4WZSD

Crystal structure of the mot1 n-terminal domain in complex with tbp and nc2 bound to a promoter dna fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
178
structure length
178
Chain Sequence
SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECU11_1470 protein
publication title Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1.
pubmed doi rcsb
source organism Encephalitozoon cuniculi (strain gb-m1)
molecule tags Transcription
total genus 25
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4wzsD01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4wzsD02
3VN5A 1VTOA 1PZDA 2IV9A 4ROEB 4WZSD 1PCZA 1AISA 1KY7A 1C9BB 1VOKA 2MJ7A 3EIKA 1QTSA 1QNCA 1TBAB 1QN7A 1KYFA 3OCIA 1NVPA 1KYUA 1KY6A 4B0AA 1VTLE 3H1ZA 1NH2A 1QN3A 1B9KA 2VJ0A 1QNBA 1MP9A 3HS8A 1D3UA 1TBPA 2D0BA 3ASMA 1QN9A 3HS9A 1QN4A 5IYDP 1KYDA 1QNEA 1JFIC 1QN6A 1R4XA 2IV8A 1YTBA 1RM1A 2D0AA 4ROCB 1QN5A 1VOLB 4PY5A 1QTPA 5IYBP 1NGMA 1E42A 2G30A 1CDWA 1QN8A 2Z8UA 3OC3C 1TGHA 1YTFA 5IYCP 1QNAA 2D0CA 1W80A 4RODB
chains in the Genus database with same CATH superfamily
2JPIA 3OLPA 4C7PA 1PZDA 3ULXA 1MPGA 1C9BB 2NVMA 3TDHA 2HL8A 2OOXA 2HKPA 1QNCA 1TBAB 3I0XA 1KYFA 1NVPA 1KY6A 2NWVA 2FGTA 3OSTA 1LWWA 3EAYA 5JMVD 2D0BA 3F10A 5IYDP 3HS9A 1QNEA 1M5Q1 2DKAA 2HZSA 1JFIC 1R4XA 2IV8A 1YTBA 2Y8QA 1QN5A 1KFQA 4MRQA 1KO9A 2JHNA 2V8QA 2YA3A 1P5DX 1QTPA 4CFFA 1Q9UA 2QREA 1EUVA 1LWYA 2G30A 3NA5A 4HJHA 1PCMX 2HZMA 5JN5A 2OOYA 1EBMA 2H4LX 2JOIA 1TGHA 1YTFA 3BKQX 1QN8A 2F7LA 1XSZA 5BMNA 3CVTA 1N3CA 1VTOA 1AISA 2I5WA 1PCZA 3DPUA 1KY7A 3TE5A 2MZ8A 4TPSA 3KTUA 3IH7A 2FKMX 2MJ7A 1LWVA 4EJZA 1QTSA 1N39A 2NOHA 3OCIA 3PDKA 1VTLE 1QN3A 2V92A 2DKCA 2Y8LA 3T4NA 1QN9A 2V9JA 1QN4A 1UT4A 1WQAA 2EHBD 2JHJA 4EAJA 2NOLA 2YH5A 1VOLB 1K35A 5AN4A 3RPJA 3OH6A 1NGMA 1C4GA 1YQMA 1E42A 4DULA 1CDWA 5EPCA 3OC3C 3OSEA 1QNAA 4D7QA 1K2YX 2D0CA 1KYUA 2PWWA 3C04A 4EJYA 4I8OA 2NOFA 3I0WA 3UW2A 5BMPA 4ROEB 3KRMA 2DKDA 2NLVA 1M3HA 1HU0A 1T6AA 2QR1A 1YQRA 5F9CA 3CWUA 1N3AA 4Q11A 2HL9A 1YQLA 2NOIA 3H1ZA 4EAGA 1B9KA 2VJ0A 1QNBA 1MP9A 3HS8A 1D3UA 1FN7A 4EAKA 4WX8A 2ZFDB 5HSHA 1KYDA 3ENCA 2NOZA 1RM1A 2D0AA 1J3MA 2XHIA 3F0ZA 3ENOC 1TUOA 4EAIA 3RSMA 3CW7A 2R5XA 2Z8UA 2NOEA 3DPTA 5IYCP 4D7RA 2FUVA 3CVSA 3VN5A 3D7QA 1JDYA 4WZSD 2IV9A 2QLVA 1C47A 2NOBA 3CWTA 1VOKA 4IL8A 3OSMA 3EIKA 1PVSA 3OH9A 1QN7A 4EALA 1DIZA 1KFIA 1WJWA 4B0AA 4WXAA 3D4VA 1NH2A 4QG5A 1TBPA 3ASMA 2H5AX 3SNSA 3CWAA 3OGDA 1LXTA 2QRCA 2QRDA 3I3WA 2Z0FA 1QN6A 5KL0A 2LAEA 3N89A 4ROCB 1M3QA 4BJUA 4PY5A 2O3OA 1YQKA 5IYBP 3CWSA 1PCJX 1VKLA 2FKFA 1P5GX 3PMGA 1V5SA 1UL7A 1W80A 1UT7A 4RODB
chains in the Genus database with same CATH topology
1PZDA 3ULXA 1C9BB 1QNCA 1TBAB 3I0XA 1KYFA 1NVPA 1KY6A 3OSTA 2FGTA 1LWWA 2D0BA 3F10A 5IYDP 3HS9A 1QNEA 2HZSA 1JFIC 1R4XA 2IV8A 1YTBA 1QN5A 1KO9A 1QTPA 1LWYA 2G30A 2HZMA 1EBMA 1TGHA 1YTFA 2JOIA 1QN8A 1N3CA 1VTOA 1AISA 2I5WA 1PCZA 3DPUA 1KY7A 2MZ8A 4TPSA 3KTUA 3IH7A 2MJ7A 1LWVA 4EJZA 1QTSA 1N39A 2NOHA 3OCIA 1VTLE 1QN3A 1QN9A 1QN4A 1UT4A 2NOLA 2YH5A 1VOLB 5AN4A 3RPJA 1NGMA 1YQMA 1E42A 4DULA 1CDWA 3OC3C 1QNAA 2D0CA 1KYUA 4EJYA 4I8OA 2NOFA 3I0WA 4ROEB 3KRMA 1HU0A 1M3HA 1YQRA 1N3AA 4Q11A 1YQLA 2NOIA 3H1ZA 1B9KA 2VJ0A 1QNBA 1MP9A 3HS8A 1D3UA 1KYDA 2NOZA 1RM1A 2D0AA 2XHIA 3F0ZA 2Z8UA 2NOEA 3DPTA 5IYCP 3VN5A 4WZSD 2IV9A 2NOBA 1VOKA 3OSMA 3EIKA 1QN7A 4B0AA 1NH2A 1TBPA 3ASMA 3SNSA 1QN6A 2LAEA 3N89A 4ROCB 1M3QA 4PY5A 2O3OA 1YQKA 5IYBP 1FN7A 1W80A 1UT7A 4RODB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VN5 A;  1VTO A;  1PZD A;  2IV9 A;  4ROE B;  4WZS D;  1PCZ A;  1AIS A;  1KY7 A;  1C9B B;  1VOK A;  2MJ7 A;  3EIK A;  1QTS A;  1QNC A;  1TBA B;  1QN7 A;  1KYF A;  3OCI A;  1NVP A;  1KYU A;  1KY6 A;  4B0A A;  1VTL E;  3H1Z A;  1NH2 A;  1QN3 A;  1B9K A;  2VJ0 A;  1QNB A;  1MP9 A;  3HS8 A;  1D3U A;  1TBP A;  2D0B A;  3ASM A;  1QN9 A;  3HS9 A;  1QN4 A;  5IYD P;  1KYD A;  1QNE A;  1JFI C;  1QN6 A;  1R4X A;  2IV8 A;  1YTB A;  1RM1 A;  2D0A A;  4ROC B;  1QN5 A;  1VOL B;  4PY5 A;  1QTP A;  5IYB P;  1NGM A;  1E42 A;  2G30 A;  1CDW A;  1QN8 A;  2Z8U A;  3OC3 C;  1TGH A;  1YTF A;  5IYC P;  1QNA A;  2D0C A;  1W80 A;  4ROD B; 
#chains in the Genus database with same CATH topology
 2JPI A;  3OLP A;  4C7P A;  1PZD A;  3ULX A;  1MPG A;  1C9B B;  2NVM A;  3TDH A;  2HL8 A;  2OOX A;  2HKP A;  1QNC A;  1TBA B;  3I0X A;  1KYF A;  1NVP A;  1KY6 A;  2NWV A;  2FGT A;  3OST A;  1LWW A;  3EAY A;  5JMV D;  2D0B A;  3F10 A;  5IYD P;  3HS9 A;  1QNE A;  1M5Q 1;  2DKA A;  2HZS A;  1JFI C;  1R4X A;  2IV8 A;  1YTB A;  2Y8Q A;  1QN5 A;  1KFQ A;  4MRQ A;  1KO9 A;  2JHN A;  2V8Q A;  2YA3 A;  1P5D X;  1QTP A;  4CFF A;  1Q9U A;  2QRE A;  1EUV A;  1LWY A;  2G30 A;  3NA5 A;  4HJH A;  1PCM X;  2HZM A;  5JN5 A;  2OOY A;  1EBM A;  2H4L X;  2JOI A;  1TGH A;  1YTF A;  3BKQ X;  1QN8 A;  2F7L A;  1XSZ A;  5BMN A;  3CVT A;  1N3C A;  1VTO A;  1AIS A;  2I5W A;  1PCZ A;  3DPU A;  1KY7 A;  3TE5 A;  2MZ8 A;  4TPS A;  3KTU A;  3IH7 A;  2FKM X;  2MJ7 A;  1LWV A;  4EJZ A;  1QTS A;  1N39 A;  2NOH A;  3OCI A;  3PDK A;  1VTL E;  1QN3 A;  2V92 A;  2DKC A;  2Y8L A;  3T4N A;  1QN9 A;  2V9J A;  1QN4 A;  1UT4 A;  1WQA A;  2EHB D;  2JHJ A;  4EAJ A;  2NOL A;  2YH5 A;  1VOL B;  1K35 A;  5AN4 A;  3RPJ A;  3OH6 A;  1NGM A;  1C4G A;  1YQM A;  1E42 A;  4DUL A;  1CDW A;  5EPC A;  3OC3 C;  3OSE A;  1QNA A;  4D7Q A;  1K2Y X;  2D0C A;  1KYU A;  2PWW A;  3C04 A;  4EJY A;  4I8O A;  2NOF A;  3I0W A;  3UW2 A;  5BMP A;  4ROE B;  3KRM A;  2DKD A;  2NLV A;  1M3H A;  1HU0 A;  1T6A A;  2QR1 A;  1YQR A;  5F9C A;  3CWU A;  1N3A A;  4Q11 A;  2HL9 A;  1YQL A;  2NOI A;  3H1Z A;  4EAG A;  1B9K A;  2VJ0 A;  1QNB A;  1MP9 A;  3HS8 A;  1D3U A;  1FN7 A;  4EAK A;  4WX8 A;  2ZFD B;  5HSH A;  1KYD A;  3ENC A;  2NOZ A;  1RM1 A;  2D0A A;  1J3M A;  2XHI A;  3F0Z A;  3ENO C;  1TUO A;  4EAI A;  3RSM A;  3CW7 A;  2R5X A;  2Z8U A;  2NOE A;  3DPT A;  5IYC P;  4D7R A;  2FUV A;  3CVS A;  3VN5 A;  3D7Q A;  1JDY A;  4WZS D;  2IV9 A;  2QLV A;  1C47 A;  2NOB A;  3CWT A;  1VOK A;  4IL8 A;  3OSM A;  3EIK A;  1PVS A;  3OH9 A;  1QN7 A;  4EAL A;  1DIZ A;  1KFI A;  1WJW A;  4B0A A;  4WXA A;  3D4V A;  1NH2 A;  4QG5 A;  1TBP A;  3ASM A;  2H5A X;  3SNS A;  3CWA A;  3OGD A;  1LXT A;  2QRC A;  2QRD A;  3I3W A;  2Z0F A;  1QN6 A;  5KL0 A;  2LAE A;  3N89 A;  4ROC B;  1M3Q A;  4BJU A;  4PY5 A;  2O3O A;  1YQK A;  5IYB P;  3CWS A;  1PCJ X;  1VKL A;  2FKF A;  1P5G X;  3PMG A;  1V5S A;  1UL7 A;  1W80 A;  1UT7 A;  4ROD B; 
#chains in the Genus database with same CATH homology
 1PZD A;  3ULX A;  1C9B B;  1QNC A;  1TBA B;  3I0X A;  1KYF A;  1NVP A;  1KY6 A;  3OST A;  2FGT A;  1LWW A;  2D0B A;  3F10 A;  5IYD P;  3HS9 A;  1QNE A;  2HZS A;  1JFI C;  1R4X A;  2IV8 A;  1YTB A;  1QN5 A;  1KO9 A;  1QTP A;  1LWY A;  2G30 A;  2HZM A;  1EBM A;  1TGH A;  1YTF A;  2JOI A;  1QN8 A;  1N3C A;  1VTO A;  1AIS A;  2I5W A;  1PCZ A;  3DPU A;  1KY7 A;  2MZ8 A;  4TPS A;  3KTU A;  3IH7 A;  2MJ7 A;  1LWV A;  4EJZ A;  1QTS A;  1N39 A;  2NOH A;  3OCI A;  1VTL E;  1QN3 A;  1QN9 A;  1QN4 A;  1UT4 A;  2NOL A;  2YH5 A;  1VOL B;  5AN4 A;  3RPJ A;  1NGM A;  1YQM A;  1E42 A;  4DUL A;  1CDW A;  3OC3 C;  1QNA A;  2D0C A;  1KYU A;  4EJY A;  4I8O A;  2NOF A;  3I0W A;  4ROE B;  3KRM A;  1HU0 A;  1M3H A;  1YQR A;  1N3A A;  4Q11 A;  1YQL A;  2NOI A;  3H1Z A;  1B9K A;  2VJ0 A;  1QNB A;  1MP9 A;  3HS8 A;  1D3U A;  1KYD A;  2NOZ A;  1RM1 A;  2D0A A;  2XHI A;  3F0Z A;  2Z8U A;  2NOE A;  3DPT A;  5IYC P;  3VN5 A;  4WZS D;  2IV9 A;  2NOB A;  1VOK A;  3OSM A;  3EIK A;  1QN7 A;  4B0A A;  1NH2 A;  1TBP A;  3ASM A;  3SNS A;  1QN6 A;  2LAE A;  3N89 A;  4ROC B;  1M3Q A;  4PY5 A;  2O3O A;  1YQK A;  5IYB P;  1FN7 A;  1W80 A;  1UT7 A;  4ROD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...