  3WXK A;  4MO5 A;  3LWL A;  3J7Z O;  5EOY A;  2IV8 A;  1QN6 A;  4F3T A;  3H1V X;  2HND A;  1TKT A;  4A57 A;  3MEC A;  5GAD P;  2FKM X;  3QNN A;  3CVT A;  1N5Y A;  4FWR A;  1C0G A;  2NOH A;  1LW2 A;  1HR0 K;  4Y1C A;  4CEZ A;  3HP6 A;  3AGK A;  2IIR A;  4KH6 A;  1B9K A;  1S9G A;  2RE2 A;  4KHU A;  2IVP A;  3KLF A;  5C42 A;  2O8B B;  4WZS D;  4CW7 B;  4O0I A;  4BRM A;  4CFC A;  1XUP O;  5AZJ A;  2QRD A;  4KB0 A;  3SAG A;  4DQR A;  3I3W A;  4JI2 K;  3AVH A;  3SCX A;  4B3T K;  5AZI B;  4RCH A;  4ICL A;  4DTM A;  4A61 A;  3VES A;  3TSU A;  3KZB A;  3OHR A;  2KFN A;  3OS2 A;  3DLG A;  3O1B A;  4BVO A;  3K5N A;  4ISG A;  5GIO A;  2RF2 A;  3VQ4 A;  1RT4 A;  3TAQ A;  3VA3 A;  3AVL A;  3F9K A;  3DAW A;  4I9L A;  1BHL A;  1BU6 O;  2GEM A;  4O55 A;  3VQ7 A;  3FFK B;  1FK9 A;  1BI4 B;  1N3A A;  1YQM A;  2Q0U A;  4CED A;  1SQK A;  2FKF A;  3BKQ X;  3CCU N;  3CJB A;  2AA4 A;  1ESV A;  3P5J A;  1BOT O;  2Z1H A;  1KC8 O;  3MEG A;  4A59 A;  2HF4 A;  1HYV A;  1S5J A;  4B1X B;  3ZX0 A;  3C7N B;  1WSI A;  4QS7 A;  3R1X A;  3OLP A;  3N89 A;  1C6V A;  1FKP A;  3DI6 A;  3SAH A;  2OPR A;  3RSE B;  2HZM A;  1VSI A;  4DUL A;  2FSK A;  1ZBL A;  3EL2 A;  1M5Q 1;  3EN9 A;  3V9Z A;  3ZX2 A;  3EKU A;  3NGI A;  4DV0 K;  4YOW A;  2HHS A;  5KPT A;  2PBD A;  4AIL C;  3VEX A;  3Q7B A;  3KLI A;  5DK5 A;  2BH1 A;  5M1K A;  2JPI A;  4C8L A;  3HOT A;  3THV A;  1Z25 A;  2ZE2 A;  1VOK A;  3LZI A;  3CC7 N;  4FJN A;  3ENC A;  1RT1 A;  1T7P A;  3C6A A;  3TI0 A;  3THX A;  2DTU A;  4B1U B;  2H4L X;  1JCF A;  3CHW A;  2FGT A;  3ZSQ A;  2W6K A;  2UXC K;  1GLD G;  3SBG A;  4FVU A;  3QFU A;  4RW9 A;  3VEV A;  1Z26 A;  5J1E A;  3KRM A;  2IGI A;  1WOQ A;  1VQ9 N;  4B1V A;  4MDB A;  1CZ9 A;  3M8P A;  3N4P A;  4FZZ A;  4CHY A;  3VEW A;  3LL3 A;  2HMI A;  3VEZ A;  3TAN A;  4DTS A;  2X6N A;  1Q8I A;  3PSI A;  4B1Z A;  4YDU C;  3V81 A;  3THY A;  2A6A A;  3QML A;  2E8A A;  2B5J A;  4DKW A;  5JS2 A;  1WB9 A;  4BR2 A;  1X9J A;  2JWL A;  4CJ4 A;  4YDU A;  3KTQ A;  1FW6 A;  4FLX A;  4FZY A;  2IVO A;  4DLE A;  3ULX A;  2P1J A;  4FWS A;  1R0A A;  4FJ5 A;  4HVJ A;  4D7Q A;  1EET A;  2NRZ A;  3R9P A;  3EY1 A;  4CF1 A;  4J2B A;  4E7J A;  3O9S A;  4E7L A;  4CHZ A;  5JLH A;  3VF6 A;  4IOA L;  3TAE A;  1Y64 A;  3L2W A;  3O80 A;  2KFZ A;  1VQM N;  5IT9 O;  3WEE A;  2Z1G A;  2ITG A;  3D2F A;  4K41 A;  1EWQ A;  1PVS A;  2D4W A;  3D2F B;  2Y1J A;  2X74 A;  1T8E A;  4C8O A;  3G6E N;  2F7L A;  1KLM A;  2UUC K;  4CJT A;  3LAN A;  3DRR A;  3IMX A;  4O5F A;  1GLF O;  2CGJ A;  5AQO A;  4Z4G A;  3OVN A;  1TL1 A;  5E26 A;  4DS5 A;  5AQM A;  3AA5 X;  4FK2 A;  1JCG A;  1VSJ A;  3CER A;  2E2N A;  1ZBI A;  3SPZ A;  3V1O A;  2P9K A;  4EJZ A;  1Q7Y O;  2RKI A;  3H46 O;  4KI4 A;  1JL2 A;  1YTA A;  4OPA A;  2A1R A;  2OPP A;  1X3N A;  3RMC A;  3WNF A;  4FXD A;  4CJ7 A;  3HO1 A;  3CWT A;  2ZM6 K;  4EAK A;  2GBZ A;  2NVM A;  3E9P A;  5AFU H;  3CJA A;  1XSZ A;  4JKF A;  1VK0 A;  3CVS A;  4JS4 A;  4YY3 K;  3M8S A;  2P5O A;  3CW7 A;  1JL1 A;  4DTP A;  3F0Z A;  1C0T A;  4LH4 A;  3LPU A;  4CEF A;  3CFO A;  2Q1N A;  1GOA A;  3PDK A;  1K73 O;  3T69 A;  4CBW A;  4FSV A;  1TK5 A;  3CC2 N;  1VHX A;  1BO5 O;  2QWQ A;  4OPH A;  4DR2 K;  1JKH A;  2HB5 A;  3HYF A;  1NK8 A;  1N34 K;  1WUA A;  2G8V A;  1QTS A;  4CJS A;  4KRF A;  1DKG D;  2P9N A;  3NCI A;  4IO8 A;  2XY5 A;  1TK8 A;  1XNQ K;  3CJ9 A;  1C4G A;  3DM2 A;  4NO7 A;  3NHG A;  3CF5 L;  3A5L C;  4BGA A;  1KFI A;  3ENB A;  4BE2 A;  5A2Q O;  4CIF A;  1JLQ A;  1SS6 A;  4EAH D;  3LM2 A;  2Z8U A;  4EHU A;  3JS6 A;  5GAE P;  2Q36 A;  4FJL A;  1LXT A;  1QN8 A;  1XQS C;  3LPT A;  1VSF A;  3O08 A;  4FCY A;  4FJM A;  1YVN A;  3L4Q A;  1J3M A;  1SKS A;  4LF8 K;  2O8D A;  2QWO A;  3VQP A;  3U6F A;  5AQI A;  1VAZ A;  4BRP A;  2UU9 K;  1U49 A;  1CXU A;  1RCH A;  2BTF A;  1B92 A;  5CR4 A;  1OVQ A;  4Q5V A;  2HL8 A;  4BRN A;  1XI1 A;  1YUW A;  1OH8 A;  4B9L A;  1D3U A;  4BR7 A;  3IG1 A;  1YTB A;  3SQ0 A;  1NGC A;  1GLA G;  3VQC A;  3AO5 A;  3NH0 A;  4XH1 A;  1JFI C;  4CZI A;  1KTQ A;  4JKA A;  3UKR B;  4CFB A;  1V4S A;  4LSN A;  3UW2 A;  4Z4I A;  2NRR A;  4ISE A;  1NGH A;  3NF8 A;  2MZ8 A;  4YOR A;  3H3O B;  4FJI A;  1DEJ A;  1U48 A;  3ASM A;  3JAM O;  2PZS A;  4J2A A;  4X66 K;  4I8O A;  4W5T A;  4FYD A;  4QOZ B;  1IBL K;  1HNI A;  1QZ6 A;  2FSN A;  4DSI A;  3VQE A;  3PUF A;  4ILH A;  1RTH A;  3QBW A;  4ROD B;  4DS4 A;  1XMO K;  1IO2 A;  2ZGZ A;  3WXI A;  3R3L A;  3D2E A;  1VQ6 N;  4IDH A;  3K9K A;  4Z0U A;  5J2P A;  2IDO A;  2A1S A;  1NGB A;  1TKZ A;  4H0O A;  4CJK A;  4KHS A;  1RFQ A;  1QNC A;  3FZL A;  5KGW A;  1NJY A;  2E1Y A;  1ITG A;  1TKX A;  1GLC G;  3MXM A;  1YQK A;  3QNO A;  4KPY A;  4BRL A;  3I8B A;  5ADX A;  1N36 K;  2F4V K;  3TTF A;  2XO7 A;  4JV5 K;  3OSM A;  1NK6 A;  1HYZ A;  2O4I A;  4Z4C A;  1XC3 A;  4E1J A;  1SAZ A;  3RTV A;  2OTJ N;  1TL3 A;  1LWE A;  5HP1 A;  4QS8 A;  2O8F B;  2GWJ A;  2G8H A;  1HUX A;  1PCZ A;  4DF8 A;  5AQS A;  4CI6 A;  4O44 A;  1YTF A;  2GUP A;  4CK1 A;  4FM1 A;  3CPE A;  4B08 A;  2Y8L A;  4DUY K;  4IXC A;  2O8F A;  4CFF A;  3VQ5 A;  2F8T A;  1CZA N;  5F9C A;  1NK4 A;  2YNF A;  2ASO A;  2IV9 A;  4CGH A;  4OPJ A;  2E2Q A;  3IFR A;  2NLX A;  3TU5 A;  1MDU B;  2HMP A;  4MFB A;  3CIP A;  4F8R A;  1NU0 A;  4GVE A;  3C6H A;  4X65 K;  3E66 A;  5BRF A;  5AQJ A;  3IUC A;  4BRF A;  1VQ4 N;  3CI5 A;  2XHB A;  3S9H A;  3DPU A;  3VQA A;  3AO2 A;  2ZJQ L;  3KHY A;  4CEQ A;  1KFQ A;  3MN7 A;  4B0A A;  3HZ6 A;  4Y0W A;  4N41 A;  1ZBU A;  3DXM B;  3CM5 A;  5KPZ A;  4W5N A;  1N39 A;  3OYG A;  1RT6 A;  4IZ9 A;  4N47 A;  4JI3 K;  3RRG A;  3HL8 A;  3SQ2 A;  3SPY A;  1WAF A;  3H6E A;  5KQ8 A;  4OLA A;  1TAQ A;  2GV9 A;  2QWP A;  3LDL A;  5AQQ A;  1RM1 A;  5M1O A;  2QA4 N;  1RNH A;  1U04 A;  1TUO A;  5KTQ A;  1GLJ O;  1VQ8 N;  5HSH A;  2OOY A;  3CME N;  4N5S A;  1YJ9 N;  3CJ1 A;  4FJG A;  1TV6 A;  2PWW A;  4B9N A;  1IG8 A;  3KJV A;  2WC9 A;  4DFM A;  1U2V A;  3TTC A;  2P9P B;  4O8U A;  4B9M A;  1HPZ A;  1NGA A;  2NRW A;  3SBT A;  4BRC A;  4WXA A;  1HQE A;  3RMA A;  1SL0 A;  3TAR A;  3MDQ A;  1GOC A;  4H5W A;  5JMV D;  4NB4 A;  1W9H A;  3BZC A;  1RDA A;  3MXJ A;  5FPM A;  1UAX A;  3DRP A;  2QLV A;  3P38 A;  3FE1 A;  4CHN A;  4FWN A;  2DPN A;  3NE6 A;  4KHN A;  4DF4 A;  1K35 A;  3K5M A;  1SL2 A;  4FOI A;  2P9U A;  5BN9 A;  1IBM K;  1QSY A;  4B3S K;  2OA8 A;  2O8C B;  3M6G A;  4A5A A;  3L2U A;  5JS1 A;  3A8Y A;  3V1R A;  4DR3 K;  2FF3 B;  3I0S A;  1RTI A;  2YKN A;  1VTO A;  4CD1 A;  3I0X A;  4ELV A;  1XNR K;  1YF5 L;  2YH5 A;  4CHP A;  1KXP A;  2P9I A;  3CCR N;  4K25 A;  4JD2 A;  3CJ7 A;  1HJR A;  4O8K A;  3THY B;  1RBS A;  2HVH A;  1S6P A;  4CJE A;  3ZSR A;  2XY7 A;  4M3Y A;  2YHX A;  2D0C A;  3KWI A;  5DMR A;  3SJJ A;  4DFP A;  2FSJ A;  4HUF A;  1F21 A;  1LWV A;  3LDQ A;  1N32 K;  3PSF A;  4XH5 A;  3ZCM A;  2G30 A;  1S6Q A;  2D0P A;  5AQG A;  5SWM A;  2LAE A;  5AQZ A;  2HZS A;  2E6L A;  1BA1 A;  5J2M A;  1RBT A;  2GEL A;  1GLB G;  1Q9U A;  1U6Z A;  3TAM A;  3VQ6 A;  1JXB A;  4FWO A;  1KAZ A;  1BUP A;  1C1C A;  1RT3 A;  2B6A A;  2ZQB A;  3MX5 A;  4BY9 C;  3J7A P;  3WUH A;  3UKU A;  1J5E K;  4DR4 K;  3GDQ A;  3SI6 A;  1UOC A;  3HT3 A;  1TUY A;  1LWF A;  3AVC A;  4IKF A;  3D45 A;  3M3Z A;  4IEI A;  2BAN A;  3RMB A;  2W41 A;  4FOE A;  2OYQ A;  1G15 A;  1ZYQ A;  1NJI O;  4B1W B;  4ILJ A;  2IC3 A;  2D1K A;  4WFB L;  3MMV A;  3DOK A;  1MPG A;  2NOL A;  1RGI A;  1A5V A;  2F7T A;  1M3Q A;  1IH7 A;  4CIE A;  3CXC M;  4IO9 L;  3PIP L;  2BDP A;  3O4N A;  1KQS M;  2JHN A;  1LOT B;  2YJE A;  4KH5 A;  3NDK A;  3ISN C;  3QEV A;  5HRR A;  3TAG A;  4I2Q A;  3RR8 A;  3S3M A;  3MX2 A;  1M1K O;  2DFH A;  4U7B A;  3OYJ A;  3KLE A;  3C0B A;  3AVG A;  4A2A A;  2XY6 A;  2Z1I A;  3I8D A;  3HM9 A;  2HHQ A;  3VQQ A;  3PY8 A;  2YA3 A;  3P39 A;  4BRG A;  1WSF A;  3I0W A;  2KZZ A;  3OST A;  2D0O A;  2DKC A;  3OA9 A;  4RW4 A;  1Q82 O;  1RDC A;  4B1Y B;  3OC3 C;  4FK4 A;  3K58 A;  2XY8 A;  4PL8 A;  3AA2 A;  2P9I B;  1NK9 A;  1W80 A;  4IJA A;  3QIO A;  3V1Q A;  4YHH K;  5AQU A;  2YJF A;  4FW1 A;  3ZEU B;  4EP5 A;  3L3U A;  3K2P A;  5EVZ A;  3V9U A;  4GV3 A;  2Q97 A;  3T1Y K;  1NKB A;  1W0H A;  2NZT A;  2G8F A;  5FRM A;  3G71 N;  4BDZ A;  3S3O A;  1EXQ A;  4I6M B;  1J9A A;  4NXN K;  4NCG A;  1S1W A;  5AZJ B;  4BC5 A;  5GAH P;  1TAU A;  5JMV A;  4XIU A;  1QNA A;  2O8D B;  3EE8 A;  1NLV A;  3DYA A;  3DJC A;  4CEB A;  1WJW A;  3KTU A;  4NXM K;  3LDS A;  2GTD A;  5B8H A;  1C47 A;  3MN6 A;  1YVU A;  2ZWH A;  4RW8 A;  2P9P A;  4BJU A;  2JWK A;  3TWH A;  4ELU A;  2E4L A;  3NGZ A;  2I5J A;  4H0Y B;  3OBW A;  4IL8 A;  5TKW A;  2D5R A;  2P9N B;  2DKD A;  1NGM A;  4BQL A;  3QES A;  3W0L A;  3ZSO A;  3PX4 A;  5BN8 A;  3IH7 A;  4BC4 A;  4CK3 A;  3DLE A;  4LSL A;  5HL7 L;  1HLU A;  2E5L K;  1E42 A;  1N8R O;  4IBN A;  1UT7 A;  3GL1 A;  5BMP A;  1KY6 A;  4GW6 A;  1QN3 A;  2Q0R A;  5CYQ A;  3QIN A;  4J2D A;  1P5D X;  3VEN A;  5FPN A;  1BIU A;  3D2E B;  5AQX A;  4W5O A;  1XWL A;  4BRH A;  3O8M A;  1GLE G;  1C0U A;  2ETJ A;  2G8W A;  3AY9 A;  3J81 O;  4OKJ A;  1X9S A;  1C9B B;  4KRE A;  3U3G A;  4OKE A;  1VQO N;  5ADX H;  2KLA A;  1Z6R A;  3KK7 A;  5JLF A;  4CK2 A;  1BCM A;  3OYI A;  1X9W A;  1NNE A;  5LL6 Z;  1UT4 A;  1JLC A;  1KLN A;  4B8A B;  2QWL A;  1M3H A;  4FJH A;  2A41 A;  2PFU A;  4B3R K;  4DR7 K;  1UWB A;  2NOE A;  4H03 B;  4G9Z A;  3MN5 A;  5D3G A;  1WSJ A;  3VOV A;  4IOC L;  3H08 A;  4EAJ A;  3AVK A;  5C25 A;  2PYJ A;  1EWR A;  3SK3 A;  4H0P A;  1QQC A;  4JD2 B;  1QZ5 A;  4BE1 A;  2F96 A;  4JI8 K;  2V8Q A;  2YNH A;  1NWK A;  4C8K A;  5HRP A;  3WXM B;  4A2B A;  1XMQ K;  2YKM A;  1KD1 O;  2GX9 A;  4C8N A;  1DTQ A;  4PKH A;  5BR8 K;  3MED A;  3QDK A;  2HL9 A;  4LY7 A;  3W3D A;  4RWT A;  3RMD A;  4BQZ A;  4PUO A;  5DM6 L;  1SKW A;  3SMS A;  3A2F A;  4JN4 A;  3VTH A;  4DQ8 A;  1Y97 A;  4GY2 B;  3OYF A;  4CVN E;  4JKH A;  4CFA A;  2Y1I A;  5I9E B;  4M63 C;  4C8M A;  2DFF A;  2YI1 A;  2F9W A;  4H4M A;  3KVG A;  2FUV A;  2VCP A;  3LAK A;  2KQ2 A;  1U2V B;  3SZ2 A;  3F73 A;  2DFE A;  3FZK A;  4DSF A;  1YJW N;  2WUS A;  4BVP A;  4R79 A;  1D9D A;  2QEX N;  4Z4F A;  3BF1 A;  3DLK A;  4JKC A;  4HHT A;  1QHA A;  3AA4 A;  3RR7 A;  4CZM A;  4DV5 K;  1T6A A;  3NVM A;  1QN7 A;  3QEX A;  4DSL A;  3G4S N;  1HYS A;  5JVG L;  2QRE A;  4FVM A;  4K43 A;  4B8C A;  4H0V B;  3CG7 A;  2CH5 A;  3ZLJ A;  3THW A;  1C0M A;  4CEE A;  2O4G A;  4CEA A;  4LF9 K;  1HNV A;  1QNB A;  2Z0F A;  5KRS A;  1NVP A;  4AQY K;  4CZG A;  2ASM A;  3OYH A;  3VA0 A;  1JLA A;  4WE1 A;  2KZM A;  1ZBH A;  3D0P A;  2JGU A;  3NF6 A;  5CZ1 A;  4HTL A;  3BEX A;  2E2O A;  4M41 A;  2FBT A;  1D4X A;  3F5T A;  5LJV A;  3OJU A;  3V9W A;  1TK0 A;  2YCH A;  1WAJ A;  2Y8Q A;  5EU7 A;  4CF0 A;  4C7P A;  1BGX T;  4A5B A;  3OGD A;  2R7Y A;  1EBM A;  3NVK A;  2I5W A;  2ITM A;  3MCP A;  3ID6 A;  4MDA A;  1LWW A;  3BGR A;  3M5R A;  4DB3 A;  1T6C A;  4F2S A;  4JK8 A;  2FBY A;  5AQV A;  4KB1 A;  2YHY A;  5HRO A;  1NH2 A;  4DR1 K;  3AVB A;  4H8K A;  4O4G A;  5CY4 A;  1RDW X;  1YXQ A;  4Q0B A;  1P8Z A;  3T1A A;  1S9E A;  1RT5 A;  3SV3 A;  3SLC A;  1ZBS A;  4DCH A;  3HJF A;  2KTQ A;  3AV9 A;  5JIC A;  3ZSV A;  1HRH A;  3HRG A;  4IFY A;  4HCC A;  4DLG A;  2DKA A;  4H5R A;  1LV5 A;  3TR8 A;  2VYP A;  3OYD A;  3D7E O;  3WQU A;  5AFU A;  3U8X A;  1TYQ A;  5CHI A;  4KH4 A;  4M7Y A;  4MRQ A;  2JLE A;  3NBP A;  1LCU A;  3HP9 A;  3VN5 A;  3OBY A;  5C2F A;  4MLH A;  5M1N A;  1ASU A;  1K8K B;  1IJJ A;  3HVT A;  2XRI A;  1N6Q A;  1E4G T;  4CZF A; 
#chains in the Genus database with same CATH homology
 3KLF A;  5C42 A;  1I39 A;  4WZS D;  4KFB A;  4O0I A;  3QLH A;  4E0D A;  4CFC A;  1HQE A;  3RMA A;  1YTU A;  1SL0 A;  3TAR A;  3DLR A;  4KB0 A;  2XHI A;  3C6T A;  1KY7 A;  3AVA A;  4DQR A;  4BDP A;  1C1B A;  4MQ3 A;  1NK0 A;  1GOC A;  3RWU A;  3ZT4 A;  4PQU A;  3AVH A;  4DWI A;  3EIK A;  3SCX A;  4DQQ A;  4DTM A;  4ICL A;  1XC9 A;  1U45 A;  1WSG A;  2YHB A;  4DSK A;  1W9H A;  4FJ9 A;  1RDA A;  3MXJ A;  2KFN A;  2PY5 A;  1ASV A;  1UAX A;  3DLG A;  1BQM A;  3DRP A;  1TBA B;  3OS2 A;  4CHN A;  3K5N A;  1L3T A;  3NE6 A;  1QSS A;  3AVM A;  1NJZ A;  4DF4 A;  4KHN A;  2RF2 A;  3VQ4 A;  1RT4 A;  3K5M A;  3TAQ A;  1SL2 A;  1JLF A;  3LWM A;  3VA3 A;  3AVL A;  3F9K A;  4I9L A;  1IKW A;  2NOZ A;  3SUO A;  1BHL A;  1QSY A;  2OA8 A;  3CM6 A;  2HHX A;  4O55 A;  3L2U A;  1KFD A;  3VQ7 A;  4ELT A;  1BI4 A;  5JS1 A;  3V1R A;  1DTT A;  1FK9 A;  2ZD1 A;  4FLU A;  1BI4 B;  2OPQ A;  1N3A A;  1YQM A;  4O0J A;  3I0S A;  5SZT A;  1RTI A;  2YKN A;  4KHW A;  4CGJ A;  1VTO A;  3TAP A;  4CED A;  3I0X A;  1KRP A;  4ELV A;  4JRQ A;  4J2B A;  3JYT A;  2YH5 A;  4E7H A;  4KAZ A;  4CHP A;  1HMV A;  4JRP A;  3C94 A;  1HQU A;  3P5J A;  1NOZ A;  1N3C A;  4O5B A;  4CF9 A;  4OGC A;  4M42 A;  4DU4 A;  3SUN A;  2Z1H A;  1REV A;  1HJR A;  2G8K A;  4FK0 A;  3FFI A;  3MEG A;  1TBP A;  2BE2 A;  1RBS A;  5K14 A;  3OYA A;  2QK9 A;  1HYV A;  1S5J A;  1SV5 A;  2HVH A;  4F3O A;  1S6P A;  3ZSX A;  3AA3 A;  3HST B;  3ZSR A;  4AHU A;  1WSI A;  4CJE A;  4OPK A;  2XY7 A;  4M3Y A;  1FN7 A;  4QAG A;  2D0C A;  5DMR A;  3SJJ A;  2YNI A;  3N89 A;  4I2P A;  4CGG A;  4KKO A;  4DFP A;  1C6V A;  1FKP A;  1KVA A;  1F21 A;  3DI6 A;  3SNS A;  3M8R A;  4HUF A;  1LWV A;  4RW6 A;  3V9S A;  3QEP A;  3ZCM A;  2OPR A;  2G30 A;  1S6Q A;  2HZM A;  1VSI A;  3KIO A;  5FDL A;  4CIG A;  4DUL A;  4JS5 A;  1ZBL A;  5SWM A;  2LAE A;  4M3U A;  2HZS A;  1QN4 A;  3V9Z A;  2E6L A;  3NH2 A;  5J2M A;  4UQG A;  1RBT A;  4W5R A;  3NGI A;  1DLO A;  1QTP A;  1EKE A;  2HHS A;  2NOF A;  1SL1 A;  3TAM A;  3VQ6 A;  1JXB A;  5HRS A;  4AIL C;  3KLI A;  5DK5 A;  5I3U A;  4FLV A;  3H1Z A;  4AH9 A;  1C1C A;  1D8Y A;  2QKK A;  2YNG A;  1RT3 A;  2B6A A;  2ZQB A;  4C8L A;  1KYU A;  1CDW A;  4IG3 A;  1Z25 A;  2ZE2 A;  4BWJ A;  4BE0 A;  3THV A;  4E7I A;  1VOK A;  1QN9 A;  3LZI A;  2HVI A;  3SI6 A;  4FJN A;  1S1T A;  1UOC A;  3IS9 A;  3RRH A;  3HT3 A;  3L2R A;  1RT1 A;  3AVC A;  1LWF A;  1T7P A;  3AVF A;  2VG5 A;  2E6M A;  4ID1 A;  4IKF A;  3D45 A;  3TI0 A;  2D0A A;  4FLY A;  1L3S A;  3HS9 A;  2BAN A;  1NK5 A;  2DTU A;  4M3W A;  1JLE A;  3RMB A;  4KO0 A;  2OYQ A;  3L8B A;  4GMJ B;  1G15 A;  1ZYQ A;  1KVC A;  3O4Q A;  3WNH A;  4E1N A;  3OS1 A;  4F4K A;  2IC3 A;  3DOK A;  2FGT A;  4PY5 A;  1VSL A;  2NOL A;  1XHX A;  3ZSQ A;  1NJW A;  2OPS A;  1A5V A;  1TKD A;  4B9S A;  5IYB P;  1IH7 A;  1M3Q A;  4CIE A;  3HPO A;  1WNS A;  2BDP A;  2IAJ A;  4RW9 A;  2YHA A;  3I0R A;  1Z26 A;  3O4N A;  3JSM A;  5J1E A;  3KRM A;  2IGI A;  3L3V A;  1EX4 A;  3NDK A;  2WON A;  4BAC A;  3ISN C;  3AO1 A;  4HCB A;  3QEV A;  4FZX C;  5HRR A;  3TAG A;  1BL3 A;  4I2Q A;  1CZ9 A;  3KK3 A;  3CFR A;  1WLJ A;  3M8P A;  3HO1 A;  4FZZ A;  4CHY A;  3RR8 A;  1VRT A;  1KFS A;  3OS0 A;  2X78 A;  3NFA A;  3S3M A;  2DFH A;  2HMI A;  3TAN A;  4RW7 A;  3NH1 A;  4DTS A;  2X6N A;  1Q8I A;  4FLT A;  4OVL A;  4CEO A;  5J2N A;  3OYJ A;  3V81 A;  1RTJ A;  3CYM A;  3AVG A;  3KLE A;  2XY6 A;  1QHT A;  2Z1I A;  3KD1 E;  3UIQ A;  2RN2 A;  2MJ7 A;  1X1P A;  4ROC B;  2B5J A;  3M8Q A;  5JS2 A;  1JLB A;  3VQ9 A;  3OYE A;  3HM9 A;  3VQQ A;  4FLZ A;  3PY8 A;  4KHY A;  2HHQ A;  4CJ4 A;  2AJQ A;  1RBR A;  1WSF A;  2HW3 A;  3I0W A;  3QEW A;  1MP9 A;  3KTQ A;  4Z4H A;  2KZZ A;  3OST A;  4FLX A;  4FZY A;  3P83 D;  4RW4 A;  1RIL A;  1RDC A;  4DLE A;  3ULX A;  2P1J A;  1KSP A;  4BDY A;  1R0A A;  3OC3 C;  3LP3 A;  2EHG A;  4HVJ A;  3K58 A;  1EET A;  3EY1 A;  4FJ5 A;  2XY8 A;  4CF1 A;  3AA2 A;  1AIS A;  4AHR A;  4DG1 A;  4E7J A;  3TAB A;  4E7L A;  3ZSY A;  4ID5 A;  4BWM A;  1NK9 A;  1NKC A;  1W80 A;  3V1Q A;  3QIO A;  4CHZ A;  3DRS A;  1JXE A;  3DPT A;  3C95 A;  3TAE A;  3SV4 A;  1IG9 A;  1BQN A;  4FW1 A;  3L2W A;  4DTU A;  2G8I A;  2KFZ A;  4HTU A;  4EP5 A;  4M3X A;  2Z1J A;  3K2P A;  2Z1G A;  3L3U A;  4OKK A;  2ITG A;  3VQB A;  4DU3 A;  4DFK A;  2VJ0 A;  1VRU A;  3V9U A;  3LP0 A;  2WOM A;  4IDK A;  1NKB A;  1W0H A;  3ITH A;  2G8F A;  5FRM A;  3HXM A;  4CES A;  4BDZ A;  2Y1J A;  3S3O A;  1QTM A;  1EXQ A;  2X74 A;  3KK1 A;  1T8E A;  4C8O A;  1VSD A;  1L3U A;  1J9A A;  4NCG A;  1KLM A;  2VWJ A;  3CQ8 A;  1S1W A;  4EZ9 A;  3V4I A;  2VG6 A;  4CJT A;  1WSH A;  1KCF A;  3LAN A;  3DRR A;  4E1M A;  4ZTF A;  4FJJ A;  1TAU A;  3QIP A;  4CHQ A;  1RDD A;  3QET A;  1BCO A;  3P1G A;  3KLH A;  2D0B A;  3DLB A;  4CCH A;  4Z4G A;  3OVN A;  4XIU A;  2X6S A;  1QNA A;  4CF8 A;  1TL1 A;  4ZTJ A;  4DS5 A;  3DYA A;  3AA5 X;  4FK2 A;  1VSJ A;  4CEB A;  3KTU A;  3LDS A;  2HNZ A;  1ZBI A;  3SPZ A;  4CJP A;  3V1O A;  1YVU A;  3MEE A;  4EJZ A;  4RW8 A;  4AHV A;  2RKI A;  4W5Q A;  3ULD A;  3TWH A;  5HBM A;  4CE9 A;  4KI4 A;  1JL2 A;  4ELU A;  1YTA A;  2E4L A;  2A1R A;  3NGZ A;  3QEI A;  2I5J A;  2OPP A;  1LWC A;  3RMC A;  1FKO A;  2NUB A;  3KKR A;  3WNF A;  4KHQ A;  4FXD A;  1GOB A;  2D5R A;  2VG7 A;  3KKS A;  1FXX A;  4KTZ A;  4NYF A;  4E19 A;  3EYZ A;  1D9F A;  1NGM A;  1B9D A;  2GBZ A;  4ROE B;  3BDP A;  3PO4 A;  4YNQ A;  3QES A;  1U4B A;  1VK0 A;  2Q3S A;  3SYZ A;  4JS4 A;  2IOC A;  3PX4 A;  3ZSO A;  3M8S A;  1L5U A;  2P5O A;  1JL1 A;  4DTP A;  4LH5 A;  3F0Z A;  3IH7 A;  4FJK A;  3HK2 A;  4KV8 A;  4CK3 A;  4EJY A;  1C0T A;  3DLE A;  4LSL A;  1PZD A;  4LH4 A;  3QER A;  1E42 A;  4CER A;  3LPU A;  4IBN A;  4CEF A;  3CFO A;  1UT7 A;  4DSE A;  3MXI A;  1GOA A;  1NKE A;  4DQI A;  1KVB A;  1KY6 A;  4GW6 A;  3B6O A;  4GVM A;  3KLG A;  1TK5 A;  1T05 A;  1QN3 A;  5CYQ A;  3SUP A;  3QIN A;  2FBX A;  3VQ8 A;  4J2D A;  5FRO A;  3HPH A;  1JKH A;  2HB5 A;  3HYF A;  1NK8 A;  3SQ1 A;  2DY4 A;  1BIU A;  1NK7 A;  2G8V A;  3ZT3 A;  1QTS A;  4CJS A;  4W5O A;  1KO9 A;  1J5O A;  1XWL A;  4KRF A;  3AVN A;  1C0U A;  3NCI A;  2ETJ A;  2XY5 A;  1TK8 A;  2G8W A;  5AN4 A;  3NAE A;  4DFJ A;  3DM2 A;  4OKJ A;  1X9S A;  3NHG A;  1C9B B;  4OLB A;  4KRE A;  3U3G A;  4BE2 A;  4PA1 A;  1IKY A;  4K8X A;  4OKE A;  1VSE A;  3HPG A;  3LAL A;  4CIF A;  1JLQ A;  2QXF A;  1NJX A;  1I3A A;  3OYC A;  3OYK A;  1EP4 A;  3DLH A;  2Z8U A;  4CK2 A;  1BCM A;  3OYI A;  4IG0 A;  1X9W A;  4FJL A;  1UT4 A;  1JLC A;  3LP2 A;  5IYC P;  1KLN A;  1QN8 A;  4B8A B;  3LPT A;  4Q11 A;  1VSF A;  1M3H A;  5CYM A;  4FJH A;  4FCY A;  5CZ2 A;  1UWB A;  4B3O A;  3U3Y A;  3PX0 A;  4EZ6 A;  4FJM A;  1QS4 A;  4E7K A;  2NOE A;  1SKS A;  2KW4 A;  4CJL A;  5D3G A;  1WSJ A;  4DSJ A;  3EZ5 A;  3VQP A;  3U6F A;  2HHU A;  4CGF A;  1MU2 A;  3H08 A;  5C24 A;  3SUQ A;  1U49 A;  1CXU A;  3AVK A;  5C25 A;  1RCH A;  4G1Q A;  2PYJ A;  4FK4 A;  1IKX A;  1B92 A;  1QQC A;  5HRN A;  4Q5V A;  3NF7 A;  4NYN A;  1KYD A;  1SUQ A;  1XI1 A;  1RT7 A;  4B9L A;  4BE1 A;  1D3U A;  4CJR A;  2F96 A;  2OZM A;  1WN7 A;  3IG1 A;  4CGD A;  1YTB A;  2YNH A;  1LW0 A;  2YV0 X;  4JLH A;  3SQ0 A;  3OYN A;  1ASW A;  4Y1D A;  4C8K A;  5HRP A;  4OJR A;  1QE1 A;  3OYB A;  3VQC A;  3AO5 A;  3NH0 A;  4AHS A;  2YKM A;  4KTW A;  1JFI C;  1KTQ A;  1QN5 A;  2PYL A;  2NOI A;  4C8N A;  4RG8 A;  4CFB A;  4LSN A;  4DTR A;  1DTQ A;  4Z4I A;  1IKV A;  3SQ4 A;  4AHC A;  3LP1 A;  4CJQ A;  3MED A;  4DTN A;  3NF8 A;  2MZ8 A;  4CJW A;  4TSX A;  4FJI A;  4J2A A;  1YQL A;  4CJ3 A;  3ASM A;  4LD0 A;  3K59 A;  1U48 A;  4TPS A;  2IS3 A;  3PV8 A;  2PZS A;  4DTX A;  4LY7 A;  4I8O A;  4W5T A;  3L2Q A;  4QOZ B;  4FYD A;  4J2E A;  3T19 A;  2OZS A;  1HNI A;  4DSI A;  3RMD A;  4NCB A;  3VQE A;  4NCA A;  3PUF A;  4PUO A;  1RTH A;  1CZB A;  4I7F A;  4FJ7 A;  2HNY A;  2GUI A;  5J2Q A;  4FJX A;  4ROD B;  1SKW A;  4DS4 A;  3A2F A;  1QSL A;  3DMJ A;  4KTQ A;  1IO2 A;  4B9V A;  1Y97 A;  3C6U A;  3OYF A;  4CJV A;  3K5O A;  4CFA A;  2Y1I A;  4CJ5 A;  1RBU A;  4C8M A;  3TAF A;  2DFF A;  4CFD A;  1LAW A;  4H4M A;  4Z0U A;  5J2P A;  3F10 A;  1LAV A;  2IDO A;  3AVJ A;  1Q9X A;  2A1S A;  4L8R B;  4M3T A;  2F8S A;  3LAK A;  2KQ2 A;  4FJ8 A;  1TKZ A;  3WNE A;  1U47 A;  4E3S A;  3IAY A;  4CJK A;  2O3O A;  3SZ2 A;  4KHS A;  2W42 A;  1QNC A;  1CXQ A;  2LSN A;  2DFE A;  5KGW A;  3ZSZ A;  3F73 A;  4DSF A;  3OCI A;  1NJY A;  4E89 A;  2HHV A;  1TKX A;  1ITG A;  4M3Z A;  2BGG A;  1YQR A;  1LWY A;  4M45 A;  3SNN A;  1YQK A;  3MXM A;  3QNO A;  3ALY A;  4KPY A;  1D9D A;  2NOB A;  4Z4F A;  3DLK A;  4CEC A;  2P51 A;  1TVR A;  2XO7 A;  4HHT A;  4DQS A;  2RPI A;  4OGE A;  4DMN A;  5IYD P;  3OSM A;  3AA4 A;  1NK6 A;  1Q9Y A;  1HYZ A;  3RR7 A;  2O4I A;  4CGI A;  4IFV A;  4Z4C A;  3L2V A;  5I42 A;  2FC0 A;  1A5W A;  3RTV A;  1TL3 A;  1UA1 A;  1A5X A;  3MAQ A;  3T3F A;  1QN7 A;  1LWE A;  4FW2 A;  3QEX A;  4B9T A;  4ZHR A;  3PX6 A;  3WNG A;  4DSL A;  5HP1 A;  1HYS A;  2G8H A;  1QNE A;  4FVM A;  1PCZ A;  2FBV A;  4DF8 A;  3ZT1 A;  1BIZ A;  2EX3 A;  3OYM A;  4B8C A;  3CG7 A;  1YTF A;  4O44 A;  4H4O A;  4F2R A;  4KI6 A;  2QKB A;  4PWD A;  4CK1 A;  1O1W A;  1J53 A;  1C0M A;  1VSK A;  4CEE A;  4FM1 A;  4DQP A;  4B08 A;  3ZT2 A;  5FRN A;  3O3G A;  3ZSW A;  2O4G A;  4N56 A;  4CEA A;  3B6P A;  1HNV A;  1QNB A;  3AO4 A;  3OY9 A;  3G10 A;  4HUG A;  5KRS A;  1NVP A;  1WSE A;  1T03 A;  5KGX A;  5E41 A;  3RPJ A;  3VQ5 A;  3OYH A;  3LZJ A;  3VA0 A;  1L3V A;  1VOL B;  1K6Y A;  3AO3 A;  1NK4 A;  2F8T A;  1JLA A;  4WE1 A;  2KZM A;  2YNF A;  1X9M A;  3LAM A;  4K8Z A;  3VQD A;  1ZBH A;  4Q0B A;  3E01 A;  2JOI A;  2B4J A;  3AVI A;  3D0P A;  1RDB A;  2IV9 A;  1S1V A;  1JLG A;  2JGU A;  3NF9 A;  3NF6 A;  5CZ1 A;  1RT2 A;  4M3R A;  4CGH A;  4OPJ A;  4CJF A;  4M41 A;  2FBT A;  1RBV A;  1SKR A;  4MFB A;  3V6D A;  4F8R A;  3KK2 A;  4FM0 A;  1CLQ A;  3OJU A;  4CJU A;  3V9W A;  1TK0 A;  1YT3 A;  3ZT0 A;  1WAJ A;  5EU7 A;  4CF0 A;  4I9Q A;  2VWK A;  3HS8 A;  1BGX T;  2ATQ A;  2XHB A;  2R7Y A;  3S9H A;  1EBM A;  3DPU A;  2I5W A;  1S1X A;  3O3H A;  2HHT A;  3VQA A;  3HVR A;  3AO2 A;  1VTL E;  1LWW A;  3BGR A;  3CFP A;  1BIS A;  4CEQ A;  4B0A A;  3OYL A;  4Z4E A;  3G0Z A;  4HUE A;  5HLF A;  4N41 A;  4QCL A;  1RTD A;  4F2S A;  2FBY A;  2P5G A;  5KI6 A;  4KB1 A;  1C1A A;  1ZBU A;  5HRO A;  1NH2 A;  4CF2 A;  3OJS A;  3AVB A;  3IRX A;  3CM5 A;  4H8K A;  3S3N A;  4O4G A;  4R5P A;  5CY4 A;  4W5N A;  3DOL A;  1B9F A;  1UA0 A;  1HU0 A;  1N39 A;  4EP4 A;  3T1A A;  5KRT A;  1S9E A;  1RT6 A;  3OYG A;  2G8U A;  3PO5 A;  1RT5 A;  4AHT A;  1D5A A;  4FLW A;  1S1U A;  4N47 A;  3QO9 A;  3SV3 A;  1NOY A;  3HL8 A;  3SQ2 A;  3RRG A;  3HJF A;  4FM2 A;  4DTO A;  1WAF A;  3AV9 A;  3SPY A;  2KTQ A;  3NGY A;  4OLA A;  1TAQ A;  1KYF A;  3K57 A;  2HHW A;  2GV9 A;  1R4X A;  3ZSV A;  4YFU A;  3LWL A;  1RM1 A;  3K5L A;  3KD5 E;  1HRH A;  1VSM A;  4IFY A;  1XHZ A;  2IV8 A;  1QN6 A;  4DLG A;  4DU1 A;  4HCC A;  1RNH A;  4F3T A;  1U04 A;  4B9U A;  5KTQ A;  1TGH A;  1LV5 A;  3TR8 A;  2HND A;  1TKT A;  3MEC A;  4N5S A;  3OYD A;  1J54 A;  3QNN A;  4N76 A;  4FJG A;  1TV6 A;  2JLE A;  3NBP A;  3HP9 A;  1N5Y A;  3V9X A;  4CHO A;  3VN5 A;  2NOH A;  1LW2 A;  4B9N A;  1ASU A;  3HVT A;  1ZBF A;  4Y1C A;  2XRI A;  3KJV A;  3I8D A;  4DTJ A;  1N6Q A;  4CEZ A;  4DFM A;  3HP6 A;  1B9K A;  1S9G A;  5T7B A;  4KHU A;  4B9M A;  1HPZ A;  3O3F A;  1VSH A;  1TGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...