1KYDA

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
total genus 68
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kydA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kydA02
1TBAB 3HS8A 2D0BA 4RODB 1NGMA 3OCIA 1PZDA 1QNEA 2YMTA 1GYUA 1TBPA 3H1ZA 1GYVA 2IV8A 1QN8A 1QTSA 4PY5A 1QNCA 3ZHFA 1QN3A 1C9BB 2VJ0A 1KY6A 4ROEB 1E42A 5CN1A 2G30A 1R4XA 3ZY7A 1KYFA 1QTPA 1QN5A 5CN2A 4BCXA 1KYDA 1GYWA 2Z8UA 1OM9A 1B9KA 2E9GA 1YTBA 1VOLB 3HS9A 1TGHA 1IU1A 1MP9A 3OC3C 3EIKA 1YTFA 1RM1A 1P4UA 1CDWA 5IYCP 2DWYA 1D3UA 1QNAA 1W80A 2D0AA 1QN9A 3MNMA 1PCZA 1VTLE 2IV9A 3ASMA 1QN7A 1KY7A 1NH2A 1VOKA 1QNBA 1NA8A 2D0CA 1AISA 5IYBP 1QN6A 2DWXA 5IYDP 4ROCB 1JFIC 4WZSD 2MJ7A 1QN4A 4B0AA 3VN5A 1KYUA 1NVPA 1VTOA 2A7BA
chains in the Genus database with same CATH superfamily
2XX1A 3CU1A 3DO4A 5HPMA 2EDLA 4F58L 1RZPA 1MDAA 3M86A 5DGRA 1KGUA 4P5MB 1PG7W 4GG8A 4LE8A 1RJYA 1QD0A 3KM2A 1G0XA 3KYKL 5HDOA 1IT9L 1N12A 5KVDH 3DNKA 4U1LB 2CRZA 2WXMA 3MACH 2DI7A 2YOCA 4RMUA 4ZAKB 4XNXL 5EOCH 1E7UA 5FW6A 2SODB 4JDTH 2ZYHA 4Y4FA 5BV7H 3GSOB 3JV6B 3WKYA 3ZDZB 5BRQA 4HUXB 5IFHL 1AGBB 4FFYA 1EO8L 4LLMA 3K2MC 4OVVA 5DMKB 4JREB 2Y25A 2NY4C 1EUTA 2AZAA 3MREB 1Z9PA 3SSGA 3ZHLA 1VFAB 1F02I 2CJ3A 4OCRL 3EFDH 4V1DA 1X5KA 5I1KH 4OGXH 5A2KH 1MWOA 1UWXH 3UBHA 4JDTL 3TJEH 3AAZB 5ESQB 3V8CA 5EOCL 3KLHC 4NP4H 3MCKB 4FQPA 1JV5A 4PPTA 5C0IA 2MPAH 5D9SA 3S35L 4WO4B 4A2LA 3CLEL 1PSKL 5ISZD 4HCRL 3ZZLA 4NOBA 1YNTB 2J6EA 3HJEA 4J3OG 4Y2OB 5CR8A 4NQCB 3AS0A 2ZX9A 5AB0A 3UOAB 1WS8A 2LLGA 5FW8A 4KQ3L 4WNSA 2RJMA 2VR5A 3KGSA 3FT2A 4HFUL 2QGCA 4W4OA 1A6UL 4WUUD 5GISH 5E6SB 1OGAB 3TBSA 1R5WB 5DRZB 3MFGB 4HSQA 3J27A 2WIIB 3MU3A 4A6YL 3MCLL 1DBKH 4YXHL 5HI4D 1XZ0B 4CUCA 1KLFB 2E5EA 3O3AA 3RUGE 4NYLA 1BBJA 3BMWA 1U0QA 2BJMH 4LCWA 1QUNA 2I07A 2EDFA 3E6HB 4FQ1L 1UT7A 4MRBA 3HUJF 4RWYL 5TQ0H 3VXME 4AKOA 1GRWA 2WLJA 4UINL 1HXKA 3QIBC 2J8OA 3FRPA 1BF2A 1CICD 3BDYL 3DI3B 2OA9A 4FGMA 4TPSA 1XH2A 4ZSOE 2A0LD 5FV1L 5IMMA 2FR4A 4J4PC 2YD2A 3RP1A 2ATKB 4XBPB 3X17A 3DXAE 2FHCA 3D09A 3RJOA 5C3LD 3P54A 4KRPD 3HMXH 2XA3A 4ZUSB 3LXAA 3O3UN 4LSPH 3T8XB 4Z7UF 2B0SL 1FZMA 3F7KA 3KGTA 3CVTA 1N64L 4ELKB 1MNUL 3PGDA 3I0WA 3HB3D 1DVYA 4H25B 12E8L 2F7QA 3A21A 4KDTC 3Q2WA 5C2BH 4PP1C 4FL4B 2B08A 1MCPH 1JDAA 3U1QA 4YN3A 1XF1A 1J7VR 3LNFA 2Y7MA 3BN9C 4LEEA 1RIVL 2VJXA 1W0WA 3VAEA 1F13A 1ZV2A 5K1JA 1G4MA 1DVQA 1TNMA 3ASWA 5IVNA 2PWFA 2FLRT 4D0CB 5IBTH 3IFOB 4Y19D 4FULA 1IBFA 2ZSWB 1E28A 3O3EB 5E9DB 4LLVA 2E9BA 4U6VL 4F7CB 6PAZA 3U4KA 4PVLA 2VWEC 4LLQB 2BWQA 5CN1A 3GTTA 5HGHB 1KEGH 3QZMA 1CXFA 5C2BL 2FJHA 2ZYSA 3DVNB 1ETB1 1CI3M 2ZSVA 4I0KA 1AO7A 3WNMA 1DQIA 2NYYD 3G5XA 1KLGA 3QR0A 3VX0A 5GRUL 2ESVA 1J5CA 5DDHA 1JP5A 3IFLL 4LSPL 1BLNB 4KI5C 2UYLA 2V5TA 3BOVA 2GC4C 5DS1A 1MFCH 1I3GL 4KI5F 4ZK8A 4MJID 3UERA 1JOIA 3HLAB 2IBZX 2VSMB 4KVPA 2UZIL 3VXSA 2VLJA 1AXSA 1DBJH 1G4RA 1MJUL 1YMHA 2P7TA 2DQMA 3MRDA 2VAAB 4NCDA 3UPAA 4Z76A 1FN4B 2V3FA 4AMKL 2I9LA 3ARGD 3O4LD 3MGOA 2I5YH 2HX7A 4RAUB 3C9NB 3BKYH 1IBYA 4BZ2H 4E68A 1DN0A 1X7QA 2I85A 2XN1A 3BP5B 1B9KA 5GGRY 2XDHA 3UMNA 5CCJA 3GSWA 4YE4L 3SKOB 2GHZA 3OXRA 2Q8BH 5F89B 5IVZB 4ZAKC 4F7MA 1PZBA 4M1GL 5AAWA 3D07A 2F74A 1WBZA 4LARH 4WKZB 1E4JA 1FZOA 2OZ4L 1SY6A 3RZCA 2D0HA 1F1GA 2Z6FA 4PGEB 1FIGH 4JQIL 5DVLA 3EO0B 2BNUA 3US9A 1NCJA 3VD0A 1QFUL 1NCBL 4FYTA 2D8KA 2UX6A 3B8YA 4B0MM 1GZQA 2D31A 1A6UH 3CUPB 5GRJL 4MNHA 2HFEA 1UXSB 4LHUG 4TQIA 4UIKH 5ECJE 3ECUA 4DOHE 5T1LA 2A6DA 1BFOA 2PR9A 1HJBC 4V1DD 1I1AC 1T6WA 3SDDD 4RRPA 1SXCA 3NA9L 4IBTA 3VI4F 4N1HB 3ZDXF 2A6JB 2DMBA 2APFA 1IIIA 1T1XA 4LLWA 4G1EB 3RZCC 4HCRH 2K9FB 4J2XA 1IGCL 5F0JB 5K9JH 3VI4E 1LD9B 1ET7A 4HSCX 3RPKA 4GXFA 2DMGA 4XNYH 3VYPA 3BZDA 2PUQT 4NRYA 3T2NL 3NCJL 1SEQH 4OD2A 4XP9L 1A64A 3GLEA 2FWOB 4CGTA 1M7IB 1LNUA 2DJMA 2NZ9D 2L04A 3WXWL 5JXED 5DEFB 1KN4H 2NT1A 3C5JA 1AD0A 1PZDA 2GUYA 2JI3A 2ZP8A 3FT3A 3G5WA 4PJHB 2QBWA 5D96B 4HWEH 1E5UI 3CFBA 1KGCD 4ONFL 2VW4A 1OE1A 5D93C 1OK8A 4XCNB 3FUMA 5KBMA 5J3HD 1D5MB 3UCRA 1CD8A 4K9EC 4DFHA 1A8JH 3QS3A 2F7OA 4NSKA 3D18A 4AT6B 3B9AA 2Y72A 4BJLA 1PJ9A 5ADOL 1JRHL 1T22B 1M9SA 5E6IC 3Q8BA 1KCSH 2R59A 3HNTL 3PWLB 1MVUA 4TPRL 1CXIA 3P73B 2XQYK 2JNZA 2ERJB 5I73B 2FJGA 2AXHA 4H0HB 3BKQX 3F00A 5MENE 3CWSA 1SYSB 5FGCB 4OLXH 1QEWA 4ZTPL 5FUZL 1YDPB 2XY2A 1TJGH 1AG0A 3I85A 2D9QB 4Z7WA 3QH3A 3RPJA 4Y1AA 4Y4KA 1RHHB 4FQ2H 2Z1PA 1QFOA 3X13A 2R4RL 3QEQE 3G6DL 3CXDH 4AC2A 3MRGA 4MNGB 3FO9B 5FO7B 5LGHL 5GGTA 1XSJA 4K8RL 1TZIA 2I25N 4S0HA 5I30L 3PIQB 1JPFA 4I2XB 2D7TH 2GY5A 2RFXA 4G8EB 4J6RL 4UM9B 3QUHA 4N2DA 1TZGH 1CLYL 4XRCB 3BE1L 2LOEA 5CINH 1WT5A 4RZKA 2G2RA 1QR4A 2KBGA 1Z3GL 3BW9A 3R19A 5KVEH 1I53A 4KV5E 2R2BA 1M2OA 1MRFH 3QWRD 4QRSA 1BWMA 3NRPA 3B2VH 5KS9F 4N8UA 2DS4A 4XPFH 3ARED 3G08B 1PQZA 1RKRA 3BYYA 2CSPA 5FO7A 1S7UB 3V7AG 3W39A 4W9LC 4WTWA 3KYNA 1ZKAA 3QHFH 3CDZB 3HFML 2A6KB 2VDNH 4IMKA 2MFNA 4NJAL 3RI5K 3F6LA 3JV4B 1VTLE 3PWPA 2EIKB 1SEBA 5C07E 3CDCA 4FF9A 4WFHD 1KELL 5DJYB 1X44A 1ZT4B 4ELME 1SBBA 3OKKA 1NKRA 5ADPL 4B9JA 5DC4B 3EOYG 5CD5D 3FRUB 1A3LL 4FG6C 1AQMA 2BVQA 2V9QA 3FN3A 4HOMA 3EUUA 1BXXA 4L3EB 3OKKB 5H4YA 1JXFA 3V4UL 4WW2F 2AITA 3UP1A 1LEKA 5A2BA 5EO0B 4DN3L 4GIAA 4FNLL 5E5MA 1PZ5B 3MA7B 4LPVA 1LWRA 1KCVL 3PJSA 4XP5L 1Z66A 4OUUA 4DCQA 4ZXBA 3ZN6A 3L7EA 4BQ8A 3WDIA 2ESVE 3BH9A 1W0VB 3QJFB 4HF5H 1DFBL 1EXUA 4TNVK 4X99B 3VWKA 1GTFA 5F7WC 3P9LB 3UPCA 3T0AA 3F64A 35C8H 1W6WA 3ILQC 3I9PA 1E4XH 4CVZB 2CUIA 4ZUTB 2WMPA 1Y0LB 3U7YL 1J0IA 1XF5A 2BO0A 4P8QA 2FLBT 2ICEC 3QJRB 4WNQA 4MJHA 3KYMB 1A66A 3IU3A 1FE8L 3L95A 2ZKWA 4EZLA 2FO1A 1YC8A 3FB8A 3U82B 3X1GA 2IFGA 1C5DB 1P84J 3AABA 3QNYA 5SWZE 3BSHA 3L3OA 3C8KA 3OTTA 3VXRB 1D5IL 4G6ML 1CIUA 4UZGA 1RULH 1CWVA 3ILQD 5JNYB 4IQHA 4PRPE 3H2QA 2MIZA 3TJPA 1R75A 3EAKA 3SQOL 5IESH 4GRLC 1LO2H 2FUQA 3JT2A 3RB5A 4B7IA 1HCFX 2X4UB 2ZCKL 1YDPA 3CLFH 3NCFB 1XIWA 3RU8H 3ZY7A 4Q97A 3H85A 1O5DT 7FABL 5LB1A 3RBSA 3IAGC 1N39A 1SMAA 1FNHA 1IIKA 4HPOH 4QXUL 1U95B 1PVSA 2JXMA 1CGXA 4S2SA 4LNRA 4UUJB 4FMKA 3VI3B 4OLYH 4J3OH 1AD9A 4LSVL 2HT4D 3O9WD 5BXFA 4N0UE 3PDGA 4PJIA 2HLEB 2G4EA 2OOYA 3OLIA 3JZYA 3BIKA 3L1OL 3PQYA 4N0CC 3TA3B 4AGNA 1XF3A 3M17B 3K0YA 1RP9A 4PV8A 4IRZL 1P5UA 5I1JL 3NSFA 2DKAA 4H1LA 3CIAA 3H42H 3W9EA 4LLUA 4W6WB 2BSBA 1HHKB 1OAYL 4FAAB 4DUWA 4QPEA 2FZ3B 3VG0L 3JWNG 3DA0A 1OSPL 1LNUB 4XO4A 1IO4C 2CA3A 3KPTA 4OD2B 1ICTA 2G75B 2OP4L 1PY0A 3SQBB 1OOWA 3IVKB 1R33A 5BZDB 4PWJA 2E47A 2Z4TA 4FLOA 4PWEA 3RDTC 5SV3A 4IGBA 4YSDA 1VERA 3B56A 4LIQE 3S5YA 3SY0A 3WNPA 1YEGH 5I1GL 5EUOE 4RRPM 1VFUA 5L9DH 4HC1L 4AQ1A 1KFIA 1AISA 4JJHA 4UOW0 4IBSA 4YSUA 3QHFL 5IW1B 4YPJA 1UWXK 3PWUA 1NSNH 2WZPA 4LSSH 3BQUC 4PGBA 3O3EA 4TTDD 5C0EA 1OSEA 3FO1A 5I9QB 2LVEA 3QBTB 3ZO9A 3V8OA 4LDEB 4R4BB 3OSEA 4B0AA 1M6OB 2XBTA 1YQLA 3CHPA 3HBGA 1OANA 2EDQA 4FN0A 4M6AA 4AQEA 1WFOA 3OGDA 1TCMA 1L0QA 4O9HH 3KPRE 2P5WB 5KVEL 2VLRB 1BREA 3NJKA 4YL4A 4NS0A 1CUOA 3WN5C 5IQ7H 4Y4FC 1SY6H 4EF3A 5I16A 4E9LA 5IEKA 5EC2A 1J87A 2X4SB 4LVOB 3KDPB 5B1KA 5T3XE 5D1ZA 4Z77A 2GBUA 2FKMX 5HHVH 2R2CA 3T8XA 1F3DJ 4ZUSA 3UCQA 3QRGH 1T1YA 2JH2A 2QQNH 3BZFB 2FX7L 1ZEAH 3GXFA 2JSFA 3QXDB 2R0ZL 5DFVD 1XMEB 3WNOA 5HHPB 3X3GL 3RY6C 4L4VB 4YDLC 3TT1L 1ORQB 4UIMB 1T89A 3HA0A 2OOXA 3ARDC 1KCRL 4EIGB 4RLDA 4TUKL 4BUQA 3EHBD 3J8F7 3U36B 4BBWA 4KKLC 1E8YA 3CFQA 1MCKA 1IKNA 3O4OB 3VUAA 3BKJL 4X9YA 1SLXA 5JW5A 4G5ZH 1DBBH 1NCAL 1CD9B 4IIZA 5CBEB 4OCWH 2XJLA 4UUJA 1E90A 3FUFA 5CILH 2I7OA 4HZLB 3OZ9L 2YPLD 1AJ7H 3ME0A 2Z8UA 4QAMB 4ODVL 5DHDA 3B2UD 1KCLA 5F7KC 3WXWH 4OI8A 1F3JA 2D03L 5KS9B 2IPTL 4POUB 4B9FA 3BZ5A 3F85A 1MAJA 4B5ZA 4CN6A 1FNLA 2Z93B 3GSQB 4HLJA 1RL1A 3EH4B 2ZOWA 3H9SE 5L2JB 4XVUD 5B7FA 1P4UA 2Y06H 4WX8A 3AWFA 1TJIH 2OW7A 1A7RL 5DMJB 2GJZB 1YVLA 1U3HD 3AAZA 2WPGA 5ESQA 1OLLA 4C83A 2EYRA 4BSVB 1MFBH 2UY6A 4D9QD 5HI4C 2VR8A 1T83C 2CRYA 4CL7A 3BT2L 1XF5B 3DGCR 2DBJA 4LRNH 1QPKA 3WS6A 2XTSA 4BCZA 3I6GA 4AM0A 1ID2A 3MRRB 1SDAB 1XSKA 5H37G 3ZGIA 2EDKA 1IGFL 3A6BL 4ZFZB 1AKPA 1B0GA 1A3RH 1X5HA 2DW5A 3B4NA 4C56D 4HUXA 2E4TA 1RZJC 1F6AA 1IKOP 3DOIA 4V33A 4AEHH 1IC1A 4KFMA 1QN4A 5HHOB 1LL1A 5DD1H 3GSRA 4KJQC 1LEKB 2OI9C 2A83A 2JJUA 1CG9A 1DQML 2DYSB 3AVEA 3T5WA 5JR1L 2VN7A 4WHTA 1JFQL 3OKDA 3TO4A 2QPFA 4FA7B 1NCBH 2A9AA 4IHOB 5FPIA 1Z5HA 1UZ6E 4DERA 4FX5A 2GT9A 2EC9T 1G9EA 5KS9E 2O61B 5KSBF 5G55A 3QB7C 1QBBA 1X9LA 3FH7A 4JDZB 5F6HJ 1S9XB 4APQB 1JJUA 3WKNA 4CN4A 1ONQB 2VNCA 3JV4A 4FQLL 3S48A 5FYLL 4I18C 1SHXA 4YX2L 3FQNB 5IG7B 4YHIB 2IVFC 2KS0A 1QRNA 1FORL 2BFGA 3WG7B 4HJGB 2I5YL 3DOHA 4YR6A 2TSAA 4ELMF 1HCVA 1XVSA 4QGTA 4Z7NF 3FUDA 4TL4A 1AR1B 3D9AH 2IDQA 4HGMA 1HH6A 1S7WA 2BZ7A 4ZMQA 3W38A 3WEAA 1T0NB 4R0LC 1BDYA 4WK2B 4WO4D 1UH4A 5CZVH 3ARSA 5J1AA 3QDGD 1BVOA 2UXGA 1HEJC 1S8DA 4GQRA 1ZLUH 3C5ZC 4LAQH 2V9JA 1Q1JL 4JO1L 3BWAA 1Z5YD 4CSPA 1D5XA 5JPMC 4I0PB 4QO1A 3I9GL 5IBUG 1JN6A 1ZSDB 3T65B 3ARGC 1IL1A 3OKMA 4Y1AB 2PTVA 2EIZA 4Y4KB 1HH9A 1V7ML 5I1HL 4L05A 4JM2D 2LT9A 2IGFH 4YDIL 4XHQA 4Y19E 4M7KL 15C8H 1ETJA 2WINB 4X42A 1AQHA 1TCRB 4U1IA 2A73A 2E9IA 5T3ZE 1L9TA 5B3JE 2OJEA 3PG2A 3VB9A 3AREB 4ZAKD 1F8TL 5D4QA 1T0MA 4LVNB 1TITA 5B1JA 3S6CA 4KO6A 3PWNA 2ITCA 3RIFF 3QJVB 4KKCC 3QIBA 3V0JA 3KPMB 5IHWA 1EZVX 1DYZA 3PWJA 4G11A 1ND0A 3PFQA 4P49A 5E8NB 5JA9A 3HMWH 3RFZA 3VXOB 5KBLA 2MPVA 1KJ3H 2BNQA 1INDL 1DBMH 3TO2B 1SBSL 1SN0A 2H1LM 5F6HI 1YPZB 5EUKB 3RL1B 3T4AB 5JHDB 1W8EA 3SYCA 1TZ8A 2OXGB 1CE6A 2X6UA 1IMHC 4WF7A 5IHLB 1R5VA 1EDYA 2EEDA 4FYSA 4A39A 2NTFB 4HJUA 1DBML 4Y2DC 5D1XE 3B7YA 1T20B 2FGWL 5C0RH 5IQ9B 1ZPLA 2OJZH 3SPVA 1TMQA 3ZKMD 4NQUA 3RDTB 4OCSH 3C04A 4FQ2L 4N2OA 1U8JB 4PGJA 4YXHH 3CX5K 5D93B 4AITA 1S7XB 5C08E 2HRPH 1IARB 2MQ3A 4BZ2A 1BFOB 1IGYA 4HJ0C 1IQWL 2DQDL 2HUHA 1X9UA 2G2NA 5CEZH 4GH7B 2HFEB 1URZA 4HUVA 1TF4A 4JN1L 3AUVA 2XXFA 3IDYB 3ZTCC 2EECA 3NACH 3TA3C 5CIPB 3WFEL 3VU1A 4FEMA 4JFZL 5AG9A 4HU2A 1N3NA 4IBVA 4LXFA 3CLEH 2WUCL 1GGYA 3VWJC 4ANWA 4LPYA 2UZPA 5AVXB 2QGBA 1GPOH 4LL4A 4XWOC 3JWNH 4FXGC 1S9VB 3DXAA 4NKMA 2DEXX 4HJ0D 2DIJA 1JZDC 2VXSH 1KTDB 4JKWA 3TH3T 3W0WA 1I7UA 3JWOC 4YHLH 1PS3A 2WVVB 2PXYD 1Q94A 4QD2E 3TEUA 4ZZKA 1ZV9A 1UC6A 5K9QG 3FYEB 4NQDB 1T2JA 1XB3A 1LJMA 1RZKC 5DJZA 3RWJA 5IMKB 1YQVL 2XWBA 4WO0A 4BGDA 4OLVH 1RPUA 3WCYA 1NEPA 4XMVA 4JNXA 4NI6A 3KPQB 1EO8H 1TQTA 2G3NA 3QR1A 5EZIH 2VDKH 1XBRA 3EGXB 5KUMA 4PY7B 3D51A 1RU9H 4X8JA 3OQ3B 3VXUB 3EXLA 1I1YA 1JZEA 1WQVT 4F7PA 3GLAA 3L5JA 4B96A 1NCDH 1P69B 3E0GA 3TO4D 4HWZB 4PJHE 1HIMH 3VW3H 2X4NB 4JRXD 4UAHA 2KYIA 5GSRB 5BS0A 3MX0B 5HVFB 1BF8A 4B9KC 3F7RA 1ZOXA 4OQ1A 5IG7A 4CKQA 1ZHBB 5FC9A 5C0GB 2AP2A 1UT2A 1J8RA 1R47A 3NIGB 4HQQL 5KG9A 1L9QA 3QRFM 1L7IH 3LKSA 3QJUB 1KF9B 4M1GH 4RFOH 4OLEA 3TFKC 4HH8A 3LS5H 2NCMA 3G6JA 3SGDI 2AW2A 2AQPA 3EDKA 3ZQWA 4Z7NE 2ZKYA 3D4CA 2ITFA 1EZVY 5CWSB 4P4RA 4YBLB 2H2SD 4NQDE 1ZTXL 3RWIB 1VACB 3MZTA 1ZS8B 2VIRB 1RK0A 5GRWA 4ZMNA 2HFFA 1BOYA 5T1MA 4OSUL 4ZYKB 2CO6A 3U7WL 5GGQL 2OAAA 2G60L 43C9B 3X1EA 1QQDB 4MAYB 4JCWA 5D72H 4EIBA 1MFBL 3VMNA 1Z5LA 4R26L 3RIKA 3Q6FA 2CIIB 4A04A 5HY9B 4OM0L 3MLWL 1TLMA 1H0DB 4FQIL 4A63A 4JRYA 1IKFL 4BA8A 3VTMA 3QCTL 4BWTA 3IFNL 3Q8FA 4RBPH 3W1ZA 3F12B 3AREC 2ZX5A 4JGJA 4OCWL 2IPTH 1ZT7B 1H3WM 2UY6B 4JFPB 4RGMC 3SDAC 3TBBA 3RVTC 2AJSH 4HG4K 1MREH 2IAMB 3T6XA 2B2XL 1E8ZA 5FUOH 4WI0B 4ZMXA 3QNXA 4NKIH 4HDIB 1ZWIA 4GUCA 5JOPE 4R5VA 4L2YA 4UILH 4HS3B 5C97A 3MRKA 3N41F 4Y4HA 1NBYA 4KZCA 1HNYA 5JXAL 3T0DA 5D1XD 2VABA 2J73A 4I9WD 3LV3B 2AAAA 2VITB 3LZPA 3RQ3A 4AEFA 1QVOB 1U8LB 1HI6B 2WXOA 1NH6A 2H0FA 4TSBL 4TNGA 2XXMB 1CC3A 3PS6A 4FFYH 4XVJH 3VGDA 1CDGA 4O02A 4Y0GA 1P1ZB 2IPUG 3GTNA 4U3SA 1AE6L 4CU6A 1YPZE 3V9CA 1B4RA 1CL7L 1G7IB 3L3IB 1I9IH 4B9IA 4F8PA 1JV5B 4DSYA 2YD5A 1R46A 2QGEA 1ZLWH 2X4PA 4KZ0A 3DX6A 5FO8A 3L7FA 2E6PA 4BD4A 4RWYH 3IBEA 3K72A 3CN0A 4HEPA 4RA0C 2R0ZH 3SY6A 4ANVA 2ETWA 1N8ZB 2R9HD 4I0PD 1RUPH 5E6IA 1NINA 3UTSB 3GHEL 4M5YL 4M9OA 1LK3L 4LPTA 4O2CA 4HFWA 5L4IA 1YQMA 1W6LA 1CR9L 2EEAA 2PCPA 5F7AA 4O00A 3T6QC 5D70L 2NW2B 5BRPA 3VXPA 3PP3H 2WO4A 1W80A 4AYMC 5L2KA 4DKEL 3COOA 2MOQA 3FSWA 5AW4B 3DX7B 1KDIA 1BZQK 1Z9MA 2EXYD 4UTCA 1AR1D 3UYPB 4Z77B 3US0A 3X12B 5FDWB 2XZCL 4F7TB 4AKPA 4KQ0A 2EH7L 2HVJB 4G9FA 5TDNB 4JB9H 1KIUB 1RMFL 2QADB 2Y7OA 1KN2L 3WTVA 1I1RA 1P4IH 3QIWB 4AENA 5CP3H 5IJKC 3CFMA 1N6QH 1Q9KA 1GC1C 5TE4L 2BIMA 4F2EA 5DWUL 2NY2D 3OG6B 5IIEB 4R4BA 4JL1A 3KLKA 4AEEA 4UTAL 3ILEA 3RNKB 1IM3D 1DBAL 1WZ1H 2EVFA 5I1KL 3U79A 3CVHA 5MEPB 4D3CL 1IJNA 5ID0B 1A4AA 4NO2B 4S10A 1BD2E 4XPAL 1A7RH 1GZHC 2YMTA 2R2EB 3L1OH 4PJBF 4AIZA 4RCAA 2XNAB 1YJDL 3BGAA 1EJFA 4WV1B 5I5RA 4I5BA 3T8VA 1A65A 3LKNA 2G75A 1PZUB 2X4QA 5EEUA 4M4RA 4NM8H 2QHRH 3VFWA 4K15A 2EYSA 4PHZA 4QRQB 3RPIB 3ASNB 4AVHA 4HK0B 1VEMA 4M6ML 4XAWH 1Y6MR 5IK3A 1JFHA 3S8GB 1MHCA 1XFPA 4XT1C 5E03A 4OLYL 4HWZA 3NESA 4L4JA 1Y6KR 1UH3A 3KWWB 1CFVL 2VTFA 4GRWF 3OH6A 5I8CB 4P2YA 1TPXB 1BQHB 3W0WD 3FJTA 3ZKNC 4I3SL 2YD7A 2Y1YA 3MODL 3SQOH 2WN2A 4DVRL 4OFIA 4QR7A 1MI5B 4YFDB 4CC4C 1G9HA 3RX8A 5DJZB 4XB3A 2AQ3A 2CDGB 3GXTA 1QMUA 1NDGB 4WSKA 1TT6A 2YPLB 1TQBC 1PAMA 3KXFA 3MNWA 3ARFC 2O4EA 1E6OL 4FHKA 4R6UA 4UQCA 1ZANL 2DTML 1GSKA 3DURA 4TUJA 5FUCE 4Z18A 2YGPA 2BZDA 4Z95H 5IEHA 2HTKD 2NWVA 3B2UC 3MLYH 4DO5A 3SGKA 4DZBA 2DYPD 3BAXA 3VWKD 1HE7A 2V2TA 3KLAA 5IFAL 5DRXA 4XX5A 4JY4B 5MENA 5D4HA 5E1HB 1VKXB 5CJQL 5DFVC 2R39A 1F4YH 1SDDB 2FGZA 3M8OH 5E6ZA 2FDBP 1PDKB 5INCB 1OAUH 1R3IH 4Q2ZB 3BUYB 4AE1A 5IROA 5E5RB 4XMKL 5ADPH 1JCVA 2NY6B 3BJLA 4F9PA 4ZJ9A 4MJ5B 4ZPVB 1G9NC 2VT0A 4FXKC 2HTKC 4G9FD 1G1KA 3GSNB 4P2AA 5IB5A 3D39E 1OEZW 4JGMA 2O6EA 1DQQA 3EOTL 5I73C 1GKEA 5F3HA 3DUSA 3VGBA 4X99A 4BZYA 4DESA 3VGAC 5IFJB 3GSNA 4AK2A 5D1XA 4G7RB 4KK5C 3WSQH 1MFVA 1F4YL 2CO4A 5D5ME 4X9BA 3ETBJ 4Z7QE 4PI0A 4CMMA 3MR9B 2H0EA 5E5MB 3IGAB 5A6IA 4NC2B 3QORC 5TH2A 2Y2TA 2MQ0A 3OZKA 4OF5A 5H94A 2BS9A 4RODB 4HX1A 3QDJA 3VSUA 1R5VB 2PYEE 5T1DL 1QNEA 1KLGB 1KJMA 1YEFH 4E5XG 5JIKA 2R2EA 1OZTG 3MXVL 1YPZA 4UB0H 2WD0A 1ZTMA 4X9HA 1NMBL 5D96C 5EUKA 3O8XA 4LVOC 5HYJE 2Q7AA 5I8KL 5L7XL 3P3RA 4ODBD 3ZGHA 3FZUD 2P5ED 3DMMA 3LDBC 4UNVA 4N2CA 5F7LB 1VENA 2IPKB 3QUXA 1R3JA 3S8WA 4JM2A 2IF7A 4GMTL 1TFPA 4GS7B 4MNQB 2WNWA 2WC7A 3VFOA 2PPAA 3PGFH 3U46B 5EEZA 3LSOB 4H4NA 4IRJA 1N2RB 2UWEE 4HQQH 2K6YA 3WFHB 1KPRB 4LSVH 4X6DF 3QQ3B 3W3BA 4QRSB 1CYXA 4DUXA 5BRZD 1WYJA 1RZIA 3X12A 3PF2A 4PWHA 2AEPH 1WA0X 4WDIB 1U8QB 3IXAB 1BQ5A 2X4RA 4KRLB 1CVSC 1FFOB 1HXYA 4NIYE 3S4SB 5J11B 3R1GL 5ALCL 5EZLB 4BCXA 4HXAH 4U1GC 4PHXA 3CHRA 1U92B 3L81A 4BZ1A 5B38G 1BA9A 3NJIA 4I1NB 3V6ZA 1D5XB 1BM3H 2EXSA 1NMCC 4R90H 1U2YA 1IC7H 5AWNL 3BFWA 4HK3N 3DBXA 3MV8D 1YCSA 2V92A 1D6VL 2Z31C 5F0MB 1YRKA 4FFVD 2AJUL 5F3BB 1CTOA 2I07B 3VYNA 3U25A 4GG6E 3QZWG 5HTSA 3L5HA 3RIAF 2XXCB 1HILA 5DK2B 1QBAA 2HKHL 1KLFA 1CGTA 3IGUA 4FC3E 1D7DA 1XZ0A 4XPTL 2CR6A 1MCOH 1P84K 3FFCA 1TZOA 1N0LB 3N2JA 5F9OH 5DMYA 2WB7A 4KZDL 4OCXH 4KJPC 4IBWA 4ZFFB 2DM7A 1U8LA 1DZ0A 4URKA 2R0KL 5IVXB 4JPQA 2QGDA 3QXTA 2WLMA 4ORGB 5HI5D 3AY4C 3CFBB 4Y5XB 4H0IA 1M3QA 4R84A 3HHRB 2A9ML 2IFFH 4J3OF 5FYJL 3WO3B 3T9WA 4J3OC 1B6UA 4GFXA 7PCYA 4N2AA 1T7XA 2YA0A 2XKNB 3ECWA 4Y2DD 2NNXA 1LP9A 3IPFA 2NXYC 4OZHF 4PJFA 1NPJA 3FAXA 4K23H 3CDGA 2G5RA 2Q8BL 1GGTA 3AUWB 3DX0A 3QPQC 4BFJA 2VDNL 1PX3A 1K2DB 2AF2A 5E4EC 1I8IA 3STLA 3VXRE 2OMBA 2OPCA 5C8JB 3FCBA 3QQ9C 2PCPB 1ZVSA 5DJ6B 3GEWB 4OB5L 4IS6A 3PREA 1J86A 1JE6A 1UJTA 1G0DA 2VXQH 4KXZH 1BZ8A 4M5YH 2UZIH 2VZOA 3VWJA 4P2RE 1OQOA 2DKSA 3RJQB 1K2DA 4L1HA 4X5PA 4JHWH 2J6EH 4KKCD 3DX6B 3IGFA 3UJIL 4OQTH 3MV7A 2GG1A 1I7TB 3KD4A 4AMWA 2R1XB 4MQ7B 3QUYC 3PCYA 4XPBL 1OD9A 4GSDL 4J6RH 3N43B 4YK4B 4JPIA 1KXVA 1UYWL 4GAGL 3NZHH 4PJGB 8FABB 1KTRL 2DQUL 1FP5A 5F89A 2PO6C 1F3DH 5DHYB 2CUHA 3SE8H 4ZMLA 4TSAL 2XN9E 3KLDA 4TVPE 5IJCC 1F3JB 4AYEC 2A74B 1T4KA 3MRJB 1KXHA 1O6VA 1FUNA 2IWFA 2W65B 4NZTH 4XVOA 1FO0B 2CE6A 1GZHA 4LSTL 4QI3A 4YNYA 3BVDB 4F33B 5T3XH 5C0BE 3VXSB 1B0RA 3PNWB 4FQJL 2IPKA 2DI8A 4JEGB 3NH7L 4KY1H 2EKSA 4EIUA 2E0PA 3AB0B 1HINH 4LIQL 4PYHA 4AKQA 2WLKA 3QCTH 4AGMA 2B2XH 1F97A 3TE5A 3FKUS 4LAQL 5ADOH 2R69L 3ABKB 4PY7A 3PRZA 3BUBA 3HS9A 1B3JA 4HS8L 5FO2A 1G7PA 3Q6GL 5D72L 2EDTA 1XQ4A 4OF0A 5F7FA 1RM1A 3O6FB 1DJHA 4F33A 5KUKA 3DV6A 2CIIA 2XFGB 2Z7ZA 3S9DB 4OKDA 1RIHL 3H55A 5EBGA 3IAPA 2R5XA 1TVHA 1KC5H 4H88H 3NDZE 3VYOA 3IDIA 5FKAA 2DEWX 5TQ0L 5KTEH 2XIBA 3BZFA 2IV9A 2MMXA 1ZHNA 4MDIB 3MLXH 3E8UL 5D2NE 3WFBH 1FSKC 5I23A 2BJML 4KPHH 4JFDA 2BXZA 4XNUL 1SM3H 1X7TA 4JG1L 4WWID 1FBIL 2HB0A 1DJXA 1I9JH 4ETQB 3RKDC 3V10A 3V5DB 2N1KA 2ED9A 2H2SC 2JKIS 1A6WL 1BX2A 5D7KE 4DT2A 4BJUA 4P2QA 4JZNA 1LE9A 4JO3H 4HV8A 5LAPA 1KPRA 3CSGA 1AKJB 2PCFA 4Z78A 2EIBA 1DQMH 3QVAA 1L0PA 1YECH 2Z8SA 4ZQKB 3H2PA 2V33A 5C0GA 5I24A 3ULVD 5DK0B 1FNGB 4EI0A 1Q9LB 4L8BA 4M03A 3S5LG 3MNZA 4NQED 3QZWB 5AOKA 5EZOH 3AGWA 3WNLA 4W1TA 3FS9A 5FYLE 5KSVA 5FYJH 3RVXC 4U49A 1A3RL 3WDHA 3AJ7A 2ZG1A 4WO4C 5DVMA 4NQXA 4LSUL 2UV3A 3BVTA 4YFLI 2WLLB 3ZT6A 5I1DB 2YA3A 4EBQH 5E00A 3MLXL 2TSBA 4P46D 5CGYD 1FV1A 3FQYA 4XMLL 5DZJA 2DQEH 2ZWNA 4LBAA 1ZD6A 4YHLL 3U6XA 5E00B 4EDXA 1OGAA 3EJUA 5IB1B 2G4GA 1A1MA 3HZMB 4GW1B 4WGKA 4FLRA 3EJQA 2OS7A 1DDHA 2WXKA 4OJFL 9PCYA 1YQVH 4KH9A 2CHWA 4WEBL 4IRSC 5ANME 1T0OA 5TPWL 1Q9UA 4M9PA 2WCGA 4ZZFA 4LLDB 5DLML 5GZNA 4G6KH 3EH2A 4K71C 2RIKA 1KTLA 3ZDYB 5CLYA 1KYFA 5IFHH 4UT7H 1S9VA 1LWVA 2B59A 2W07B 2ITCB 2X6AA 2MNJB 1QRND 3SJVD 3WAKA 4ZD3H 4G1MB 4JGUA 1IC7L 3N43F 4JKMA 4WWOA 2GFBA 1WIPA 4HU8A 3VI3A 1TMCB 4OCYL 5IWLC 2HZHA 5GGVY 1JAEA 2OCCB 2WINA 4WV1A 4E9VA 4LSTH 2DAVA 2YD6A 3C2AL 1DBBL 1M3IA 4JN1H 4YDMA 5LWYH 1FH5H 1SYVA 2J5WA 2OL3B 4GKNB 1V54B 5CEYB 1GL4B 5E4OA 1OV8A 2JTYA 4TSAH 1WGOA 4NUGH 2FT7A 5KBNC 2Q8AL 3KJ4C 4HMDA 2H8PB 2YPLA 4U3XA 1BQLL 5IM7B 3VD1A 2OLDA 3CFCH 1A1NA 5A2AA 2WLIB 3ZMNA 1B2WL 2DLHA 1N6VA 2ORBL 2W0FA 3QI9B 3V0AC 3EYFA 3MGTA 3KR3L 2FGTA 2QQLL 1JZFA 1AP2B 1KY7A 4NIKB 3MOAL 2QSCL 4X8GA 3MKGA 4EVNB 4Q6IA 4OV6F 1DE4B 1U8NA 2X2HA 1YNLH 4E5XA 1GGIH 1GC1L 1SVBA 3BQUB 3LY6A 1FI8C 3RL1A 5SWSD 1O9VA 2FATH 4KK6C 2HG5A 5FLVA 2G3MA 4ORGA 2OZ4A 4I3RL 2EKSB 4H8QA 4S0SD 3FOLB 3BH9B 1JUFA 3DPTA 5HJDA 1T4WA 1PCJX 1W0YT 4GXUM 4JO5A 4IIQC 3KG5A 3KPMA 3UTTE 4WWNA 1BBDL 2A5UA 4L4TD 2JELL 4XP1H 5CJ8A 3O8XB 4J8RA 2DQJH 4KROD 2A74A 4Q8BA 4X4ZA 3RHWK 3KBFA 5HDBE 4PG2A 3FC8A 2X6CA 3B8SA 3BUPA 1O7VA 2AJXH 1YN6A 2DQFB 5FO8B 4G8GB 2AJZA 5GJTL 3UYRL 5I0YA 2VW6A 2JLPA 1EHKB 1YO4A 3JBG7 3LD8C 4KQ3H 5AW1B 3MR9A 1OAXL 3GWJA 1JYXA 1E6JL 4N2MA 1ZHLB 1C08B 2ICWB 2VXVH 2YAQA 5E9AA 4D2NA 4E9QA 3TNNA 3QE5A 3RVVD 4GRWH 5KBPA 1OP4A 3SDDC 1KB3A 4O5LL 4RMWA 4XCEB 4WHYH 2HKHH 1OT2A 3S4SA 3SGEI 3D87B 3MRKB 1MLBB 1SNRA 4HSAC 5TDNA 1EEYA 1QN5A 4BQBA 4N25A 2AXFB 3CDGB 1AZNA 4IRZH 5FDWA 1RSFA 1S2EA 4X0KA 4YHZL 3QQ3A 4XB7A 5F71A 4R96A 3DX7A 2Y1ZA 3PIQA 3QQXA 3BCFA 4I2XA 3KS0J 4GAJH 3IFPB 5AWNH 3IJEA 4A7GF 1UHVA 2FD6H 2YR3A 3QUYA 4LU5H 4Y89A 3D30A 1E9QB 3IDJA 1FFTB 3ARBC 3L3DB 4NZDA 3QDHA 1OM9A 4LCVA 5DSCA 4BV1A 5E4EB 3PL6B 2DWSA 3TFKD 4I3GA 1QLRA 2VISB 1CZ8L 4WI9A 5LCVL 3LZFH 1TPXC 3TT3L 5EG6C 1C8PA 1T3FA 2NUPB 3VFTB 5D7SL 1UXLA 1UM4L 1LO2L 5HYSA 1AHWC 4HBCL 3P73A 1WWWX 2BNRE 3ROOA 3V4VH 4F15C 1LO3H 5GGTL 5AYUL 1VPOL 3PGFL 1DQKA 4H8VA 3R4DA 3WE6B 1XZWA 4KJYA 1FVDB 3AADB 3JWNC 5KVGH 4UCFA 3UAJD 3HG0A 2Z92A 3GUTB 1FPTL 2WLHA 1BXAA 4M6OH 3ZL4H 4WFGE 5F3BA 5F6IB 1K3ZA 2WQVA 3MUGA 4DPAX 2K4WA 1ITBB 3E9UA 3D4YA 2XX0A 5C0CA 2C4XA 5KAQF 5IK3B 1QSFB 2X2YA 3A6CH 3H56A 1MCSA 3VNYA 3PL6D 4AM0B 2NY1D 5GIRA 4MASA 1IZJA 1F0LA 4UT9H 1ZCRA 5C08A 1AHWB 1XGZA 4NLAA 1ZHBA 5DJAB 4MJJA 4Q0XL 5K69A 4N9GA 1DFBH 3QXVA 1ZWIB 3TLRA 3HC3L 3OKYA 2VUKA 3MX0A 3N1QC 3P9MB 3UTPD 4Z1PA 4JZNB 1F6LL 1K35A 3PUUA 2HTLC 1PD1A 5ETUA 4FJZA 2CIKB 2GJ6B 1JHLL 3Q1EA 4PJ5B 2X4OB 4MJIE 1C5CH 2HSIA 4GQ9L 1WE5A 2NXZD 1LQBC 4HGWB 4NO2A 4YGAB 2F1AA 5HJ3A 4P9MH 1NL0L 2BIPA 2A4CA 1TKWB 3EJRA 5JOPD 5DFWH 5AFAA 3I3WA 3BVVA 4GG6F 2VDOL 4I9WE 2WYHA 2H2PD 3HG2A 4JGNA 4ODVH 5FCUH 2K70A 3VD9A 3PHOB 1TZHA 5HHOD 3MV8B 2BNUB 3ZE0F 5D2NB 1BIHA 1JXKA 2YQ2A 2BSRB 2V9RA 3QQ4A 2P80A 4HGWA 1I8UA 2KPNA 4N1CA 4P23D 2OYLA 3GXIA 2X4OA 2I69A 3TEXA 1MWAL 2DM3A 1RUPL 1B0WA 1Z3GH 3BP5A 3I9IA 4DQOL 3WY3A 2PYED 1F1DA 2XHNA 2ZP0T 2GJJA 4ZW8A 1L4IA 2Y4SA 4DIXA 2Z64C 2J8UE 4OCLC 1YQRA 3CFEB 3EFOA 4JZOA 3ULUE 5CCKL 3P3TA 4LMQI 1I9IL 4DN4H 3MRJA 3CXFA 3MODH 1YEDB 2MH4A 3AZUA 1BM7A 3FYIB 4I3SH 3V0VA 3ZYIA 5B1BB 4N0CD 1H8OA 1G1YA 4UU9A 2BY1A 1ETZB 5JLZB 1GZPA 2ENQA 1VFBA 2Y6SC 3KEDA 4DF9A 2B77A 5ACMA 4ZTPH 3QHTC 5FUZH 1FVEB 2CKBA 3II3A 3L5XL 2BSSA 1PVHA 2FQFA 4M3JA 3ZUNC 4UAOB 3HPLA 3EDFA 2V2XB 5JPNB 4L8CB 4ATWA 3WDJA 3KW8A 2OMWA 5IHZA 1QA9B 1RZGB 1Y1DA 3CJJA 3LH2H 3OL2A 3T1WA 2XWBB 5D7HA 2X4UA 3WHXB 2DIAA 2X41A 1Q9KB 1QVOA 4NUMA 2I9TB 1I4FA 3GJFB 1BHGA 3LPPA 2HT3D 3L08A 5EF3A 5E94B 3QI9C 2O5ZL 3VXOA 3VFPB 3RFZB 4MA7H 1P7QB 2PTTA 3GB7A 4DKDC 3VFVA 1C5DA 4ZUUA 4NQEE 2NDFA 1KNOA 5CP7A 2F5BH 3L5IA 5FYLD 5BOJA 3DV4A 2YSTA 3GBDA 5L2KB 1DBAH 2W88A 4NBYB 4UDUB 1BV8A 3AU1B 3LIZH 4UTAH 2CLVB 2IH3A 1UT9A 4H8HA 5F7DA 4S1SH 2PABA 1C7SA 2BX5A 3ILDA 5I18H 2WLYA 5HPOA 4R8WH 3KWWA 2E6QA 3FU7B 4IOSA 2H0PA 4JRYB 4LSRH 3P30L 4MNQD 3HE7D 1F4WH 1YA5A 2WLZA 3FTSA 2AEQL 3F58L 5CJ5A 3GUTA 3L7EB 3AQZA 3ZE1B 4F27A 4M6OL 1XF3B 3C2SA 3M17A 4PV8B 4HK0A 1Q9OB 5EMYA 5C0NC 3B7RL 3WMQA 1HDMB 2KL6A 4KJPD 1F18A 1N9PA 3FFCB 1J48A 4W68A 1EK3A 3F6IA 3C12A 1KIPB 4JCMA 4XC3L 2C3WA 4QCIA 3V6OA 5D2LA 2J8UA 1HILB 3LKNB 2E7LA 2X2JA 5FYJU 2Q7YB 3G6JB 4AMXA 2CMRH 5T33H 1XXDC 2WVUA 4UZSA 3K8MA 4GW4A 1IFGA 1NEUA 4KHTH 2QSTA 4HJGA 1NC2B 2GSIB 4RGOH 1ECYA 1MWAA 1VADA 3U0PB 1H3GA 1Z0NA 5DURB 4HJEA 2MWCA 3WFCL 3GSVB 5IOPA 2BS8A 4F37K 2ZAHA 3K4ZA 3HI5H 3KWVA 1IEBB 4FLSA 5B7EA 1OF0A 3UAEA 3QPQD 5AW6B 4AUJA 5BPPA 1AOZA 4AENB 1FJ1B 1CFMA 5HSFA 3V0WL 2PETA 3UGUA 4FE9A 5E2TH 3BQUA 4P05A 4JAMB 4B9ZA 4AVKA 2IH1B 3P0GB 4MAUH 1UFUA 1KPVA 3NYKA 4GOSA 4LLYB 4AQ1C 3KR3H 5IUCA 4GBXA 3ALXA 4HPHA 3GRWH 1A1OB 3K6IA 1JGIA 4GRLB 1KIRB 2H47C 1CU4L 2W0FB 3A67L 4LSDA 4OIAA 3TA4D 4G9FE 3NUKA 3OXSB 3KPSB 4BQCA 4M43L 2EDHA 3ES6B 4Z7UA 2VMEA 1B4LA 3C6SB 1CBVL 43C9A 4FNUA 3PJSB 5I8EB 2EIMB 5F1OB 3NACL 5T5NF 1P7HL 3O2WL 1MREL 1G9NL 1T2QH 2UWEB 1KXVC 3BJ91 1EJ6A 3QFJB 1F6FB 2RBLA 3GEFA 3PWPE 2E7CA 2XTLA 3HBPA 4X98A 5I1CL 4IDJL 1OP9A 3CN3A 1NLDH 4HX1B 4PSRA 4AVJA 2ZAIA 1OGAD 2WUBH 3RWCB 4MLIA 1V3MA 4KUCD 3VG9C 3OZLA 4IK7A 2QMKA 2YC1A 3BP6B 5HI3C 2QREA 3AXHA 4BH7B 2DI9A 1MCJA 1J1XH 1KGJA 2AMGA 4JO8A 2LLLA 4Q6YA 1EMTH 2DQCH 2YWYA 2FECL 2NY4D 1PLAA 2X09A 1DL7H 1EEUA 4GQPH 4WTQA 1MHPL 4M5TA 1COBA 5GZOC 5F72S 5FEBA 3CSBA 1BXVA 1GY2A 3P0VH 3FB6A 4ZPVA 3P0YH 4Z7QB 3ABGA 1WA1X 1T1ZB 4YDJA 1SBSH 1NCGA 3EGDA 1ADQH 2A77H 3ASOB 3B2MA 2KERA 3SPVB 3A47A 2BH0A 3EYFB 2J8UB 4XNBA 5AG8A 5FWQA 5HDRA 4PAZA 1YNTF 3DUUB 2L8AA 5TF1H 5CAYB 5ITBL 1TTCA 3X11A 2J55A 1FYTD 4JY4A 1ACZA 1N26A 4EO5A 4A55A 3HC4H 3ZDXB 4AYFB 4PGCA 4U1JA 3WL9A 1D9KB 1F6AB 4LVHC 4NNXA 2Q8AH 1KACB 4H0GA 1VESA 2D7OA 3L4UA 1EERB 3LOWA 4JL2A 3WIHH 2KQNA 3FU7A 5LWYL 4U7MA 3ULVE 2GTQA 5IT2H 3MV8E 2VR3A 5F7DB 5HYJA 4Y4HC 2GVYA 4OF7A 5MEND 1EJOH 2RD0A 3X1NA 1WAPA 1E3FA 1EDHA 4OZIE 4WI4A 1FZOB 4LB8A 2XVBA 3ATBA 5TQ2L 1DVXA 5IVZA 2VM3A 3RURA 3LX9A 5CWSA 5AQ0A 3IMWA 3S37H 3H3BC 1J8HD 4P99A 3VFRB 3CBRA 1FN7A 3FAWA 1JV2A 2F18A 4XCYB 4X9FA 5D7IE 4J8QA 1CXEA 1CFNA 2CO1A 2LGNA 5DS8B 2F53B 3LKSB 4GW1A 5DYOB 3D39A 2NY5C 4OJYA 1M7IA 2OYPA 5I15L 2OYMA 2W80C 3KHQA 2MCPH 3BDBA 3Q01A 4L8CA 3MLZH 5LG1A 4E9YA 1TXKA 3IN0A 1G84A 3KEHA 1JPTH 4ZMYA 3A3YB 5I5MA 3PMGA 4DWHA 3BPOC 1YYML 3LXCA 5JHLL 3QNFA 4TF4A 3EGXA 1CN4A 4MQXC 4XXDA 3ATFA 2FH6A 3H9HA 2CPCA 3QZWA 1E3ZA 4PJAF 3N0PB 4P23A 3QUXC 3FQNA 3JTSA 4GSQA 4NM4L 1MJ7L 1UGKA 2A6DB 4RGNB 4LPCA 2GTWA 4LEOB 2D3LA 3TN0B 4RFEA 5AL8A 2F7PA 3BSZH 1HHKA 1XDTT 2XV2A 1UA7A 1YECL 1DQVA 4HV8B 5CSBA 3RTQC 2BIIA 2Y1VA 3MJ7B 4OFKA 1OE2A 3RX7A 3RZCB 5CNHA 2GY7B 3H53A 1D5RA 1CLZH 5DURD 5T5FA 4NBXB 1CG9B 1QUPA 1FG9C 1OHQA 2OMYB 4MQ7A 1NANH 4XNAA 4JHWL 4EN3D 5D2NA 2W9EL 1LE5B 3HRZB 2YBRB 2JIXD 2FR4B 4ZFOL 2ZOKB 4NNYB 3VU2A 4P9HL 3FO2B 1OIOA 1M6OA 4OTXH 3U1SL 2VLKA 2WNKA 3P0VL 3H9SD 3ZYJA 4MCZB 3RVVC 3NZ8A 4NWTH 4WY7L 3WY2A 5DGQA 5CU9A 4GRLA 3ZIYA 1IGJB 3ISRA 1YAIA 3L2MA 5I1IL 1QLFA 4UQ3A 2IH1A 3ZDYF 5D7JA 2DY2A 3IFLH 1CYWA 3S35X 5D7JD 2QELA 4NRZA 2PPFA 3SB3A 1D6EA 4M7KH 1WZAA 1U8JA 2ZSVB 1KB5A 2IOOA 1G7QB 4ADIA 2VLLA 3LRSB 2WWOA 5EDXA 3VB8A 3ARYA 4LFHG 3WNIA 3MV9D 4PJDF 2JK5B 1F3RB 2IIJA 3L95B 1NCOA 1B0RB 3EGDB 3EH3B 3PNWA 2D73A 3IRPX 3BKML 3NIDE 3S96A 3NBNA 5IOPB 1QWHA 3O2VL 4LDCA 3IFOA 4WK0B 5T3XL 1O9ZA 1ZDSA 1C16A 2QFRA 2VERN 3FTVA 1FO0A 4G8GE 2VL4A 4XWGL 1LILA 1BFVL 2WXJA 1YYLL 5JHDA 3C5ZA 4Y5YC 6TAAA 4EI6B 1N4XH 5DD3L 1E67A 2CM6A 2Y69B 3PXHA 3U4EA 3VRIB 1QWUA 2A3TA 5CZRA 5DHYA 4G7VH 1BD2B 5EBLA 3VFSB 4XOAA 4DCQB 3P69A 5CBEA 1S9KC 4OJEH 3A24A 4MB3A 3GBLA 1JDCA 4EAJA 3IDMA 2VLLB 3LRSA 2YFOA 5EC1A 1MCWM 4UT6A 2HFGH 4HCRA 4FQXD 3GSRB 3BLPX 4KDWA 4GBXC 2DQIL 2OJEB 1PD0A 3FRUA 2QMJA 4WZ9A 2DQTH 5J12B 1INQB 2QHLA 4JX0A 2IMNA 5E4IA 3RUGF 3GYRA 1SEBB 2PXYC 3RVXD 4L0PB 4ABWA 2JCCF 3ZDZF 2DTSA 2LVCA 5HHPA 5IGXL 3JV6A 2DQ6A 3T3PF 1JSYA 2BK8A 3TWCH 1RUKL 1MF2H 4FD0A 5B7MA 5BUAA 1LP9B 2CGYA 3K8LA 3OM3B 1AQDB 4PI2A 5GGUA 4ENZA 2OMVB 3F7VA 2P26A 4GBXB 4MA1C 3GIVB 4HJJH 2WZAA 5I75B 3U0WL 1CFTA 4LSSL 3TS8A 2GSGA 2LU5A 4AUUA 4XRCA 1IFRA 3GI9L 3WBDA 3BSGA 4EAIA 5L9DL 4ZUTA 1UD5A 2QQQA 2H1XA 4LQFL 3C5ZB 5T5FL 2QTVA 1OP3K 1QSFD 3LHPH 4RFEB 2WQUA 4WAFA 1H3PL 3IDXL 1I3RB 4P23B 3OAYK 4PGBB 5HHXH 1R3JB 1WAAF 3X13B 4KO9A 3M6DA 3NG5A 4XXDB 3DX9A 2WANA 3UH8A 3G6JF 3K4AA 3N1MC 4A7UA 4HKBA 1AS7A 3MNDA 2MKLC 4LHUD 4IHOA 4LSQH 3VH8G 5A16A 1QLFB 4UQ3B 4LHQB 4OGXL 4NQSB 4RZCA 4W81A 1A7PL 4R7DA 1KUMA 5EU6B 4EZMA 2CK2A 3WY4A 1YAZA 2PPDA 3VSVA 5DRNA 5BS0D 1WFJA 3MRBA 4Y2LA 4ZO6A 4UNUA 4AT6A 5TFSH 1MCCA 3IWVA 2XQBL 4ZODA 3NCXA 4H1LB 4K07A 5ID1B 3CU7A 3AGVA 1MJJA 1U21A 4G5ZL 1KIRA 4XNXH 3FT3B 1HU0A 4MYPA 3BIKB 1PF3A 2ID5A 1P53A 4X80H 1Z6JT 2P4AB 4AY0A 2C34A 3LRGA 4KTYA 5CN3A 1AS8A 1EBPA 2P3YA 4MMYB 2Y6SD 4NO0D 2W9LA 4ZPTA 2ADGB 4N87A 5T5NG 1BOGB 4M43H 4Q2ZA 4P59L 1PG7X 2X1PA 2J1WA 3MGTB 4NERA 3TPUB 3ZKXB 3N0AA 4AL8H 1M1XB 4IKIA 3SBPA 1IC5L 1JPFB 1ZA6B 1N8OE 3RVUD 2CR0A 1P6WA 4AW7A 4Y1AD 4Y4KD 2H7WA 2N01B 2HKPA 1IGIL 1NH2A 4I77H 2DWEB 5IEHB 1P4LA 1FE8H 4LFHD 1NC2A 2GSIA 4L29A 1K2YX 1S7XA 5EU3A 4RGNC 3MNWB 4MAZA 4F37F 3DGGB 2XPYA 5D1ZC 5I26A 4PIBA 1HZLA 1AMXA 4FLHA 5I66B 4MBRA 4PJ5A 4M1DL 4HZLA 1E4XL 1YEFL 2FJGB 3SDAA 3PGCB 4G8GD 4OZIF 4JFXA 4P5RA 2XIIA 3SKUD 4LP8A 5GS0H 1JD7A 5KBKA 2JKXA 4Z3JA 2PW2B 5FYJE 1QLEL 3IGAA 5EU5B 3VD7A 4W9CC 1BWWA 5DJAA 5JW5B 3MQIA 1N59A 4WUUE 3ULUL 1A3ZA 4J3BA 1EUUA 2X1QA 3HAEG 2R2HA 1CLOL 1IUZA 1YNKL 3I6SA 3KCWA 5F3HB 1DQQB 4D9LL 2ENSA 1JWSA 4PRHB 2O3OA 1KJ2A 3N44B 5FOBB 1DFXA 4XC3H 4FMFA 5HD8C 2VAAA 4FTVA 4GNKB 4Z76B 3O45B 3GRBA 3RPIA 1AQKH 4P2QD 3K81A 4XN8A 3BQUD 2EUWA 3TZVC 2XLLA 2ZXBA 4NJAH 4HUCA 4RISH 4K5LA 4POYA 2PW2A 4FTDA 4DKFL 1IAIL 2ZXEB 5JHMA 2XU9A 4PRIA 2OYKA 1LO4L 2IOMA 2FJUB 5DEJA 4YOKA 2Y5TB 2X89D 3DK2A 4HKBB 1X5IA 2ZOTA 5HGHA 3N04A 1E5ZA 1VRSA 4C56A 1CTNA 1MW0A 1A4BA 4K3DH 1JL8A 2F1BA 3NIFB 4KAQH 2DWEA 3HN8A 3PNRB 1E9QA 3C75A 3IDJB 3WHXA 1ED3B 5FFLA 1N68A 4HGKC 2Y36H 1NGXA 1U2CA 2VXUH 2HVBA 3IFPA 3DOSB 3W11D 3X11B 1CF8L 1AZZC 1QA9A 3RY6A 3KVPA 2AHIA 2AQRA 3WJLA 1LDPL 5DO2C 2K7PA 4LL9A 4LL1A 3IJYA 1JHTB 5MI0B 1KCWA 3A23A 2L7UA 2W59A 4L4VD 4KU1A 3BVUA 4MFHA 4E42A 4ETQA 3DTUB 3NEEA 3BZ4A 4OZFG 1FSKB 4M5ZL 4LQFH 4ELKA 5K59F 3ZTJH 4Y1SA 3NK4A 2V17H 3GSWB 4AZUA 2K3HA 1RCYA 1AI1H 2Q9OA 4PWKA 4ZO9A 3MBED 1DN0B 5H2BA 4LASH 1MAKA 2XVGA 4PTTB 1VADB 1P9MA 4C59B 3K6DA 2ZUSA 2VH5H 5C1MB 4JJOA 1ILUA 3DV6B 4Z7AA 3G9VA 1MCFA 4KH2A 1SOKA 5DRNB 2P45B 3LZFL 3I2CL 3TT3H 3IAQA 1SYSA 4EKXA 4EPSA 3DJ9A 2YEVB 3AACA 4NNPL 2DQIH 4NPKA 4Q11A 5I71C 4NYLB 3TA3A 3PQYB 4BUGA 5IVXE 2Y2WA 1H3VA 1RERA 1AO7B 5FYKH 1ZLUK 3TESA 5HDLA 3QIUB 2A83B 1T22A 3SE9L 3ZYZA 1H8SA 4JVWA 4RSVA 2WWKT 4IGBC 4XPAH 4YEEA 1TU2A 3DX9B 4XVUC 1U30A 4X4XA 1Q38A 3KPSA 1UA3A 3ARFD 3QDAA 4ZFZA 1LWJA 3APMA 5I1EH 1T3FB 3EKCA 4FNLH 1G7HA 3MA9H 5E2UH 2J4WL 5EIVA 1TBPA 3MBEA 4UV7L 5K9JL 2EACA 3Q5TA 4ENED 1TKWA 1AZCA 4DGVH 1W0WB 4NT6A 5HHOE 1DE4A 1U8NB 3HVDA 4OLWH 1P1VA 1OF2A 4Z0XB 3AS1A 4C83B 1RZKH 3QNYB 3QUML 3IH7A 2VDOH 4G80A 4XWGH 1M71A 4UIKL 3SGJC 3EJYC 1D6EB 1IEBA 1PFCA 4BM7A 4YFLF 4N9GB 4LPUA 3LN4B 4LNVA 2EUZA 1GJUA 3VWJB 4QNPE 2P5WD 3HEIB 4S11A 1BQKA 3INOA 5CLTA 5CEYA 4DP5X 2EDBA 2ADFL 5CO1A 3MCYA 1XIWC 1H0DA 5F9WC 43CAB 1TUOA 4N2NA 2Q7YA 5DC2A 4NNYA 1I9RH 1IAKA 3H9SB 2G60H 5M7QA 1VAHA 1U8HA 4H20L 5J1TC 3CWUA 2J71A 2ICWI 4KC3B 5FHBL 5LN8A 2YQBA 2BSSB 2E4FA 3PWLA 4YBQD 1CLZL 3RGHA 2FB4H 1UZ6F 4JPKH 1PPIA 4YHKH 2DQFA 2FEDD 2V5YA 4ODUA 1ZSHA 1M3JA 1GZPB 2HX9A 4MS8C 5F6IC 3HG3A 2NY0B 2QDWA 2WXPA 3CHOA 4NSKB 1BD2A 1FHNA 2HT3C 1TJGL 3LV3A 3CFEA 3BLKA 4JZOB 1ZLVK 3P02A 5BMNA 4MHHG 1MJ7H 1AXSB 1FRGH 5DJCA 1XD0A 2NLVA 3CDZA 2F2HA 4XOBA 3FOLA 1TEGA 5DO8A 3KL0A 4TPRH 5D55A 2H5UA 3HR6A 1CCZA 1ZV5A 3C6LC 1QPPA 2EYTA 4MA8L 4PLJD 2X53A 4L18A 2HMIC 4EI5C 2P42B 1EFQA 4TXVB 5EZJB 3SGEH 4AV0A 4NM4H 3VXNB 3UYOD 4X9IA 5J5EA 4J23A 1FYTA 2PW1B 2R83A 2D0CA 2JI1A 4OZGF 5I6NA 2WXHA 5DF0A 4XCEA 4GAJL 1LXMA 3MTXA 4ABQA 2I9TA 3H8NA 4PM1A 3QUXD 3ZTDC 4LKCA 4MNHB 2F53A 4XB8A 1AKJA 1NGYA 1UD2A 1C08A 2FH8A 2XWCA 4Y9GA 4LSQL 3UC0H 1F00I 3HAEH 4PP1D 4NUQA 2XN2A 1GPOL 4ZW7A 3WKML 1LWHA 2W95A 2Y5TA 3GXMA 4MVBD 3VRLF 4QOKB 5CSZA 1FGVH 1UM6L 4HUNB 3UMTA 3WFEH 1B6DA 3V0VB 4A2DA 4DP2X 1GJIA 5LBSA 3LJ3A 1UOKA 1WT5C 2J6WA 1V3KA 5JHBA 2UXVA 5HYJB 1PG7L 4RFOL 2VL5B 3CGTA 4X7DC 4FQHA 5HHNB 5TQ2H 3VD3A 3O45A 2OXHA 3X3FL 2JF1A 1GAFL 4WI5A 3RKPA 2X89A 4PGDB 5K33A 1EJOL 3II1A 5CHNB 3G04B 2Z92B 3CWTA 4B3EA 4PJHA 4L5FE 4X8CA 4E9XA 1AD0B 4HFUH 1E50A 2W94A 2JELH 1FVDA 4WGVB 1HAWA 1S7SA 2P46B 3QK0A 3FO0H 4YDVB 5AW0B 5LGYA 5IBLD 3UABA 2WO3B 3TWCL 3SKMA 2VDKL 1XAKA 3TIDB 2WLLA 5I1DA 1U95A 3MRPA 2VR6A 4UYQA 1CDCA 3ISYA 4YK4C 1NUNB 3UTZB 2XRAL 4N8PA 4ZOCA 3WKQA 3EZJB 4PRIE 5DYOA 4OM1L 1GGIL 3GMRB 1WFNA 2H32B 2K3TA 4KPHL 1NIEA 1ZGLP 3E3QE 1TYRA 2DMKA 2DQTL 1W72L 3HMWL 4M7LT 5DSCB 2V2WA 4K8RD 4GB9A 1WCBB 4PJ7F 4YSSA 4B41A 4I88A 3NJVA 4MDJB 2SEBA 4MJ5A 3PWVA 3L3OB 3T0EE 2XKUA 2P5WE 3NSYA 5D9SB 4BQ6A 1XCXA 4OBSA 4L5FH 3QUYD 5ANHA 2IAMD 5JYMA 1YEEL 4XBPA 3WNJA 2J3SA 2CDEA 4MDJA 5L88L 2BVUA 1G9NH 3TBVA 1WIUA 1XGQB 4YDKH 4JO2L 1MI5E 4DZBB 2MHAA 1X7QB 3CMOL 4J27A 2VLKD 3F8UB 1UWEH 5I1CH 1MZZA 2CK0L 1HWWA 3C9NA 4M93C 4DGYL 1MKFA 4OUUB 1BBJB 4ABUA 1AIFA 3KL5A 4FZEL 2B4CC 2ZXWB 3L6FA 2YJQA 3BFOA 5C92A 3DUUA 3EBHA 3G7TA 1T20A 3DX1A 1E8XA 1G7PB 3JWDH 4IU3B 5B21A 1KPVB 5I1IH 5A16B 1WICA 2ESVB 3WXVH 3G5YA 1BZ7A 2WGXA 4ZS7L 4PJHF 5SWQA 3U4AA 1X5LA 4YDJB 4OJFH 3HC0A 1UYWH 4GAGH 1NIAA 1ODAA 2BNQB 3RNQB 3TO2A 1YEHH 2C8NA 4XPBH 4G70B 3FN0H 4UBDC 2QRDA 5C7XH 4P06A 4L3EE 3RA7L 4UMGA 4AYSA 4N0UB 2W9EH 4MKTA 5LBSL 3T08A 4OLZH 4FXTA 4POZD 3PP3K 3LZRA 4JZJC 2GW5A 4CW1B 3D85D 4U4IA 5CS7A 2JOIA 9CGTA 3IF1A 2IBGA 5AW5B 4BH7A 3L3KA 3KTUA 4LEXH 1EO5A 2QT6A 2V8QA 4U6XB 3L1FA 4HHAA 3TBTB 1OY3B 4F7EB 5KSAC 3I50H 3WELA 3BN3B 1OKEA 1H3TA 2CHZA 1TVBB 5I76A 4PD4J 3X3FH 1E4WH 5HYEA 4IRJC 4AIZB 1JDDA 2J20A 4CADB 5CSGA 4LCWD 3RIFK 2MQCA 5SX4H 5MEPA 1RZKL 4WI2A 3SDDA 4FQQA 3EYSH 4WU5B 4NZJA 3FFCD 3ZSTA 3ULVC 1Z9SA 1IGTA 1U42A 5GGVH 3RGVD 4E41D 3IM1A 1JGVL 2W0PA 1BVNT 4LSRL 1X5MA 4OV5A 1EXGA 3MRRA 1I3UA 3P40A 3WFZA 3B5TA 1TJMA 3LPOA 3STLB 4NO3A 5CGTA 1K5WA 2HVJA 4LLYA 1YN6B 2EKJA 5IR1A 3BUTA 1IZKA 2MCPL 1KTJA 1MVUB 1EAOA 1RVFH 1V3JA 4IJ3C 3QEHA 4P5MA 5CGYC 3MYZA 4ACTA 1JYNA 2DQHH 4XN1A 4X2UA 1EZUA 1KCUL 1KNOB 1DVUA 1D3CA 1P9MC 2KLTA 2YKLH 2Z1KA 5JORA 4DGIH 1KTLB 3ORJA 1ORSB 1MRCH 2WKOA 2A9NH 3DMMB 1MWAB 4UT9A 2OMTB 1F58L 1JERA 1WLHA 4FXKA 4OF8A 1ZIAA 4APQA 2HG5B 3BN9D 4U6HA 1I4FB 5DD6B 2H1PH 4URTB 5E0QA 2DWDA 5EFIA 3EAYA 3OZ9H 4G72B 5IB1A 2P8LA 1UB5A 1MH5A 1CICB 1NFDA 4X5QA 4GRWE 1JFIC 4U3CA 4A2MA 3IDUA 2X4PB 5KWYC 2DLGA 5TH2B 1H8NA 4MD5A 3MRLA 1CGSL 2DBLL 5HVGB 3DK0A 4ZI8A 3F05A 5SWSE 3LQAC 1ZLWK 1A1NB 2F1EA 4G1EA 1HHHB 2HLFC 3IB4A 1RZFH 2WXNA 2IANA 1FZKA 3GMNB 2DQUH 2M83A 1I1AD 2MHAB 1YJDC 3EOAB 2FYYA 1J1OL 2AGJL 1J5DA 4WQOA 3U30C 4BFFA 5I0WA 1LHZA 4W4NA 1XGQA 3TBVB 1ML0A 1ZVSB 5DJ6A 4Y4HB 5CCGE 1MFMA 3I02B 1I8IB 5DWPA 5E99L 1KZYA 3DI2B 1R24B 3RVUC 1PGRB 3HRZA 4K2UH 3QRGL 4KY2A 4I48B 4JM4H 3QDMD 1MCIA 2Y24A 2YPKB 4XC1L 4XMZA 2Z3FA 2NY7L 2MTAA 2GBTA 2X4SA 2B59B 2V2TB 5EZPA 1DL7L 3ZU8A 5IMOA 3EJCA 4PV1C 3FSVA 1DLFH 4IEFA 3U1PA 2VLRA 3EH5B 5EBMA 5LXGH 3LD8B 5IVXA 1AQKL 1DEEB 4RH4A 1DDHB 4KTDL 1H3UA 5INDA 4LEOA 3TN0A 3QUXB 2LTQC 2CO6B 4M62H 2OMWB 5IHZB 4Z7QF 4D9LH 5HHMB 4HC1H 1RJLA 4M02A 3VRLE 2V0AA 2NLJB 4AQ1B 5MERA 2J4WH 3F62A 4OIFA 1IM3B 1O7DE 1BEXA 4CN1A 1CURA 2CO3A 5DXWA 2DMCA 3MLPA 1DLFL 2OTUA 2ZF9A 4HJ1A 5C0AA 1VFBB 5H94B 1L0XA 4MB5A 5KSVB 4A67A 4LLQA 2J8HA 3JWNE 4UIMA 5BZXA 5K93A 3S5ZA 4UV7H 4X6FA 1R6VA 5A6MA 1FZJA 4NKOA 4HG4J 2VDPL 1EWHA 2Y8LA 4JMNA 5E8DH 5D1XB 5IW6A 2PCFB 5C3TA 4Z78B 3ABLB 1I8MB 1R17A 2EICA 1OGTA 3U2JA 4DFIA 3MUGB 1IGIH 5EZLA 2CKNA 2I7SA 5C2UB 4PG2C 4HZ1A 2UWEF 3UAJC 1WO2A 2OTUB 4TSCH 3IGLA 2V9UA 1KG0B 2NY0D 4E41E 3EJZC 1BP3B 4E42B 3QFDB 1GIGL 1JGDA 5HYQA 2DLFH 2JJTA 2PNDA 3UAAA 1PL3A 4R2GC 5E95B 1DQDH 3IJYB 5EULV 2FK9A 1AD9B 3EOBA 4TOYL 32C2A 4DP8X 5JUEH 2EDXA 2WP3T 2OK0L 2HJKA 4EE2A 3CLFL 2BIHA 3TWYA 4J7RA 4N0FA 1NGMA 4DAGH 2CMRL 2ZXDA 4B97A 4TKWA 4PJCE 3DARA 1WBYA 1BGXH 3IPEA 1AI1L 1H6EA 3VH8A 4DW2L 3L3JB 3DXAB 2Z0UA 4OVUA 2PWHA 2MKWA 1J05A 4MXVF 1PCMX 1UKSA 3IJEB 2WWMC 2O1AA 4KZEL 2ATPA 2QHRL 2ZWLT 4FERA 4GO6B 1BSIA 3NOIA 1LVEA 4F1SA 3N1GC 2C9RA 5DRZA 2AQQA 4JFYB 4WVRA 4HBQA 4HT1H 5D4IA 2W60B 4OFPA 3ARDD 1WEJH 1HXMB 1LO4H 1EAPA 2F8OA 2WMPB 2IWEA 1JHKL 2GBVA 3ARPA 3GM0A 1BMWA 4R4ND 4RISL 3DPBA 5EH1A 5J12C 3TBWB 1J0HA 4BQ9A 4IOIA 3JWOL 1H5BC 1ZTXE 4YDNA 3IDXH 3O4OC 4H7VA 1KXQA 1L9NA 1OO2A 4ZXBB 4KKBC 2GK2A 2VZ3A 5I1AA 1DVTA 1GYWA 1AZRA 2DLIA 2YXWA 2ALAA 3FHEA 1WEJL 4KI5E 3MRLB 5GPRA 5IQ9A 4GMSL 4IBUA 2JXMB 4S2SB 5KSUA 5AB1A 1T5WB 1IQDB 1ID5I 3MZGB 3SO3C 1DJWA 3LKQA 1JNHA 4X98B 5EU7C 1MH5B 3NIDB 2P8LB 1XF4A 5F9JA 1UVQB 3KLAB 3TEWA 3ROLA 2LU3A 3RU8L 4U6HB 2AEOA 3ULSB 4HOXA 1LK2B 5GJTH 1QRKA 3MJGX 5BZWB 4D9QE 1Q4NX 4QKXB 3I84A 1VSCA 4ZTOH 1I1CA 2G0KA 4X8XA 3M8OL 4I87A 2EXWD 3HC2A 3C6SA 3O3BA 4HJSA 2DJSA 2J2ZB 3VXRA 4WEUD 4F93B 3VTAA 4HDIA 4DO6A 3MGAA 5IHHA 4GRMA 1PZAA 5T1KD 3AXLB 3MLVH 1BZEA 2CHXA 3G5VB 3C08H 1NWOA 1A1OA 1E5BA 3FTWA 5BVPH 2ADGA 4QRPA 3GMLB 2NNFA 4FNSA 2WBJC 3T6ZA 5C7XL 2AXFA 3UO8B 4IMLB 2A73B 3BE1H 3EYOA 4HALA 3WO4C 3P1VA 4M1DH 2OX5B 3CX5J 3WMSA 2VDPH 1XCTB 2ZCLL 3PV6A 1IE4A 2FBOJ 3LS4L 3P9LA 3CFCL 3QAZC 2LLNA 4FQXA 2IDCA 1BF5A 3BAJA 2WLIA 3D2UB 3PDDA 5GGRA 4TVUA 2Q86B 2B15A 2AJ3A 2ED7A 1Q0YH 2FBRA 3LEYH 1QQDA 4MAYA 5A43C 4R3SB 4ZX6A 1P5VB 2B9AA 2FX8L 3MRBB 4P0DA 4WI3A 4C4BA 5EO0A 4JRXE 1Y1UA 3HS8A 4Z0BH 1C7TA 1SYVB 4A38A 2VIRA 2P52A 2VRQA 3O2DL 2PTUA 4R7DB 5EU6A 1J9CT 3FQ2A 3ZQ9A 4YC2B 3RB7A 5DTFA 5E7BA 3F04A 3O2VH 1F86A 1T5WA 1MW2A 1ZT4A 4TNWF 5JIMA 5E1QA 4OD1H 2B20A 3QRLA 1ZRUA 1O9WA 2VZVA 1OWRM 1XR9A 2BOLA 4G8IB 4ODWB 4U0RB 4Q74A 2WTRB 5BV7B 5DQDL 5JYLA 4P3DB 1EHLH 2VERA 4H1LG 1XCQB 3N06B 1QABA 2CHNA 4UQDA 3LPWA 4L5FL 4LMQE 1PQZB 3APDA 3VXQA 1YJDH 3BPNB 1YEJL 5HDQH 2DMHA 1SUHA 2GBAA 4FQIH 1EAPB 5KOMC 2NY7H 3RWGB 2IDSA 3QQ9D 1JNLH 4QJ5B 3WGUB 4P57B 3TH4T 4R26H 3BZ4B 5JMRA 1KTCA 4DP9X 4BWUA 5HHXL 1CFTB 2QR0A 3HB3B 2MCAA 2EDWA 2HVKB 1RZJL 2CLVA 2F53E 2IH3B 4LCUB 4F8QA 5GGQH 4XBMA 2FAUA 1NIFA 2IG2H 3D1MC 4L4VE 3ZSSA 1WC7B 4Q0XH 4X6BB 5E0FA 4NRYB 4OM1H 4RMRA 1J5HA 3T0WA 2CBQA 5FUCC 5C6TL 2IEPA 3DSNB 4X7SL 3A4DA 1A6AB 3MLRL 1O7SA 3FO9A 4XC1H 3WS3A 5SWZA 5HHOA 5IJBC 4MNQA 5JN5A 3LEVH 1ET8A 3TFBA 2N3JA 2AABH 4N8CL 4Z23A 3IMTA 2A6JA 1P7QA 3US1A 4JK0D 2LQRA 4QRUB 4ZW3A 4ES8A 1I7UB 4YMPA 1E40A 3AS2A 4LSUH 3BHBB 1OPGL 4B9GA 5ABDE 3W37A 1WGVA 3FPXA 2ZXAA 2DBLH 3HN3A 1J1OH 3LZNA 4R7NB 4TLKA 3O4LA 5SX5H 1KJMB 4KV5F 3S34H 3KPRB 4OGYL 1PTZA 4XN9A 3KLLA 3U0WH 1LE9B 3VXSD 2J1XA 1QEXA 3V5DA 4PGEA 1H15A 2NRDA 5FCSH 4ALAH 5C0FA 4WSGA 1RU9L 1D5MA 1VOKA 1FAKT 3JTTA 5IFJA 1ZT1A 1UM6H 4MDIA 3TURA 2QRCA 3WL9B 2PR4H 2RGSA 8CGTA 4OIBA 5JMOC 5LUMA 5IB5B 4TN9A 3IDIB 3E1ZA 5FKAB 3QCUH 3FUIA 3N55A 4JG1H 4QRQA 3N89A 2VLJE 4HWEL 4Y9FA 3HG4A 1KGIA 3MBXH 4JJ5A 4ETYA 1CE1H 4L9LB 4NBZB 1A1MB 1FA4A 2X4QB 3BIBX 1L3NA 1KFGA 1CLCA 5BS0B 3F65A 4GP4B 4O58H 4XO5A 4UQ2B 4P5KB 2AK4D 1RZ7L 3C8HA 1FH2A 3FB5B 3QS2A 4I5BB 3D34A 4NHCH 4CSZA 3FUJA 3HPJA 3GD1C 4XNZC 4ZFGL 5EHFA 3TU6A 4YHMH 1LMKA 3AW5A 1JGVH 2F61A 2UY7A 4AI7A 4NFCA 4IKKA 5D1ZI 5GS3A 3CZFA 5SWZD 5GZOD 1K9TA 4LVNC 1P4LB 3NP4A 4QHKJ 2PWGA 4NX0A 1JZ7A 1TZHB 4XHJC 1C8QA 3FO2A 2OSXA 4L4VA 4ZMOA 2E9WA 4BUHA 5I74C 5GRJH 3EXJA 1TQBB 2W65A 1MI5A 5TE7L 5J06A 2V7HA 1S9YA 4C56E 3PLYA 2UZYA 3O6MH 3F5WA 3QR2A 5FX3A 3E7JA 3KYAA 3WJMB 5LQBL 2NMSA 5I8CA 3KPSE 4PLOB 4XP1L 2ARWA 1AY1H 1MQKH 1WG3A 4Z3EA 2OSLA 4K3EH 5IUSA 2H41A 1FDLL 4TMPA 4P5TA 2EH8L 2NYZA 1MRDL 4J1UB 4RAUA 5C0RL 2YUWA 3MGOB 5LDUA 1I8MA 4FEIA 2IJ0C 5HXMA 2VXTL 4CVXA 2FB4L 4M7ZC 4XNMA 5D8JL 4HWNA 5CU5A 1IGYB 3FONB 5C0EB 1MOEA 2BP0A 4L8SC 1NOFA 2FYYB 1MRDH 2IDFA 4X6FB 5E56A 2AJVH 5E6IB 4ZMVA 4EEEA 4PJDA 2PW1A 4OFYD 5TE6H 2EO1A 3RA7H 5C8JA 3FBKA 1XGYH 5BO0D 1AY1L 1MQKL 1UD4A 5HVHC 3VXNA 5ABZA 2XNAA 3ERXA 4M56A 4FZEH 4G5AA 1B2WH 1WAAE 2NLJA 2F6AA 2EYTB 2VZSA 4QMEA 5IBUB 4V2BA 1P1ZA 3G6JE 4YSTA 4IDJH 1RY7B 4DQAA 3S5LB 3ARZA 1CE6B 3P3YA 5E4AA 4K23L 3F10A 1HI6A 5I0VA 2GC7C 5KVDE 3BEWA 3T4AA 4ZNCD 5J7CC 5IMLB 5JA8B 4U7KA 1JD9A 1NFDF 1DZBA 3A5VA 4WFEE 3MLUH 5EEXA 3MLZL 2V3EA 3PL6A 2GSGB 1GSMA 5AOLA 2ISDA 1WWBX 3GTVA 4MX7A 4X7CC 4W9JC 4F7TA 4P46C 4PRAB 1X5AA 4OLVL 1MCOL 5F9OL 1D7BA 3PWNB 4PS8A 1VKLA 1OCWH 2JJVA 2OMVA 3L4ZA 2FJSA 4JO1H 5L88H 1N3NB 1DANT 3UJTL 5BXFB 3B3BA 5DT1H 3PYCA 3QEHB 5FK9B 4D7RA 1NC4B 4Z6AT 2NOBA 3DETD 3FCSB 4TQ8A 5CIPA 3IYLW 4LNRB 4FNRA 2H45A 2NW2A 3PV7A 5IQLA 3V5KB 3I0XA 1MLBA 3JVGC 4XMTA 5DZOA 4BIKA 1QAWA 1A7NL 4XXWC 1Q0XL 1MPGA 1AZVA 2WTPA 2EIZB 2LE9A 2L7QA 3HZVB 1B4JL 3NJHA 4W6XB 3VA2C 1INQA 2Y07H 5DMKA 3V0GA 4U1JB 1UZGA 2N59A 3OLPA 5JZ7D 3DC0A 1KGYE 3NVQA 3D4VA 4PJEA 3GSOA 1TVDA 3L7FB 3N85L 4J3SA 3VQ1C 3U83A 4R9HA 4EN3C 3V4PB 3X1FA 1RK0B 1J9QA 3ESPA 4CSSA 5KANI 4CADA 5DA4A 3QA3A 1C4GA 2KKQA 3ESNA 3L4VA 4MD5B 1LQSR 3TV3H 2AJZB 4WDIA 3OJVC 4DEWA 1CICA 1NFDB 5DK3A 3KBHE 1A6VH 3FO0L 2Q2LA 4AE0A 1SN5A 4GIPD 4AYDC 3MBEB 2DB8A 1HEHC 1J0ZA 3LSOA 4IRJB 3TCLB 1CT8A 2C5DC 2QVIA 1WZKA 3PPEA 4WJ5A 1QG3A 5DI8A 2BW5A 1UD8A 4ZFFA 2IANE 2F54A 2BVPB 3TV3L 1BCIA 4E0RB 5BUGA 1P6FA 2X4NA 3C5XA 1NMBH 4MXQC 1DUZB 5C0IB 1ZLEA 1S9XA 3MCKA 4LZKA 4YDLB 2IAMA 2AQNA 2ZOUA 5J6SA 1MHPH 5DFAA 3OMNB 5C9JA 4JFPA 1YEIL 4EMZA 5DFTA 2WSKA 1CS6A 3C60A 4GQZA 1MXGA 1MG2C 4WHTB 3MXWH 3ULUD 1IGJA 2P48B 2UVFA 3KPQA 3V4PL 2A99A 2FTAA 5DJDB 2VLKB 4JQVC 1TJIL 3U6XS 4FADA 1Z5LB 3PP4L 2DWYA 1TUPA 3WN5B 3ES6A 4Z7UB 1X5JA 5CF3A 1DSWA 3M45A 2VDQL 5CR1A 5H2BB 1E43A 1J1XL 5DQDH 2FUVA 2EUVA 2H26A 2Q76A 3AXIA 4MGXA 2OQJB 5IOKA 3V95A 2X4RB 2GJPA 1WDAA 2GQHA 3HNVH 4MNGE 5IEKB 1F45A 4JAMA 2ADIB 3QYNA 1RZIB 5KZCD 2QEJA 4JKNA 4LRIA 4NLHA 5DA0B 2P1YA 2JJTC 2YXMA 2IADB 5E1GA 3S3PA 2N4IA 1KXQE 4I4WB 1HWHB 3LMJH 4R7VA 3PWVB 3SBRA 1S3KH 1UZ8B 4BKTC 5MENB 1VKXA 1KENH 1PU0A 25C8H 4UT6L 2W07A 2OJ1A 1MHEB 5A6LA 3EO1A 4N0UA 3O6LL 4GKSB 5E2TL 2CO7B 1AACA 1HWGB 1RHHA 5BQDA 4K55A 4G7YL 4JBSA 1CU4H 4NPYB 4JPKL 1F56A 2BFVL 1NLBH 2EILB 1A0QL 3O6FD 3FQUA 1FLRH 3MRPB 3Q13A 1EEQA 3MJ9L 2WTOA 3QDJB 4KTGA 3T2OA 2Y7NA 5D2LB 2KDYA 2CRIA 2NTFA 3C08L 2RACA 3QCVL 4ZW5A 1MDTA 1HN1A 4KGJA 5AZEL 4G2AA 2IOIA 2NDGA 1E5YA 4WW2C 3GINA 4CU7A 3B3IA 2PO6B 2R29A 3O3DB 2AV7B 2QVTA 1MUJA 5I6PA 2BNRD 3TX4A 3EO9H 3NSCA 1R4XA 4GUPA 4IK6A 4OJAA 4HOWA 2Y23A 4M7JL 1J8HB 2VDML 4U1SA 2VN5A 2WYIA 3KPNB 3VJ6B 4FQCL 2J21A 3RWDA 2CGRL 4FG4A 1OVZA 4PG9A 3ATDA 4XTRC 2YD8A 1FFRA 3MOBL 2R8SL 3JWDC 3KHOA 1NSNL 1ADQA 2AEQH 1TQSA 3F58H 4NZRL 2QJDA 3VGGA 2AQTA 3NGBB 5KYUA 5TE7H 3VGFA 4G42B 4ZUUB 2CWRA 1QBMH 3OKLB 4LDLB 1U9KA 1UTDA 1T1XB 3ML8A 4J3WA 3K6FA 1HH9B 4QJ3B 1HVXA 3LVEA 2NOEA 1I7RA 4S1DC 2IWKA 1AQ8A 4NXKA 1FFPB 5FM8A 4I89A 1HL4A 5E2VH 2EDYA 4LKCB 4YZFE 1T1WB 3T1FA 2F08A 1M7DA 2YD4A 3HIZA 3A22A 3ZE0E 1U8PB 3S7GA 1WJ3A 5GJSL 4PJAB 1E4HA 1S8DB 2XN9A 3CWGA 1VGEH 3TXAA 4P48A 1S4IA 2V2XA 3B5HA 4JB9L 4RGNE 2CZNA 2R1YB 3SKMB 3EDEA 1KIUA 4JFDD 5F97E 1FVEA 2CKBB 3MLTA 3TTSA 4AXWB 1MLCA 3D3VA 3AFLA 2PLTA 5DJ2A 5BRZA 5AN4A 1TOXA 2YD0A 1PEWA 1N7MH 5L0QB 2AK4E 3RUGB 4ECNA 4NHUA 1BGXL 5CHNA 2B1OA