1JFIC

Crystal structure of the nc2-tbp-dna ternary complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
SHMSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*TP*TP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*TP*CP*
publication title Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1jfiC01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1jfiC02
3EIKA 5IYCP 1QN5A 2D0AA 1KYDA 1QN8A 4ROEB 1KYFA 1R4XA 1VOKA 4B0AA 3HS9A 3H1ZA 1YTBA 1QNEA 3HS8A 1QNAA 4ROCB 1QTSA 4WZSD 1PZDA 1JFIC 2Z8UA 1KY7A 1QN3A 1QN7A 1QNCA 1QTPA 5IYDP 1TGHA 1PCZA 1W80A 1VTLE 1NH2A 1C9BB 1QN6A 1YTFA 1MP9A 1B9KA 1VTOA 1NGMA 3OC3C 1E42A 2MJ7A 1RM1A 1CDWA 2G30A 1TBPA 3OCIA 1D3UA 2VJ0A 2D0BA 1KYUA 1QNBA 3VN5A 1NVPA 1VOLB 4PY5A 2IV8A 3ASMA 1KY6A 4RODB 1AISA 1TBAB 2IV9A 1QN4A 5IYBP 1QN9A 2D0CA
chains in the Genus database with same CATH superfamily
4IL8A 2FKFA 1K35A 1QN5A 2O3OA 1PCMX 1KYDA 4B0AA 3D4VA 3H1ZA 2Z0FA 3CW7A 4EAGA 4ROCB 1V5SA 1QTSA 3ENOC 3TE5A 1KY7A 1QN3A 2DKCA 2ZFDB 1QTPA 2QRDA 4EALA 1VTLE 4MRQA 4D7QA 4EJZA 2NOIA 2MJ7A 3I0WA 1Q9UA 3ENCA 1TBPA 2EHBD 3DPUA 3OCIA 2FUVA 1D3UA 1LWVA 1UL7A 1QNBA 2NOFA 1VOLB 1LXTA 1P5DX 2IV8A 5AN4A 1UT7A 1KFQA 2NOBA 2NOLA 1C47A 5IYBP 3OH9A 1QN9A 5F9CA 4WXAA 2PWWA 5JMVD 1VOKA 2NLVA 4I8OA 4TPSA 1JDYA 1YTBA 3CWSA 2NVMA 3PDKA 3CVSA 1JFIC 5HSHA 4EAJA 2YA3A 4HJHA 1M3QA 2JPIA 2MZ8A 2YH5A 3KTUA 1UT4A 1YTFA 1WJWA 1E42A 2JHNA 1CDWA 2NOHA 2G30A 2LAEA 2VJ0A 3NA5A 1FN7A 3VN5A 1KFIA 3BKQX 2HL8A 2NWVA 3ASMA 3CWAA 1YQKA 1C4GA 1LWYA 4RODB 2IV9A 1N3AA 4C7PA 2D0CA 2H4LX 3OH6A 2QRCA 3D7QA 3EIKA 5JN5A 3KRMA 5IYCP 1J3MA 3CWTA 3DPTA 3IH7A 2D0AA 1YQMA 4EJYA 3HS9A 1PVSA 3C04A 3HS8A 2QREA 4QG5A 1QNAA 2V9JA 2NOEA 3CVTA 2HZMA 3OGDA 1MPGA 3N89A 1XSZA 4DULA 1YQLA 2QR1A 2XHIA 1K2YX 5BMNA 2Y8LA 1HU0A 1B9KA 2DKDA 1VTOA 1NGMA 3OC3C 1RM1A 5BMPA 1KYUA 4EAIA 2HZSA 1NVPA 4Q11A 4WX8A 3RPJA 3RSMA 5EPCA 3I0XA 5KL0A 1KY6A 2QLVA 3PMGA 1AISA 2NOZA 1QNEA 1TGHA 2H5AX 3I3WA 4D7RA 1EBMA 2Y8QA 3OSTA 1VKLA 1YQRA 3EAYA 1PCJX 1QN8A 4ROEB 1KYFA 1R4XA 3F0ZA 2I5WA 3TDHA 2R5XA 2OOXA 3CWUA 2JHJA 2OOYA 1TUOA 4WZSD 1M5Q1 1PZDA 2F7LA 2Z8UA 5IYDP 1P5GX 1QN7A 2HL9A 1N39A 1QNCA 2DKAA 3SNSA 1T6AA 1PCZA 1W80A 2V92A 3F10A 3ULXA 1NH2A 1LWWA 1C9BB 1MP9A 1DIZA 1QN6A 2HKPA 4CFFA 4PY5A 2FKMX 3OSMA 2D0BA 2V8QA 1WQAA 1EUVA 3OSEA 1N3CA 2JOIA 4BJUA 1KO9A 3UW2A 1TBAB 4EAKA 1M3HA 1QN4A 3OLPA 3T4NA 2FGTA
chains in the Genus database with same CATH topology
1QN5A 2O3OA 1KYDA 4B0AA 3H1ZA 4ROCB 1QTSA 1KY7A 1QN3A 1QTPA 1VTLE 4EJZA 2NOIA 2MJ7A 3I0WA 1D3UA 1TBPA 3DPUA 3OCIA 1LWVA 2NOFA 1QNBA 1VOLB 2IV8A 5AN4A 1UT7A 2NOBA 2NOLA 5IYBP 1QN9A 1VOKA 4I8OA 4TPSA 1YTBA 1JFIC 1M3QA 2MZ8A 2YH5A 3KTUA 1YTFA 1UT4A 1E42A 1CDWA 2NOHA 2G30A 2LAEA 2VJ0A 1FN7A 3VN5A 3ASMA 1YQKA 1LWYA 4RODB 2IV9A 1N3AA 2D0CA 3EIKA 3KRMA 5IYCP 3DPTA 3IH7A 2D0AA 1YQMA 4EJYA 3HS9A 3HS8A 1QNAA 2NOEA 2HZMA 3N89A 4DULA 1YQLA 2XHIA 1HU0A 1B9KA 1VTOA 1NGMA 3OC3C 1RM1A 1KYUA 2HZSA 1NVPA 4Q11A 3RPJA 3I0XA 1KY6A 1AISA 2NOZA 1QNEA 1TGHA 1EBMA 3OSTA 1YQRA 1QN8A 4ROEB 1KYFA 1R4XA 3F0ZA 2I5WA 4WZSD 1PZDA 2Z8UA 5IYDP 1QN7A 1N39A 1QNCA 3SNSA 1PCZA 1W80A 3F10A 1NH2A 3ULXA 1LWWA 1C9BB 1QN6A 1MP9A 4PY5A 3OSMA 2D0BA 1N3CA 2JOIA 1KO9A 1TBAB 1M3HA 1QN4A 2FGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIK A;  5IYC P;  1QN5 A;  2D0A A;  1KYD A;  1QN8 A;  4ROE B;  1KYF A;  1R4X A;  1VOK A;  4B0A A;  3HS9 A;  3H1Z A;  1YTB A;  1QNE A;  3HS8 A;  1QNA A;  4ROC B;  1QTS A;  4WZS D;  1PZD A;  1JFI C;  2Z8U A;  1KY7 A;  1QN3 A;  1QN7 A;  1QNC A;  1QTP A;  5IYD P;  1TGH A;  1PCZ A;  1W80 A;  1VTL E;  1NH2 A;  1C9B B;  1QN6 A;  1YTF A;  1MP9 A;  1B9K A;  1VTO A;  1NGM A;  3OC3 C;  1E42 A;  2MJ7 A;  1RM1 A;  1CDW A;  2G30 A;  1TBP A;  3OCI A;  1D3U A;  2VJ0 A;  2D0B A;  1KYU A;  1QNB A;  3VN5 A;  1NVP A;  1VOL B;  4PY5 A;  2IV8 A;  3ASM A;  1KY6 A;  4ROD B;  1AIS A;  1TBA B;  2IV9 A;  1QN4 A;  5IYB P;  1QN9 A;  2D0C A; 
#chains in the Genus database with same CATH topology
 4IL8 A;  2FKF A;  1K35 A;  1QN5 A;  2O3O A;  1PCM X;  1KYD A;  4B0A A;  3D4V A;  3H1Z A;  2Z0F A;  3CW7 A;  4EAG A;  4ROC B;  1V5S A;  1QTS A;  3ENO C;  3TE5 A;  1KY7 A;  1QN3 A;  2DKC A;  2ZFD B;  1QTP A;  2QRD A;  4EAL A;  1VTL E;  4MRQ A;  4D7Q A;  4EJZ A;  2NOI A;  2MJ7 A;  3I0W A;  1Q9U A;  3ENC A;  1TBP A;  2EHB D;  3DPU A;  3OCI A;  2FUV A;  1D3U A;  1LWV A;  1UL7 A;  1QNB A;  2NOF A;  1VOL B;  1LXT A;  1P5D X;  2IV8 A;  5AN4 A;  1UT7 A;  1KFQ A;  2NOB A;  2NOL A;  1C47 A;  5IYB P;  3OH9 A;  1QN9 A;  5F9C A;  4WXA A;  2PWW A;  5JMV D;  1VOK A;  2NLV A;  4I8O A;  4TPS A;  1JDY A;  1YTB A;  3CWS A;  2NVM A;  3PDK A;  3CVS A;  1JFI C;  5HSH A;  4EAJ A;  2YA3 A;  4HJH A;  1M3Q A;  2JPI A;  2MZ8 A;  2YH5 A;  3KTU A;  1UT4 A;  1YTF A;  1WJW A;  1E42 A;  2JHN A;  1CDW A;  2NOH A;  2G30 A;  2LAE A;  2VJ0 A;  3NA5 A;  1FN7 A;  3VN5 A;  1KFI A;  3BKQ X;  2HL8 A;  2NWV A;  3ASM A;  3CWA A;  1YQK A;  1C4G A;  1LWY A;  4ROD B;  2IV9 A;  1N3A A;  4C7P A;  2D0C A;  2H4L X;  3OH6 A;  2QRC A;  3D7Q A;  3EIK A;  5JN5 A;  3KRM A;  5IYC P;  1J3M A;  3CWT A;  3DPT A;  3IH7 A;  2D0A A;  1YQM A;  4EJY A;  3HS9 A;  1PVS A;  3C04 A;  3HS8 A;  2QRE A;  4QG5 A;  1QNA A;  2V9J A;  2NOE A;  3CVT A;  2HZM A;  3OGD A;  1MPG A;  3N89 A;  1XSZ A;  4DUL A;  1YQL A;  2QR1 A;  2XHI A;  1K2Y X;  5BMN A;  2Y8L A;  1HU0 A;  1B9K A;  2DKD A;  1VTO A;  1NGM A;  3OC3 C;  1RM1 A;  5BMP A;  1KYU A;  4EAI A;  2HZS A;  1NVP A;  4Q11 A;  4WX8 A;  3RPJ A;  3RSM A;  5EPC A;  3I0X A;  5KL0 A;  1KY6 A;  2QLV A;  3PMG A;  1AIS A;  2NOZ A;  1QNE A;  1TGH A;  2H5A X;  3I3W A;  4D7R A;  1EBM A;  2Y8Q A;  3OST A;  1VKL A;  1YQR A;  3EAY A;  1PCJ X;  1QN8 A;  4ROE B;  1KYF A;  1R4X A;  3F0Z A;  2I5W A;  3TDH A;  2R5X A;  2OOX A;  3CWU A;  2JHJ A;  2OOY A;  1TUO A;  4WZS D;  1M5Q 1;  1PZD A;  2F7L A;  2Z8U A;  5IYD P;  1P5G X;  1QN7 A;  2HL9 A;  1N39 A;  1QNC A;  2DKA A;  3SNS A;  1T6A A;  1PCZ A;  1W80 A;  2V92 A;  3F10 A;  3ULX A;  1NH2 A;  1LWW A;  1C9B B;  1MP9 A;  1DIZ A;  1QN6 A;  2HKP A;  4CFF A;  4PY5 A;  2FKM X;  3OSM A;  2D0B A;  2V8Q A;  1WQA A;  1EUV A;  3OSE A;  1N3C A;  2JOI A;  4BJU A;  1KO9 A;  3UW2 A;  1TBA B;  4EAK A;  1M3H A;  1QN4 A;  3OLP A;  3T4N A;  2FGT A; 
#chains in the Genus database with same CATH homology
 1QN5 A;  2O3O A;  1KYD A;  4B0A A;  3H1Z A;  4ROC B;  1QTS A;  1KY7 A;  1QN3 A;  1QTP A;  1VTL E;  4EJZ A;  2NOI A;  2MJ7 A;  3I0W A;  1D3U A;  1TBP A;  3DPU A;  3OCI A;  1LWV A;  2NOF A;  1QNB A;  1VOL B;  2IV8 A;  5AN4 A;  1UT7 A;  2NOB A;  2NOL A;  5IYB P;  1QN9 A;  1VOK A;  4I8O A;  4TPS A;  1YTB A;  1JFI C;  1M3Q A;  2MZ8 A;  2YH5 A;  3KTU A;  1YTF A;  1UT4 A;  1E42 A;  1CDW A;  2NOH A;  2G30 A;  2LAE A;  2VJ0 A;  1FN7 A;  3VN5 A;  3ASM A;  1YQK A;  1LWY A;  4ROD B;  2IV9 A;  1N3A A;  2D0C A;  3EIK A;  3KRM A;  5IYC P;  3DPT A;  3IH7 A;  2D0A A;  1YQM A;  4EJY A;  3HS9 A;  3HS8 A;  1QNA A;  2NOE A;  2HZM A;  3N89 A;  4DUL A;  1YQL A;  2XHI A;  1HU0 A;  1B9K A;  1VTO A;  1NGM A;  3OC3 C;  1RM1 A;  1KYU A;  2HZS A;  1NVP A;  4Q11 A;  3RPJ A;  3I0X A;  1KY6 A;  1AIS A;  2NOZ A;  1QNE A;  1TGH A;  1EBM A;  3OST A;  1YQR A;  1QN8 A;  4ROE B;  1KYF A;  1R4X A;  3F0Z A;  2I5W A;  4WZS D;  1PZD A;  2Z8U A;  5IYD P;  1QN7 A;  1N39 A;  1QNC A;  3SNS A;  1PCZ A;  1W80 A;  3F10 A;  1NH2 A;  3ULX A;  1LWW A;  1C9B B;  1QN6 A;  1MP9 A;  4PY5 A;  3OSM A;  2D0B A;  1N3C A;  2JOI A;  1KO9 A;  1TBA B;  1M3H A;  1QN4 A;  2FGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...