1CDWA

Human tbp core domain complexed with dna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
179
Chain Sequence
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEENSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*TP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*CP*TP*G)-3
publication title Crystal structure of a human TATA box-binding protein/TATA element complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 45
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 1996-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1cdwA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1cdwA02
1QNCA 1NGMA 2Z8UA 1VOLB 3OCIA 1QNBA 1KY7A 2IV9A 1RM1A 3VN5A 1VOKA 1KYUA 3EIKA 4ROCB 1QTPA 1VTLE 1QN8A 1QNEA 2D0BA 1KYDA 1JFIC 2D0CA 1W80A 1PCZA 1QN9A 4ROEB 1TGHA 1KY6A 4RODB 1TBPA 5IYDP 1CDWA 1PZDA 1QN4A 2G30A 1KYFA 1E42A 1QN5A 2D0AA 1QNAA 1R4XA 2IV8A 3HS9A 3OC3C 5IYCP 1C9BB 5IYBP 1VTOA 3HS8A 1QN7A 1QN3A 1QTSA 4WZSD 4PY5A 1NH2A 4B0AA 1MP9A 1YTFA 1D3UA 1QN6A 2VJ0A 1YTBA 1TBAB 3ASMA 3H1ZA 1NVPA 1AISA 2MJ7A 1B9KA
chains in the Genus database with same CATH superfamily
1P5GX 1VKLA 1Q9UA 2QRDA 2Z8UA 3CW7A 3OSTA 4WXAA 4BJUA 3KTUA 1VOKA 3EIKA 3DPUA 1N3CA 1C4GA 1UL7A 2D0CA 2NOFA 1N3AA 1T6AA 1KY6A 4TPSA 5IYDP 3CWUA 4IL8A 1CDWA 2NOZA 2Z0FA 1M3QA 2DKCA 2NLVA 3NA5A 5BMPA 2NWVA 3OH6A 5IYBP 1XSZA 2OOYA 4WZSD 5EPCA 1YQMA 1KFIA 3ENCA 1YTFA 1C47A 1K35A 1M3HA 1LXTA 2VJ0A 3TE5A 1EBMA 1TBAB 2HZMA 3OH9A 2MJ7A 1B9KA 2QLVA 4HJHA 2FKMX 3I0WA 1PCJX 2R5XA 2DKDA 3D4VA 3I3WA 1LWWA 3RSMA 2JHNA 3C04A 2QRCA 1QNBA 1PVSA 1RM1A 3I0XA 1LWVA 2LAEA 4D7QA 1QN8A 3N89A 1QNEA 2NOIA 1J3MA 1P5DX 2QR1A 2Y8QA 1TBPA 1EUVA 3ENOC 1PZDA 4EJYA 2G30A 3RPJA 1WQAA 5JN5A 2D0AA 2F7LA 2H5AX 1YQRA 1R4XA 3F10A 2IV8A 3HS9A 5HSHA 3SNSA 5BMNA 1KO9A 1VTOA 3HS8A 4DULA 4PY5A 1KFQA 2HL9A 1NH2A 4B0AA 1MP9A 2NOHA 1D3UA 3T4NA 2V9JA 1YQLA 1YTBA 3BKQX 1QNAA 2NVMA 2JPIA 3DPTA 3PDKA 2V92A 4EAGA 1NGMA 3CWSA 1VOLB 2V8QA 4EJZA 5KL0A 1KY7A 1KYUA 4ROCB 3CWTA 2NOEA 3ULXA 1MPGA 1W80A 1PCZA 4C7PA 4RODB 1TGHA 5F9CA 1FN7A 1E42A 4D7RA 2FKFA 1M5Q1 1K2YX 3CVTA 2JOIA 3D7QA 3IH7A 1LWYA 1QN7A 1QTSA 3F0ZA 3H1ZA 3EAYA 2O3OA 4QG5A 1QN6A 3CVSA 1UT7A 2JHJA 4WX8A 4MRQA 1AISA 2EHBD 2NOBA 2DKAA 1YQKA 1QNCA 2PWWA 2XHIA 2ZFDB 2MZ8A 2OOXA 2QREA 3OCIA 2FGTA 2HKPA 2IV9A 5JMVD 3VN5A 3OGDA 1PCMX 1TUOA 1UT4A 1WJWA 3UW2A 1QTPA 4EALA 1VTLE 2D0BA 1KYDA 1JFIC 2Y8LA 4I8OA 4Q11A 5AN4A 3PMGA 4ROEB 3CWAA 1DIZA 1QN9A 2HZSA 3TDHA 2I5WA 4EAIA 2FUVA 1QN4A 1KYFA 1JDYA 1QN5A 4EAJA 3OLPA 3OSMA 3OC3C 5IYCP 1C9BB 4EAKA 1N39A 1QN3A 2NOLA 4CFFA 1V5SA 2H4LX 2HL8A 3OSEA 1HU0A 3KRMA 3ASMA 2YA3A 2YH5A 1NVPA
chains in the Genus database with same CATH topology
2Z8UA 3OSTA 3KTUA 1VOKA 3EIKA 3DPUA 1N3CA 2D0CA 2NOFA 1N3AA 4TPSA 1KY6A 5IYDP 1CDWA 2NOZA 1M3QA 5IYBP 4WZSD 1YQMA 1YTFA 1M3HA 2VJ0A 1EBMA 1TBAB 2HZMA 2MJ7A 1B9KA 3I0WA 1LWWA 1QNBA 1RM1A 3I0XA 1LWVA 2LAEA 1QN8A 3N89A 1QNEA 2NOIA 1TBPA 1PZDA 4EJYA 2G30A 3RPJA 2D0AA 1YQRA 1R4XA 3F10A 2IV8A 3HS9A 3SNSA 1KO9A 1VTOA 3HS8A 4DULA 4PY5A 1NH2A 4B0AA 1MP9A 2NOHA 1D3UA 1YQLA 1YTBA 1QNAA 3DPTA 1NGMA 1VOLB 4EJZA 1KY7A 1KYUA 4ROCB 2NOEA 3ULXA 1W80A 1PCZA 1TGHA 4RODB 1FN7A 1E42A 2JOIA 1LWYA 3IH7A 1QN7A 1QTSA 3F0ZA 2O3OA 1QN6A 1UT7A 1AISA 2NOBA 1YQKA 1QNCA 2XHIA 2MZ8A 3OCIA 2FGTA 2IV9A 3VN5A 1UT4A 1QTPA 1VTLE 2D0BA 1KYDA 1JFIC 4I8OA 4Q11A 5AN4A 4ROEB 1QN9A 2HZSA 2I5WA 1QN4A 1KYFA 1QN5A 3OSMA 3OC3C 5IYCP 1C9BB 1N39A 1QN3A 2NOLA 1HU0A 3KRMA 3ASMA 3H1ZA 2YH5A 1NVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNC A;  1NGM A;  2Z8U A;  1VOL B;  3OCI A;  1QNB A;  1KY7 A;  2IV9 A;  1RM1 A;  3VN5 A;  1VOK A;  1KYU A;  3EIK A;  4ROC B;  1QTP A;  1VTL E;  1QN8 A;  1QNE A;  2D0B A;  1KYD A;  1JFI C;  2D0C A;  1W80 A;  1PCZ A;  1QN9 A;  4ROE B;  1TGH A;  1KY6 A;  4ROD B;  1TBP A;  5IYD P;  1CDW A;  1PZD A;  1QN4 A;  2G30 A;  1KYF A;  1E42 A;  1QN5 A;  2D0A A;  1QNA A;  1R4X A;  2IV8 A;  3HS9 A;  3OC3 C;  5IYC P;  1C9B B;  5IYB P;  1VTO A;  3HS8 A;  1QN7 A;  1QN3 A;  1QTS A;  4WZS D;  4PY5 A;  1NH2 A;  4B0A A;  1MP9 A;  1YTF A;  1D3U A;  1QN6 A;  2VJ0 A;  1YTB A;  1TBA B;  3ASM A;  3H1Z A;  1NVP A;  1AIS A;  2MJ7 A;  1B9K A; 
#chains in the Genus database with same CATH topology
 1P5G X;  1VKL A;  1Q9U A;  2QRD A;  2Z8U A;  3CW7 A;  3OST A;  4WXA A;  4BJU A;  3KTU A;  1VOK A;  3EIK A;  3DPU A;  1N3C A;  1C4G A;  1UL7 A;  2D0C A;  2NOF A;  1N3A A;  1T6A A;  1KY6 A;  4TPS A;  5IYD P;  3CWU A;  4IL8 A;  1CDW A;  2NOZ A;  2Z0F A;  1M3Q A;  2DKC A;  2NLV A;  3NA5 A;  5BMP A;  2NWV A;  3OH6 A;  5IYB P;  1XSZ A;  2OOY A;  4WZS D;  5EPC A;  1YQM A;  1KFI A;  3ENC A;  1YTF A;  1C47 A;  1K35 A;  1M3H A;  1LXT A;  2VJ0 A;  3TE5 A;  1EBM A;  1TBA B;  2HZM A;  3OH9 A;  2MJ7 A;  1B9K A;  2QLV A;  4HJH A;  2FKM X;  3I0W A;  1PCJ X;  2R5X A;  2DKD A;  3D4V A;  3I3W A;  1LWW A;  3RSM A;  2JHN A;  3C04 A;  2QRC A;  1QNB A;  1PVS A;  1RM1 A;  3I0X A;  1LWV A;  2LAE A;  4D7Q A;  1QN8 A;  3N89 A;  1QNE A;  2NOI A;  1J3M A;  1P5D X;  2QR1 A;  2Y8Q A;  1TBP A;  1EUV A;  3ENO C;  1PZD A;  4EJY A;  2G30 A;  3RPJ A;  1WQA A;  5JN5 A;  2D0A A;  2F7L A;  2H5A X;  1YQR A;  1R4X A;  3F10 A;  2IV8 A;  3HS9 A;  5HSH A;  3SNS A;  5BMN A;  1KO9 A;  1VTO A;  3HS8 A;  4DUL A;  4PY5 A;  1KFQ A;  2HL9 A;  1NH2 A;  4B0A A;  1MP9 A;  2NOH A;  1D3U A;  3T4N A;  2V9J A;  1YQL A;  1YTB A;  3BKQ X;  1QNA A;  2NVM A;  2JPI A;  3DPT A;  3PDK A;  2V92 A;  4EAG A;  1NGM A;  3CWS A;  1VOL B;  2V8Q A;  4EJZ A;  5KL0 A;  1KY7 A;  1KYU A;  4ROC B;  3CWT A;  2NOE A;  3ULX A;  1MPG A;  1W80 A;  1PCZ A;  4C7P A;  4ROD B;  1TGH A;  5F9C A;  1FN7 A;  1E42 A;  4D7R A;  2FKF A;  1M5Q 1;  1K2Y X;  3CVT A;  2JOI A;  3D7Q A;  3IH7 A;  1LWY A;  1QN7 A;  1QTS A;  3F0Z A;  3H1Z A;  3EAY A;  2O3O A;  4QG5 A;  1QN6 A;  3CVS A;  1UT7 A;  2JHJ A;  4WX8 A;  4MRQ A;  1AIS A;  2EHB D;  2NOB A;  2DKA A;  1YQK A;  1QNC A;  2PWW A;  2XHI A;  2ZFD B;  2MZ8 A;  2OOX A;  2QRE A;  3OCI A;  2FGT A;  2HKP A;  2IV9 A;  5JMV D;  3VN5 A;  3OGD A;  1PCM X;  1TUO A;  1UT4 A;  1WJW A;  3UW2 A;  1QTP A;  4EAL A;  1VTL E;  2D0B A;  1KYD A;  1JFI C;  2Y8L A;  4I8O A;  4Q11 A;  5AN4 A;  3PMG A;  4ROE B;  3CWA A;  1DIZ A;  1QN9 A;  2HZS A;  3TDH A;  2I5W A;  4EAI A;  2FUV A;  1QN4 A;  1KYF A;  1JDY A;  1QN5 A;  4EAJ A;  3OLP A;  3OSM A;  3OC3 C;  5IYC P;  1C9B B;  4EAK A;  1N39 A;  1QN3 A;  2NOL A;  4CFF A;  1V5S A;  2H4L X;  2HL8 A;  3OSE A;  1HU0 A;  3KRM A;  3ASM A;  2YA3 A;  2YH5 A;  1NVP A; 
#chains in the Genus database with same CATH homology
 2Z8U A;  3OST A;  3KTU A;  1VOK A;  3EIK A;  3DPU A;  1N3C A;  2D0C A;  2NOF A;  1N3A A;  4TPS A;  1KY6 A;  5IYD P;  1CDW A;  2NOZ A;  1M3Q A;  5IYB P;  4WZS D;  1YQM A;  1YTF A;  1M3H A;  2VJ0 A;  1EBM A;  1TBA B;  2HZM A;  2MJ7 A;  1B9K A;  3I0W A;  1LWW A;  1QNB A;  1RM1 A;  3I0X A;  1LWV A;  2LAE A;  1QN8 A;  3N89 A;  1QNE A;  2NOI A;  1TBP A;  1PZD A;  4EJY A;  2G30 A;  3RPJ A;  2D0A A;  1YQR A;  1R4X A;  3F10 A;  2IV8 A;  3HS9 A;  3SNS A;  1KO9 A;  1VTO A;  3HS8 A;  4DUL A;  4PY5 A;  1NH2 A;  4B0A A;  1MP9 A;  2NOH A;  1D3U A;  1YQL A;  1YTB A;  1QNA A;  3DPT A;  1NGM A;  1VOL B;  4EJZ A;  1KY7 A;  1KYU A;  4ROC B;  2NOE A;  3ULX A;  1W80 A;  1PCZ A;  1TGH A;  4ROD B;  1FN7 A;  1E42 A;  2JOI A;  1LWY A;  3IH7 A;  1QN7 A;  1QTS A;  3F0Z A;  2O3O A;  1QN6 A;  1UT7 A;  1AIS A;  2NOB A;  1YQK A;  1QNC A;  2XHI A;  2MZ8 A;  3OCI A;  2FGT A;  2IV9 A;  3VN5 A;  1UT4 A;  1QTP A;  1VTL E;  2D0B A;  1KYD A;  1JFI C;  4I8O A;  4Q11 A;  5AN4 A;  4ROE B;  1QN9 A;  2HZS A;  2I5W A;  1QN4 A;  1KYF A;  1QN5 A;  3OSM A;  3OC3 C;  5IYC P;  1C9B B;  1N39 A;  1QN3 A;  2NOL A;  1HU0 A;  3KRM A;  3ASM A;  3H1Z A;  2YH5 A;  1NVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...