1CDWA

Human tbp core domain complexed with dna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
179
structure length
179
Chain Sequence
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEENSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*TP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*CP*TP*G)-3
publication title Crystal structure of a human TATA box-binding protein/TATA element complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 45
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 1996-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1cdwA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1cdwA02
5IYDP 3HS8A 3OC3C 1KYDA 5IYCP 1VTLE 1R4XA 1PCZA 3VN5A 1PZDA 1TGHA 1AISA 1QN9A 1KY6A 1QN7A 1CDWA 1QNEA 4WZSD 2G30A 1NGMA 1D3UA 2IV8A 2IV9A 1VOLB 1RM1A 2D0AA 1W80A 1YTFA 3H1ZA 1QNCA 2MJ7A 4ROCB 4PY5A 3HS9A 1VTOA 5IYBP 1QTPA 2VJ0A 1KYFA 1QTSA 2D0CA 1JFIC 1YTBA 3ASMA 1E42A 1KYUA 1B9KA 1VOKA 4B0AA 1QN3A 1MP9A 1QN4A 1KY7A 2Z8UA 1TBAB 4RODB 1QN6A 1QN5A 2D0BA 1NH2A 1C9BB 1NVPA 4ROEB 1QNBA 1QNAA 1QN8A 3EIKA 1TBPA 3OCIA
chains in the Genus database with same CATH superfamily
1KYDA 1VTLE 3CWUA 1PCZA 3VN5A 3F10A 1KY6A 1UT7A 3CWAA 4WZSD 2G30A 1RM1A 3NA5A 4ROCB 2Y8LA 2DKAA 1VTOA 3RSMA 1LWVA 2NOBA 2O3OA 2V92A 2HZMA 1K35A 1YTBA 1JDYA 2JHJA 4BJUA 1E42A 1PCMX 4EAGA 2NOLA 2NOFA 3OLPA 2HL9A 4QG5A 1QN3A 4IL8A 1MP9A 2XHIA 3C04A 3PDKA 4CFFA 1QN6A 3CVTA 3CWSA 2YH5A 5JN5A 2FGTA 2JHNA 3D4VA 1KFIA 2NLVA 2V8QA 2ZFDB 2HZSA 2OOYA 1YQRA 1C9BB 3CVSA 1NVPA 4EJYA 3IH7A 5BMNA 3RPJA 5IYDP 3HS8A 3OC3C 3OSEA 3ULXA 5IYCP 1PZDA 1TGHA 1YQLA 2EHBD 1QN9A 5KL0A 1QN7A 5EPCA 3OH6A 1CDWA 1QNEA 2NOEA 2IV8A 2IV9A 1MPGA 3UW2A 1VOLB 2D0AA 1W80A 1PCJX 1EUVA 2QRDA 3TDHA 4EAIA 1V5SA 5F9CA 4DULA 2QLVA 3F0ZA 4MRQA 1WQAA 2OOXA 4I8OA 3CW7A 1QTSA 1WJWA 1KFQA 3PMGA 4EALA 2LAEA 1KYUA 1P5GX 5JMVD 1EBMA 1KY7A 1UL7A 2Z8UA 1TBAB 4D7QA 2FUVA 1YQKA 1C47A 2DKDA 1QNBA 4ROEB 2H5AX 1UT4A 2HL8A 3TE5A 1DIZA 1C4GA 1R4XA 3DPUA 3EAYA 5BMPA 4EJZA 1K2YX 2R5XA 1P5DX 1D3UA 3H1ZA 1N3AA 1QNCA 3I3WA 3KTUA 2VJ0A 1KYFA 3OGDA 1JFIC 2DKCA 1N39A 3ENCA 4B0AA 1QN4A 3OSTA 2MZ8A 1FN7A 3I0XA 3SNSA 2I5WA 4HJHA 3T4NA 2Y8QA 1PVSA 1TUOA 2D0BA 3BKQX 2QR1A 3DPTA 2PWWA 4TPSA 1NH2A 3EIKA 1TBPA 1Q9UA 1HU0A 1M3HA 3N89A 3KRMA 4C7PA 3CWTA 3ENOC 1AISA 2QRCA 3D7QA 1LWYA 1QN8A 1NGMA 2NOZA 1YQMA 5AN4A 1LXTA 1KO9A 5HSHA 1YTFA 3OH9A 4PY5A 2JOIA 2MJ7A 3HS9A 5IYBP 2V9JA 1VKLA 2H4LX 4WX8A 4EAKA 2NOIA 1QTPA 1M5Q1 2D0CA 3ASMA 1M3QA 2FKFA 2JPIA 1N3CA 2NWVA 1B9KA 1VOKA 3OSMA 3I0WA 2QREA 1QN5A 2Z0FA 4WXAA 1T6AA 1XSZA 4RODB 4D7RA 4Q11A 2NOHA 2HKPA 1LWWA 2NVMA 1QNAA 2F7LA 4EAJA 2FKMX 1J3MA 2YA3A 3OCIA
chains in the Genus database with same CATH topology
1KYDA 1VTLE 1PCZA 3VN5A 3F10A 1KY6A 1UT7A 4WZSD 2G30A 1RM1A 4ROCB 1VTOA 1LWVA 2NOBA 2O3OA 2HZMA 1YTBA 1E42A 2NOLA 2NOFA 1QN3A 1MP9A 2XHIA 1QN6A 2YH5A 1QN5A 2FGTA 1YQRA 2HZSA 1C9BB 1NVPA 4EJYA 3IH7A 3RPJA 5IYDP 3HS8A 3OC3C 3ULXA 5IYCP 1PZDA 1TGHA 1YQLA 1QN9A 1QN7A 1CDWA 1QNEA 2NOEA 2IV8A 2IV9A 1VOLB 2D0AA 1W80A 4DULA 3F0ZA 4I8OA 1QTSA 2LAEA 1KYUA 1EBMA 1KY7A 2Z8UA 1TBAB 1YQKA 1QNBA 4ROEB 1UT4A 1R4XA 3DPUA 4EJZA 1D3UA 3H1ZA 1N3AA 1QNCA 3KTUA 2VJ0A 1KYFA 1JFIC 1N39A 4B0AA 1QN4A 3OSTA 2MZ8A 1FN7A 3I0XA 3SNSA 2I5WA 2D0BA 1NH2A 3DPTA 4TPSA 3EIKA 1TBPA 1HU0A 1M3HA 3N89A 3KRMA 1AISA 1LWYA 1NGMA 2NOZA 1YQMA 5AN4A 1KO9A 1YTFA 4PY5A 2JOIA 2MJ7A 3HS9A 5IYBP 2NOIA 1QTPA 2D0CA 3ASMA 1M3QA 1N3CA 1B9KA 1VOKA 3OSMA 3I0WA 4RODB 2NOHA 4Q11A 1LWWA 1QNAA 1QN8A 3OCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD P;  3HS8 A;  3OC3 C;  1KYD A;  5IYC P;  1VTL E;  1R4X A;  1PCZ A;  3VN5 A;  1PZD A;  1TGH A;  1AIS A;  1QN9 A;  1KY6 A;  1QN7 A;  1CDW A;  1QNE A;  4WZS D;  2G30 A;  1NGM A;  1D3U A;  2IV8 A;  2IV9 A;  1VOL B;  1RM1 A;  2D0A A;  1W80 A;  1YTF A;  3H1Z A;  1QNC A;  2MJ7 A;  4ROC B;  4PY5 A;  3HS9 A;  1VTO A;  5IYB P;  1QTP A;  2VJ0 A;  1KYF A;  1QTS A;  2D0C A;  1JFI C;  1YTB A;  3ASM A;  1E42 A;  1KYU A;  1B9K A;  1VOK A;  4B0A A;  1QN3 A;  1MP9 A;  1QN4 A;  1KY7 A;  2Z8U A;  1TBA B;  4ROD B;  1QN6 A;  1QN5 A;  2D0B A;  1NH2 A;  1C9B B;  1NVP A;  4ROE B;  1QNB A;  1QNA A;  1QN8 A;  3EIK A;  1TBP A;  3OCI A; 
#chains in the Genus database with same CATH topology
 1KYD A;  1VTL E;  3CWU A;  1PCZ A;  3VN5 A;  3F10 A;  1KY6 A;  1UT7 A;  3CWA A;  4WZS D;  2G30 A;  1RM1 A;  3NA5 A;  4ROC B;  2Y8L A;  2DKA A;  1VTO A;  3RSM A;  1LWV A;  2NOB A;  2O3O A;  2V92 A;  2HZM A;  1K35 A;  1YTB A;  1JDY A;  2JHJ A;  4BJU A;  1E42 A;  1PCM X;  4EAG A;  2NOL A;  2NOF A;  3OLP A;  2HL9 A;  4QG5 A;  1QN3 A;  4IL8 A;  1MP9 A;  2XHI A;  3C04 A;  3PDK A;  4CFF A;  1QN6 A;  3CVT A;  3CWS A;  2YH5 A;  5JN5 A;  2FGT A;  2JHN A;  3D4V A;  1KFI A;  2NLV A;  2V8Q A;  2ZFD B;  2HZS A;  2OOY A;  1YQR A;  1C9B B;  3CVS A;  1NVP A;  4EJY A;  3IH7 A;  5BMN A;  3RPJ A;  5IYD P;  3HS8 A;  3OC3 C;  3OSE A;  3ULX A;  5IYC P;  1PZD A;  1TGH A;  1YQL A;  2EHB D;  1QN9 A;  5KL0 A;  1QN7 A;  5EPC A;  3OH6 A;  1CDW A;  1QNE A;  2NOE A;  2IV8 A;  2IV9 A;  1MPG A;  3UW2 A;  1VOL B;  2D0A A;  1W80 A;  1PCJ X;  1EUV A;  2QRD A;  3TDH A;  4EAI A;  1V5S A;  5F9C A;  4DUL A;  2QLV A;  3F0Z A;  4MRQ A;  1WQA A;  2OOX A;  4I8O A;  3CW7 A;  1QTS A;  1WJW A;  1KFQ A;  3PMG A;  4EAL A;  2LAE A;  1KYU A;  1P5G X;  5JMV D;  1EBM A;  1KY7 A;  1UL7 A;  2Z8U A;  1TBA B;  4D7Q A;  2FUV A;  1YQK A;  1C47 A;  2DKD A;  1QNB A;  4ROE B;  2H5A X;  1UT4 A;  2HL8 A;  3TE5 A;  1DIZ A;  1C4G A;  1R4X A;  3DPU A;  3EAY A;  5BMP A;  4EJZ A;  1K2Y X;  2R5X A;  1P5D X;  1D3U A;  3H1Z A;  1N3A A;  1QNC A;  3I3W A;  3KTU A;  2VJ0 A;  1KYF A;  3OGD A;  1JFI C;  2DKC A;  1N39 A;  3ENC A;  4B0A A;  1QN4 A;  3OST A;  2MZ8 A;  1FN7 A;  3I0X A;  3SNS A;  2I5W A;  4HJH A;  3T4N A;  2Y8Q A;  1PVS A;  1TUO A;  2D0B A;  3BKQ X;  2QR1 A;  3DPT A;  2PWW A;  4TPS A;  1NH2 A;  3EIK A;  1TBP A;  1Q9U A;  1HU0 A;  1M3H A;  3N89 A;  3KRM A;  4C7P A;  3CWT A;  3ENO C;  1AIS A;  2QRC A;  3D7Q A;  1LWY A;  1QN8 A;  1NGM A;  2NOZ A;  1YQM A;  5AN4 A;  1LXT A;  1KO9 A;  5HSH A;  1YTF A;  3OH9 A;  4PY5 A;  2JOI A;  2MJ7 A;  3HS9 A;  5IYB P;  2V9J A;  1VKL A;  2H4L X;  4WX8 A;  4EAK A;  2NOI A;  1QTP A;  1M5Q 1;  2D0C A;  3ASM A;  1M3Q A;  2FKF A;  2JPI A;  1N3C A;  2NWV A;  1B9K A;  1VOK A;  3OSM A;  3I0W A;  2QRE A;  1QN5 A;  2Z0F A;  4WXA A;  1T6A A;  1XSZ A;  4ROD B;  4D7R A;  4Q11 A;  2NOH A;  2HKP A;  1LWW A;  2NVM A;  1QNA A;  2F7L A;  4EAJ A;  2FKM X;  1J3M A;  2YA3 A;  3OCI A; 
#chains in the Genus database with same CATH homology
 1KYD A;  1VTL E;  1PCZ A;  3VN5 A;  3F10 A;  1KY6 A;  1UT7 A;  4WZS D;  2G30 A;  1RM1 A;  4ROC B;  1VTO A;  1LWV A;  2NOB A;  2O3O A;  2HZM A;  1YTB A;  1E42 A;  2NOL A;  2NOF A;  1QN3 A;  1MP9 A;  2XHI A;  1QN6 A;  2YH5 A;  1QN5 A;  2FGT A;  1YQR A;  2HZS A;  1C9B B;  1NVP A;  4EJY A;  3IH7 A;  3RPJ A;  5IYD P;  3HS8 A;  3OC3 C;  3ULX A;  5IYC P;  1PZD A;  1TGH A;  1YQL A;  1QN9 A;  1QN7 A;  1CDW A;  1QNE A;  2NOE A;  2IV8 A;  2IV9 A;  1VOL B;  2D0A A;  1W80 A;  4DUL A;  3F0Z A;  4I8O A;  1QTS A;  2LAE A;  1KYU A;  1EBM A;  1KY7 A;  2Z8U A;  1TBA B;  1YQK A;  1QNB A;  4ROE B;  1UT4 A;  1R4X A;  3DPU A;  4EJZ A;  1D3U A;  3H1Z A;  1N3A A;  1QNC A;  3KTU A;  2VJ0 A;  1KYF A;  1JFI C;  1N39 A;  4B0A A;  1QN4 A;  3OST A;  2MZ8 A;  1FN7 A;  3I0X A;  3SNS A;  2I5W A;  2D0B A;  1NH2 A;  3DPT A;  4TPS A;  3EIK A;  1TBP A;  1HU0 A;  1M3H A;  3N89 A;  3KRM A;  1AIS A;  1LWY A;  1NGM A;  2NOZ A;  1YQM A;  5AN4 A;  1KO9 A;  1YTF A;  4PY5 A;  2JOI A;  2MJ7 A;  3HS9 A;  5IYB P;  2NOI A;  1QTP A;  2D0C A;  3ASM A;  1M3Q A;  1N3C A;  1B9K A;  1VOK A;  3OSM A;  3I0W A;  4ROD B;  2NOH A;  4Q11 A;  1LWW A;  1QNA A;  1QN8 A;  3OCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...