4WZSD

Crystal structure of the mot1 n-terminal domain in complex with tbp and nc2 bound to a promoter dna fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
178
structure length
178
Chain Sequence
SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords ECU11_1470 protein
publication title Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1.
pubmed doi rcsb
source organism Encephalitozoon cuniculi (strain gb-m1)
total genus 25
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4wzsD01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4wzsD02
1VOKA 2Z8UA 2G30A 1QTSA 3VN5A 1KYUA 2D0AA 1B9KA 1QNBA 5IYBP 1QN4A 1JFIC 1PZDA 1VOLB 3ASMA 2D0BA 1NH2A 1QN5A 1C9BB 4B0AA 1QN8A 1YTFA 3H1ZA 3HS9A 1QN3A 1W80A 1QN6A 1QN9A 3OC3C 1NGMA 1R4XA 3HS8A 2MJ7A 1E42A 1QN7A 4ROCB 1TBPA 1KYFA 1D3UA 1YTBA 1TBAB 2IV8A 3EIKA 2D0CA 1PCZA 4ROEB 1AISA 1VTOA 3OCIA 1RM1A 1QNCA 5IYDP 1CDWA 1QTPA 1KYDA 1QNAA 4PY5A 1KY6A 2VJ0A 1KY7A 2IV9A 1NVPA 4RODB 1MP9A 1QNEA 4WZSD 5IYCP 1TGHA 1VTLE
chains in the Genus database with same CATH superfamily
2R5XA 1VOKA 2FKMX 2NWVA 2Z8UA 4IL8A 1KYUA 2HZSA 1QNBA 2DKCA 2QR1A 1JFIC 3CW7A 1PZDA 1EUVA 1M5Q1 2D0BA 2I5WA 3T4NA 3UW2A 5F9CA 3I0XA 1C9BB 4TPSA 1QN3A 1QN6A 3TDHA 1QN9A 1WJWA 2NOEA 2ZFDB 2MJ7A 1JDYA 1KYFA 1PVSA 1YTBA 4D7QA 2H4LX 2NOZA 2D0CA 1PCZA 2V9JA 1LXTA 3OCIA 1LWVA 1DIZA 3F0ZA 1QTPA 5EPCA 3CWTA 2QRDA 1KYDA 2LAEA 5KL0A 3RPJA 4C7PA 1KY6A 2VJ0A 5HSHA 2IV9A 4EAGA 4RODB 1TGHA 1P5DX 2NLVA 2JOIA 1K2YX 2JHJA 1B9KA 4I8OA 2OOYA 5AN4A 1NH2A 1QN8A 4B0AA 2JHNA 3H1ZA 3CWUA 2NOIA 1YQMA 1W80A 2HKPA 5JMVD 1R4XA 4MRQA 1TUOA 3OSTA 1E42A 3EAYA 3IH7A 1TBPA 4WXAA 2H5AX 4CFFA 1D3UA 1TBAB 4Q11A 2NOFA 1RM1A 1VKLA 4BJUA 3TE5A 1N3AA 2Y8LA 1MPGA 2O3OA 2FUVA 4WZSD 3DPTA 1VTLE 1T6AA 1QTSA 3NA5A 3VN5A 2DKAA 2Y8QA 1M3QA 5IYBP 1QN4A 3N89A 1VOLB 1C47A 3ASMA 2NVMA 1UL7A 5BMPA 1QN5A 2V8QA 3C04A 1K35A 1LWWA 4DULA 3RSMA 3KTUA 5JN5A 3ENCA 1C4GA 3OGDA 3PDKA 2NOLA 4EAIA 3ULXA 5BMNA 1XSZA 3OH6A 1HU0A 1QN7A 4QG5A 2DKDA 3EIKA 4ROEB 2QLVA 3CWSA 1N3CA 2JPIA 4WX8A 1VTOA 4EAJA 2QRCA 1QNCA 3CVSA 3PMGA 2YH5A 1KFQA 4EALA 1J3MA 1PCJX 1EBMA 2FKFA 1QNAA 4PY5A 2XHIA 1YQRA 1PCMX 2NOHA 1MP9A 1UT7A 5IYCP 2YA3A 1M3HA 2G30A 2OOXA 3BKQX 3D4VA 3ENOC 2D0AA 3DPUA 3D7QA 1LWYA 3KRMA 4EJZA 1YTFA 2F7LA 2NOBA 1KFIA 3HS9A 1YQKA 2EHBD 3F10A 3SNSA 3OC3C 1NGMA 4EAKA 3HS8A 1YQLA 1N39A 4ROCB 2MZ8A 2IV8A 1WQAA 1UT4A 2HL9A 2HZMA 2QREA 3I3WA 3OLPA 3OSMA 1AISA 1Q9UA 5IYDP 2HL8A 1CDWA 1V5SA 3CVTA 1FN7A 4EJYA 1P5GX 2V92A 2Z0FA 3OSEA 2FGTA 1KO9A 1KY7A 4HJHA 1NVPA 3I0WA 1QNEA 4D7RA 3CWAA 3OH9A 2PWWA
chains in the Genus database with same CATH topology
1VOKA 2Z8UA 1KYUA 2HZSA 1QNBA 1JFIC 1PZDA 2D0BA 2I5WA 3I0XA 1C9BB 4TPSA 1QN3A 1QN6A 1QN9A 2NOEA 2MJ7A 1YTBA 1KYFA 2NOZA 2D0CA 1PCZA 3OCIA 1LWVA 3F0ZA 1QTPA 3RPJA 1KYDA 2LAEA 1KY6A 2VJ0A 2IV9A 4RODB 1TGHA 2JOIA 1B9KA 4I8OA 5AN4A 1NH2A 1QN8A 4B0AA 3H1ZA 2NOIA 1YQMA 1W80A 1R4XA 3OSTA 1E42A 3IH7A 1TBPA 1D3UA 1TBAB 4Q11A 2NOFA 1RM1A 1N3AA 2O3OA 4WZSD 1VTLE 3DPTA 1QTSA 3VN5A 1M3QA 5IYBP 1QN4A 3N89A 1VOLB 3ASMA 1QN5A 1LWWA 4DULA 3KTUA 2NOLA 3ULXA 1QN7A 1HU0A 3EIKA 4ROEB 1N3CA 1VTOA 1QNCA 2YH5A 1EBMA 1QNAA 4PY5A 2XHIA 1YQRA 2NOHA 1MP9A 1UT7A 5IYCP 1M3HA 2G30A 2D0AA 3DPUA 1LWYA 3KRMA 4EJZA 1YTFA 2NOBA 3HS9A 1YQKA 3F10A 3SNSA 3OC3C 1NGMA 3HS8A 1YQLA 1N39A 4ROCB 2MZ8A 2IV8A 1AISA 1UT4A 2HZMA 3OSMA 5IYDP 1CDWA 4EJYA 1FN7A 2FGTA 1KO9A 1KY7A 1NVPA 3I0WA 1QNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VOK A;  2Z8U A;  2G30 A;  1QTS A;  3VN5 A;  1KYU A;  2D0A A;  1B9K A;  1QNB A;  5IYB P;  1QN4 A;  1JFI C;  1PZD A;  1VOL B;  3ASM A;  2D0B A;  1NH2 A;  1QN5 A;  1C9B B;  4B0A A;  1QN8 A;  1YTF A;  3H1Z A;  3HS9 A;  1QN3 A;  1W80 A;  1QN6 A;  1QN9 A;  3OC3 C;  1NGM A;  1R4X A;  3HS8 A;  2MJ7 A;  1E42 A;  1QN7 A;  4ROC B;  1TBP A;  1KYF A;  1D3U A;  1YTB A;  1TBA B;  2IV8 A;  3EIK A;  2D0C A;  1PCZ A;  4ROE B;  1AIS A;  1VTO A;  3OCI A;  1RM1 A;  1QNC A;  5IYD P;  1CDW A;  1QTP A;  1KYD A;  1QNA A;  4PY5 A;  1KY6 A;  2VJ0 A;  1KY7 A;  2IV9 A;  1NVP A;  4ROD B;  1MP9 A;  1QNE A;  4WZS D;  5IYC P;  1TGH A;  1VTL E; 
#chains in the Genus database with same CATH topology
 2R5X A;  1VOK A;  2FKM X;  2NWV A;  2Z8U A;  4IL8 A;  1KYU A;  2HZS A;  1QNB A;  2DKC A;  2QR1 A;  1JFI C;  3CW7 A;  1PZD A;  1EUV A;  1M5Q 1;  2D0B A;  2I5W A;  3T4N A;  3UW2 A;  5F9C A;  3I0X A;  1C9B B;  4TPS A;  1QN3 A;  1QN6 A;  3TDH A;  1QN9 A;  1WJW A;  2NOE A;  2ZFD B;  2MJ7 A;  1JDY A;  1KYF A;  1PVS A;  1YTB A;  4D7Q A;  2H4L X;  2NOZ A;  2D0C A;  1PCZ A;  2V9J A;  1LXT A;  3OCI A;  1LWV A;  1DIZ A;  3F0Z A;  1QTP A;  5EPC A;  3CWT A;  2QRD A;  1KYD A;  2LAE A;  5KL0 A;  3RPJ A;  4C7P A;  1KY6 A;  2VJ0 A;  5HSH A;  2IV9 A;  4EAG A;  4ROD B;  1TGH A;  1P5D X;  2NLV A;  2JOI A;  1K2Y X;  2JHJ A;  1B9K A;  4I8O A;  2OOY A;  5AN4 A;  1NH2 A;  1QN8 A;  4B0A A;  2JHN A;  3H1Z A;  3CWU A;  2NOI A;  1YQM A;  1W80 A;  2HKP A;  5JMV D;  1R4X A;  4MRQ A;  1TUO A;  3OST A;  1E42 A;  3EAY A;  3IH7 A;  1TBP A;  4WXA A;  2H5A X;  4CFF A;  1D3U A;  1TBA B;  4Q11 A;  2NOF A;  1RM1 A;  1VKL A;  4BJU A;  3TE5 A;  1N3A A;  2Y8L A;  1MPG A;  2O3O A;  2FUV A;  4WZS D;  3DPT A;  1VTL E;  1T6A A;  1QTS A;  3NA5 A;  3VN5 A;  2DKA A;  2Y8Q A;  1M3Q A;  5IYB P;  1QN4 A;  3N89 A;  1VOL B;  1C47 A;  3ASM A;  2NVM A;  1UL7 A;  5BMP A;  1QN5 A;  2V8Q A;  3C04 A;  1K35 A;  1LWW A;  4DUL A;  3RSM A;  3KTU A;  5JN5 A;  3ENC A;  1C4G A;  3OGD A;  3PDK A;  2NOL A;  4EAI A;  3ULX A;  5BMN A;  1XSZ A;  3OH6 A;  1HU0 A;  1QN7 A;  4QG5 A;  2DKD A;  3EIK A;  4ROE B;  2QLV A;  3CWS A;  1N3C A;  2JPI A;  4WX8 A;  1VTO A;  4EAJ A;  2QRC A;  1QNC A;  3CVS A;  3PMG A;  2YH5 A;  1KFQ A;  4EAL A;  1J3M A;  1PCJ X;  1EBM A;  2FKF A;  1QNA A;  4PY5 A;  2XHI A;  1YQR A;  1PCM X;  2NOH A;  1MP9 A;  1UT7 A;  5IYC P;  2YA3 A;  1M3H A;  2G30 A;  2OOX A;  3BKQ X;  3D4V A;  3ENO C;  2D0A A;  3DPU A;  3D7Q A;  1LWY A;  3KRM A;  4EJZ A;  1YTF A;  2F7L A;  2NOB A;  1KFI A;  3HS9 A;  1YQK A;  2EHB D;  3F10 A;  3SNS A;  3OC3 C;  1NGM A;  4EAK A;  3HS8 A;  1YQL A;  1N39 A;  4ROC B;  2MZ8 A;  2IV8 A;  1WQA A;  1UT4 A;  2HL9 A;  2HZM A;  2QRE A;  3I3W A;  3OLP A;  3OSM A;  1AIS A;  1Q9U A;  5IYD P;  2HL8 A;  1CDW A;  1V5S A;  3CVT A;  1FN7 A;  4EJY A;  1P5G X;  2V92 A;  2Z0F A;  3OSE A;  2FGT A;  1KO9 A;  1KY7 A;  4HJH A;  1NVP A;  3I0W A;  1QNE A;  4D7R A;  3CWA A;  3OH9 A;  2PWW A; 
#chains in the Genus database with same CATH homology
 1VOK A;  2Z8U A;  1KYU A;  2HZS A;  1QNB A;  1JFI C;  1PZD A;  2D0B A;  2I5W A;  3I0X A;  1C9B B;  4TPS A;  1QN3 A;  1QN6 A;  1QN9 A;  2NOE A;  2MJ7 A;  1YTB A;  1KYF A;  2NOZ A;  2D0C A;  1PCZ A;  3OCI A;  1LWV A;  3F0Z A;  1QTP A;  3RPJ A;  1KYD A;  2LAE A;  1KY6 A;  2VJ0 A;  2IV9 A;  4ROD B;  1TGH A;  2JOI A;  1B9K A;  4I8O A;  5AN4 A;  1NH2 A;  1QN8 A;  4B0A A;  3H1Z A;  2NOI A;  1YQM A;  1W80 A;  1R4X A;  3OST A;  1E42 A;  3IH7 A;  1TBP A;  1D3U A;  1TBA B;  4Q11 A;  2NOF A;  1RM1 A;  1N3A A;  2O3O A;  4WZS D;  1VTL E;  3DPT A;  1QTS A;  3VN5 A;  1M3Q A;  5IYB P;  1QN4 A;  3N89 A;  1VOL B;  3ASM A;  1QN5 A;  1LWW A;  4DUL A;  3KTU A;  2NOL A;  3ULX A;  1QN7 A;  1HU0 A;  3EIK A;  4ROE B;  1N3C A;  1VTO A;  1QNC A;  2YH5 A;  1EBM A;  1QNA A;  4PY5 A;  2XHI A;  1YQR A;  2NOH A;  1MP9 A;  1UT7 A;  5IYC P;  1M3H A;  2G30 A;  2D0A A;  3DPU A;  1LWY A;  3KRM A;  4EJZ A;  1YTF A;  2NOB A;  3HS9 A;  1YQK A;  3F10 A;  3SNS A;  3OC3 C;  1NGM A;  3HS8 A;  1YQL A;  1N39 A;  4ROC B;  2MZ8 A;  2IV8 A;  1AIS A;  1UT4 A;  2HZM A;  3OSM A;  5IYD P;  1CDW A;  4EJY A;  1FN7 A;  2FGT A;  1KO9 A;  1KY7 A;  1NVP A;  3I0W A;  1QNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...