1CDWA

Human tbp core domain complexed with dna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
179
Chain Sequence
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEENSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*TP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*CP*TP*G)-3
publication title Crystal structure of a human TATA box-binding protein/TATA element complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 1996-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1cdwA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1cdwA02
1YTBA 1R4XA 1NGMA 1VOLB 1JFIC 5IYCP 1CDWA 1NVPA 1E42A 1QTSA 3HS8A 4ROCB 1TGHA 1W80A 1QNBA 1QN8A 2Z8UA 3H1ZA 3EIKA 1VOKA 2MJ7A 2D0AA 4ROEB 2IV9A 1QN3A 1VTOA 1QN4A 2D0BA 2D0CA 5IYBP 1KYFA 3OCIA 3VN5A 1B9KA 1D3UA 1PZDA 2IV8A 3OC3C 1QNEA 1AISA 1KY7A 3HS9A 1MP9A 1QN5A 3ASMA 1QN6A 5IYDP 1KYUA 4RODB 1TBAB 1QN9A 4WZSD 1TBPA 1QNCA 2VJ0A 4PY5A 1KYDA 1QN7A 2G30A 1VTLE 4B0AA 1QTPA 1YTFA 1PCZA 1NH2A 1C9BB 1KY6A 1QNAA 1RM1A
chains in the Genus database with same CATH superfamily
1TUOA 2ZFDB 1UL7A 4EALA 2YA3A 1YQKA 2DKDA 5F9CA 1NGMA 3HS8A 5BMNA 1W80A 2NWVA 1M3QA 1QN8A 2Z8UA 3H1ZA 2JHJA 1VOKA 3CW7A 2D0AA 2EHBD 2IV9A 3UW2A 2NOIA 1VTOA 1QN4A 1KFQA 4MRQA 2D0BA 1N3CA 5IYBP 4EAGA 3VN5A 3KTUA 1PCMX 3D7QA 2HKPA 1PZDA 2HZSA 1MP9A 4Q11A 1KO9A 2Y8LA 2V9JA 1UT4A 4WZSD 1TBPA 1WJWA 2JPIA 3ENOC 3TDHA 4C7PA 3I0XA 1YTFA 5KL0A 3TE5A 1PCZA 4I8OA 3D4VA 1NH2A 5BMPA 5JMVD 2V8QA 5EPCA 1YQLA 3OSTA 1T6AA 1JFIC 5IYCP 1CDWA 1Q9UA 1QTSA 1LWYA 1TGHA 3CWTA 4QG5A 3SNSA 4TPSA 2NVMA 1V5SA 2MJ7A 4ROEB 3CWUA 4EJZA 2NOLA 2HL8A 2NOFA 4CFFA 3OH9A 2NOZA 2QLVA 1P5DX 1KYFA 3OCIA 5AN4A 1N39A 4BJUA 3OC3C 3CVSA 1QNEA 2DKCA 1EUVA 1QN6A 5IYDP 1XSZA 4IL8A 1TBAB 1QN9A 3N89A 2QRDA 3F0ZA 1KYDA 1QN7A 1VTLE 1C4GA 3T4NA 3I3WA 3I0WA 3PMGA 2H5AX 4EJYA 1C9BB 1KY6A 1LXTA 2NLVA 2Y8QA 2Z0FA 1UT7A 2LAEA 4EAKA 1RM1A 2FGTA 1HU0A 1YTBA 1R4XA 2I5WA 1VKLA 3DPUA 1J3MA 1NVPA 4ROCB 2NOEA 2DKAA 1MPGA 2QREA 1QNBA 1JDYA 3BKQX 3EAYA 2FKFA 2JHNA 2NOBA 2D0CA 3OLPA 1B9KA 4D7QA 2F7LA 1KFIA 1D3UA 2MZ8A 2IV8A 2OOYA 3HS9A 2FKMX 3PDKA 1AISA 1LWWA 3OSMA 2QRCA 3IH7A 1FN7A 2XHIA 2VJ0A 1PVSA 3C04A 4EAIA 4WX8A 2FUVA 4B0AA 4EAJA 3F10A 1DIZA 2QR1A 1LWVA 1N3AA 1EBMA 4DULA 4WXAA 1VOLB 1P5GX 1E42A 1PCJX 2HL9A 2JOIA 3EIKA 2R5XA 3CWSA 1QN3A 2YH5A 3OGDA 3OSEA 3CWAA 2HZMA 3OH6A 2O3OA 2V92A 1K35A 3RSMA 1KY7A 1QN5A 3ASMA 2OOXA 1KYUA 1C47A 2NOHA 4RODB 1QNCA 5JN5A 3CVTA 2PWWA 1M5Q1 4PY5A 3KRMA 2G30A 3DPTA 3ENCA 3NA5A 1YQRA 1QTPA 2H4LX 4D7RA 1K2YX 4HJHA 3ULXA 3RPJA 5HSHA 1YQMA 1WQAA 1QNAA 1M3HA
chains in the Genus database with same CATH topology
1NGMA 1YQKA 3HS8A 1W80A 1M3QA 1QN8A 2Z8UA 3H1ZA 1VOKA 2D0AA 2IV9A 2NOIA 1VTOA 1QN4A 1N3CA 2D0BA 5IYBP 3VN5A 3KTUA 1PZDA 2HZSA 1MP9A 4Q11A 1KO9A 1UT4A 4WZSD 1TBPA 3I0XA 1YTFA 1PCZA 4I8OA 1NH2A 1YQLA 3OSTA 1JFIC 5IYCP 1CDWA 1QTSA 1LWYA 1TGHA 3SNSA 4TPSA 4EJZA 2MJ7A 4ROEB 2NOLA 2NOFA 2NOZA 1KYFA 3OCIA 5AN4A 1N39A 3OC3C 1QNEA 1QN6A 5IYDP 1TBAB 1QN9A 3N89A 3F0ZA 1KYDA 1QN7A 1VTLE 3I0WA 4EJYA 1C9BB 1KY6A 1UT7A 2LAEA 1RM1A 1HU0A 2FGTA 1YTBA 1R4XA 2I5WA 3DPUA 1NVPA 4ROCB 1QNBA 2NOBA 2D0CA 1B9KA 1D3UA 2MZ8A 2IV8A 1AISA 3HS9A 1LWWA 3OSMA 3IH7A 1FN7A 2XHIA 2VJ0A 4B0AA 3F10A 1LWVA 1N3AA 1EBMA 4DULA 1VOLB 1E42A 2JOIA 3EIKA 1QN3A 2YH5A 2HZMA 2O3OA 1KY7A 1QN5A 3ASMA 1KYUA 2NOHA 4RODB 1QNCA 4PY5A 3KRMA 2G30A 3DPTA 1YQRA 1QTPA 1YQMA 3ULXA 3RPJA 2NOEA 1QNAA 1M3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTB A;  1R4X A;  1NGM A;  1VOL B;  1JFI C;  5IYC P;  1CDW A;  1NVP A;  1E42 A;  1QTS A;  3HS8 A;  4ROC B;  1TGH A;  1W80 A;  1QNB A;  1QN8 A;  2Z8U A;  3H1Z A;  3EIK A;  1VOK A;  2MJ7 A;  2D0A A;  4ROE B;  2IV9 A;  1QN3 A;  1VTO A;  1QN4 A;  2D0B A;  2D0C A;  5IYB P;  1KYF A;  3OCI A;  3VN5 A;  1B9K A;  1D3U A;  1PZD A;  2IV8 A;  3OC3 C;  1QNE A;  1AIS A;  1KY7 A;  3HS9 A;  1MP9 A;  1QN5 A;  3ASM A;  1QN6 A;  5IYD P;  1KYU A;  4ROD B;  1TBA B;  1QN9 A;  4WZS D;  1TBP A;  1QNC A;  2VJ0 A;  4PY5 A;  1KYD A;  1QN7 A;  2G30 A;  1VTL E;  4B0A A;  1QTP A;  1YTF A;  1PCZ A;  1NH2 A;  1C9B B;  1KY6 A;  1QNA A;  1RM1 A; 
#chains in the Genus database with same CATH topology
 1TUO A;  2ZFD B;  1UL7 A;  4EAL A;  2YA3 A;  1YQK A;  2DKD A;  5F9C A;  1NGM A;  3HS8 A;  5BMN A;  1W80 A;  2NWV A;  1M3Q A;  1QN8 A;  2Z8U A;  3H1Z A;  2JHJ A;  1VOK A;  3CW7 A;  2D0A A;  2EHB D;  2IV9 A;  3UW2 A;  2NOI A;  1VTO A;  1QN4 A;  1KFQ A;  4MRQ A;  2D0B A;  1N3C A;  5IYB P;  4EAG A;  3VN5 A;  3KTU A;  1PCM X;  3D7Q A;  2HKP A;  1PZD A;  2HZS A;  1MP9 A;  4Q11 A;  1KO9 A;  2Y8L A;  2V9J A;  1UT4 A;  4WZS D;  1TBP A;  1WJW A;  2JPI A;  3ENO C;  3TDH A;  4C7P A;  3I0X A;  1YTF A;  5KL0 A;  3TE5 A;  1PCZ A;  4I8O A;  3D4V A;  1NH2 A;  5BMP A;  5JMV D;  2V8Q A;  5EPC A;  1YQL A;  3OST A;  1T6A A;  1JFI C;  5IYC P;  1CDW A;  1Q9U A;  1QTS A;  1LWY A;  1TGH A;  3CWT A;  4QG5 A;  3SNS A;  4TPS A;  2NVM A;  1V5S A;  2MJ7 A;  4ROE B;  3CWU A;  4EJZ A;  2NOL A;  2HL8 A;  2NOF A;  4CFF A;  3OH9 A;  2NOZ A;  2QLV A;  1P5D X;  1KYF A;  3OCI A;  5AN4 A;  1N39 A;  4BJU A;  3OC3 C;  3CVS A;  1QNE A;  2DKC A;  1EUV A;  1QN6 A;  5IYD P;  1XSZ A;  4IL8 A;  1TBA B;  1QN9 A;  3N89 A;  2QRD A;  3F0Z A;  1KYD A;  1QN7 A;  1VTL E;  1C4G A;  3T4N A;  3I3W A;  3I0W A;  3PMG A;  2H5A X;  4EJY A;  1C9B B;  1KY6 A;  1LXT A;  2NLV A;  2Y8Q A;  2Z0F A;  1UT7 A;  2LAE A;  4EAK A;  1RM1 A;  2FGT A;  1HU0 A;  1YTB A;  1R4X A;  2I5W A;  1VKL A;  3DPU A;  1J3M A;  1NVP A;  4ROC B;  2NOE A;  2DKA A;  1MPG A;  2QRE A;  1QNB A;  1JDY A;  3BKQ X;  3EAY A;  2FKF A;  2JHN A;  2NOB A;  2D0C A;  3OLP A;  1B9K A;  4D7Q A;  2F7L A;  1KFI A;  1D3U A;  2MZ8 A;  2IV8 A;  2OOY A;  3HS9 A;  2FKM X;  3PDK A;  1AIS A;  1LWW A;  3OSM A;  2QRC A;  3IH7 A;  1FN7 A;  2XHI A;  2VJ0 A;  1PVS A;  3C04 A;  4EAI A;  4WX8 A;  2FUV A;  4B0A A;  4EAJ A;  3F10 A;  1DIZ A;  2QR1 A;  1LWV A;  1N3A A;  1EBM A;  4DUL A;  4WXA A;  1VOL B;  1P5G X;  1E42 A;  1PCJ X;  2HL9 A;  2JOI A;  3EIK A;  2R5X A;  3CWS A;  1QN3 A;  2YH5 A;  3OGD A;  3OSE A;  3CWA A;  2HZM A;  3OH6 A;  2O3O A;  2V92 A;  1K35 A;  3RSM A;  1KY7 A;  1QN5 A;  3ASM A;  2OOX A;  1KYU A;  1C47 A;  2NOH A;  4ROD B;  1QNC A;  5JN5 A;  3CVT A;  2PWW A;  1M5Q 1;  4PY5 A;  3KRM A;  2G30 A;  3DPT A;  3ENC A;  3NA5 A;  1YQR A;  1QTP A;  2H4L X;  4D7R A;  1K2Y X;  4HJH A;  3ULX A;  3RPJ A;  5HSH A;  1YQM A;  1WQA A;  1QNA A;  1M3H A; 
#chains in the Genus database with same CATH homology
 1NGM A;  1YQK A;  3HS8 A;  1W80 A;  1M3Q A;  1QN8 A;  2Z8U A;  3H1Z A;  1VOK A;  2D0A A;  2IV9 A;  2NOI A;  1VTO A;  1QN4 A;  1N3C A;  2D0B A;  5IYB P;  3VN5 A;  3KTU A;  1PZD A;  2HZS A;  1MP9 A;  4Q11 A;  1KO9 A;  1UT4 A;  4WZS D;  1TBP A;  3I0X A;  1YTF A;  1PCZ A;  4I8O A;  1NH2 A;  1YQL A;  3OST A;  1JFI C;  5IYC P;  1CDW A;  1QTS A;  1LWY A;  1TGH A;  3SNS A;  4TPS A;  4EJZ A;  2MJ7 A;  4ROE B;  2NOL A;  2NOF A;  2NOZ A;  1KYF A;  3OCI A;  5AN4 A;  1N39 A;  3OC3 C;  1QNE A;  1QN6 A;  5IYD P;  1TBA B;  1QN9 A;  3N89 A;  3F0Z A;  1KYD A;  1QN7 A;  1VTL E;  3I0W A;  4EJY A;  1C9B B;  1KY6 A;  1UT7 A;  2LAE A;  1RM1 A;  1HU0 A;  2FGT A;  1YTB A;  1R4X A;  2I5W A;  3DPU A;  1NVP A;  4ROC B;  1QNB A;  2NOB A;  2D0C A;  1B9K A;  1D3U A;  2MZ8 A;  2IV8 A;  1AIS A;  3HS9 A;  1LWW A;  3OSM A;  3IH7 A;  1FN7 A;  2XHI A;  2VJ0 A;  4B0A A;  3F10 A;  1LWV A;  1N3A A;  1EBM A;  4DUL A;  1VOL B;  1E42 A;  2JOI A;  3EIK A;  1QN3 A;  2YH5 A;  2HZM A;  2O3O A;  1KY7 A;  1QN5 A;  3ASM A;  1KYU A;  2NOH A;  4ROD B;  1QNC A;  4PY5 A;  3KRM A;  2G30 A;  3DPT A;  1YQR A;  1QTP A;  1YQM A;  3ULX A;  3RPJ A;  2NOE A;  1QNA A;  1M3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...