1KYDA

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
total genus 68
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kydA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kydA02
1AISA 1TGHA 1QNAA 1NH2A 1R4XA 4PY5A 2IV8A 2A7BA 1QN3A 1E42A 1VOKA 1D3UA 1QN8A 1W80A 2D0AA 1PZDA 1YTFA 1QN6A 1TBAB 1VTOA 2VJ0A 3HS9A 1NVPA 2DWYA 1MP9A 4WZSD 1NGMA 5IYDP 1P4UA 1QN7A 1C9BB 3MNMA 4ROCB 3OC3C 1OM9A 1QTSA 1VTLE 1QTPA 2MJ7A 4BCXA 1KYUA 1GYWA 5CN1A 3OCIA 3HS8A 2G30A 2Z8UA 1IU1A 1QNCA 2D0CA 1RM1A 2IV9A 3ZHFA 2YMTA 4ROEB 1VOLB 5IYCP 3ASMA 2DWXA 1QNEA 1KYFA 5IYBP 2E9GA 1B9KA 1QN5A 3ZY7A 1TBPA 1NA8A 4B0AA 1QNBA 1PCZA 3EIKA 3VN5A 5CN2A 4RODB 1QN9A 1KYDA 2D0BA 3H1ZA 1KY7A 1KY6A 1JFIC 1YTBA 1GYVA 1QN4A 1CDWA 1GYUA
chains in the Genus database with same CATH superfamily
3I9GL 5I1GH 5JZ7D 4KNTA 4F20A 2Z7UA 4CADA 2C3GA 1QFPA 3ARFD 1WBZB 3NFPB 5KVFL 3SE9L 1BVOA 1G9MH 1SXSA 5K9JL 3L4UA 4L3FA 4FZ8H 4HCRA 4AMXA 2E7MA 2VW4A 3MRDB 4XMPL 2X9ZA 4HKBB 3HZKB 1M7XA 2FJSA 1MHHA 3AT0A 3G5YA 3L5XH 3O3AA 4PLOB 5KYNA 3PL6B 4LAQH 5GGTH 3TYFB 3F7LA 3SKNB 3HE7D 1G9NL 2YMOA 3MRHA 4ILDA 2IXQA 4JY5H 3GMNB 3WFEL 5H37G 1M2VB 4LSUH 4UWQB 5GRUH 1M05A 3H2QA 1BVNP 1V55B 5D7IE 2FJHB 3QJTB 1SUHA 4XN9A 1NUGA 2YPLE 3MLZH 4CC4A 2NY4D 4HFWA 5F1KC 4GS7C 1A2YB 4QOKE 4WWNA 5ICZA 2PO6A 1ONQA 3KWWB 3GSOB 3UYRH 2GEEA 2YAMA 3R7QA 3L3KA 2KZWA 2K3TA 2A99A 3P11L 4PVNA 3ZE0B 5IHUL 5KVGH 3DX4A 2HSIA 1G6RL 3PY9A 1JXKA 4O5LL 6FABL 2FHCA 5SX4I 1R5IB 5B7FA 2WQWA 5AKRA 4FABL 5EZJB 1XGZA 3CX5J 5C9JA 4N85A 4S1SH 1GGCL 3MNVB 3PP4H 4JJ5A 3WO4C 2ERJC 3FO1A 2I25N 2FSEB 2Y8LA 3EADA 1HNFA 4GRWF 3GUTA 1NGPH 4Z7QB 3HR5A 1BVLA 3NZ8B 3G08A 5C0JB 3BUBA 3TJHD 1Q9WB 5AYTA 3US9A 3BN9D 1Z66A 3MJ9L 1XIWD 4G6FD 1QA9A 1K4DA 1M7IB 4WI9A 5KVEH 3ULVD 2JJUA 1FI8C 4KV5E 1BG9A 2OYMA 4E41E 2Q76A 4ZSOE 1CQYA 1OCOB 3L3OC 5DFAA 3UXFA 3ZDXE 3VW3L 3Q8FA 4WIQA 5BQ7B 3SZKC 3VFNA 4L3EA 4WU5B 3HS0B 4ZTOL 1FCGA 3CFCH 4JFOB 4QXWA 2EXYC 1E8XA 3MGAA 4B3EA 4MSWB 2WNWA 4PCYA 3TO4C 2YLHA 1BFOB 1QMUA 2JCWA 3BT2H 3KLQA 4J3OF 4Y89A 1IT9H 5TD4A 3UZEC 1TJGL 1LJMA 1OARH 1CD1B 3I0WA 3Q7JA 3ZE1B 1F0LA 1ZIBA 3KXFB 1QLEL 1T5WB 1MHEA 1XAUA 4R7DB 2YD0A 5FM5M 3UTPE 4AYBA 3PP3H 2K8QA 1R17A 3IDYB 2EKSA 4PGCB 3L1EA 5EN3A 2D2OA 3W82A 2IWGA 3CFDB 5JMRA 4ZJ9A 3AWGA 3ETSA 3VXUD 3AJ7A 2EDXA 1A1NA 2D4FA 4MNHB 4XPTL 2C4FU 2NY6C 3N85L 1HHHA 1OM3H 4PTUB 4MJ6A 2A9BA 1TQCB 5DZPA 4XP9H 5IM7B 4RAUA 5B1BB 3V5DA 4YAQA 1P53A 3BKJH 3L9RA 3EHBB 1H8SA 4X99A 3RUGB 5ESAA 3TEUA 5HYEA 5J13C 1A3LH 5BPPA 1TTUA 1IGYB 3HRZA 2H0PA 4MHHI 3P0YL 1NGMA 4N2GA 4ZMTA 4X6BA 4R2GB 1FVEB 1OGAB 1VZGA 4IHOA 2NR6C 5CCJA 4U2ZA 3QI9A 4KZCA 3QEQA 4LVHB 1J87A 4WO4D 4Y5YA 1QO3B 2N7SA 5LGYA 1MFAH 2CUAA 1FCCA 1REIA 3HG1B 1JPSL 3L08A 2ADJA 1JUFB 3L1GA 1EO8L 4QRPE 5CEXB 1SN5A 3GSNL 3MYZA 3KLLA 1WZAA 3O2DA 3ORJA 1F6FB 4LCWB 3NN8A 4ZO8A 1H8LA 2FO4A 2W95A 4KKQA 1PDKA 3MXVH 3EUDA 1IC4L 3FKUS 4XNXH 5JUEL 1DQQA 2XWJA 3LEVH 3LIZL 5J6HB 4ZD3L 1OAUL 4YBQD 5J11B 3H7LA 3WS3A 5EEZA 3E7JA 1UKQA 3TT3H 1FJ1B 1OHQA 3B7RL 4X6DE 3W9EA 3E3QE 5HJGA 1WS8A 4YK4B 3JWDH 4Z3EA 3FFCB 1JNJA 1QSFD 1TXKA 5EB9A 1YZZA 1F5WA 1YNLL 4E9TA 2IWEA 5IQ7H 3CWSA 3PQYB 3TZVA 1MVUB 4A2DA 4YHML 4HUVA 4YEEA 2BXZA 2L0DA 4JFQB 3KCPB 2KLTA 1M6UA 3NSXA 1Q4NX 2CMRH 3B5TA 4X6CB 2IFFH 4N9GA 1QNBA 2HFGH 3TV8A 1K4CB 2XQYA 8FABB 4AVKA 1E9QA 3CSPA 4A66A 3H1ZA 2VAAB 4Y2OB 4XNYL 2FUTA 1CD9B 2DKUA 2B3RA 2X6BA 4NZFA 3G6DH 1KTDB 1T6WA 4X5WA 3RVTC 5LBGA 1T0MB 4DKTA 3IPBA 4D8PA 3HPLB 3N42B 3QDJA 4G9FD 1D3CA 3RTQD 3CG8A 2GJPA 3IE9A 1X9UA 3VYPA 3HJEA 5LWYL 2JHNA 2R4SL 1IGIH 1OL0A 3MBEC 1A0QL 3C2AL 3SDAA 3IMSA 4L1SA 5FUCC 4LIQE 1ETZA 1TJIL 4PJEA 1V54B 1OW0A 3CSTA 4JKWA 1IEAB 4MRBA 3UJJL 1Q1PA 3WBDA 1BF2A 4OI7A 2ENPA 4I3RH 1A4CA 4PBXA 3SSGA 5DJXA 3QQ3A 3QS3A 1MHCB 3SBPA 4NNYA 3I75A 4IYKA 1S5IL 1MCOL 2P5ED 2B0SH 3TPUA 4D0CB 3MRGA 1G6RA 5JW4R 2CLVA 4KJPD 2GEQA 4BRJA 1PZBA 4P99A 5DLML 4AT6B 3SQBB 3GSVB 3FT0A 4WKXA 5E9DA 3EYSL 1RPUA 2VR9A 4S0SD 2XI9A 3SBRA 3GFUA 4ZAKD 5I73B 3ULXA 4L8SB 4YSPA 3LH2H 3MR9B 3EJPA 4LSVL 5D7LD 4GW5B 4DVBA 5E1AA 2IMMA 4H5SB 3MOBH 1O9WA 4WNQA 5EZIL 3QUMH 2WBJC 3EJCA 5FGCB 1S7SB 3LNEA 3HAEA 4OGAD 1R3IH 4JFPB 1RIUH 4F37K 1N8OE 3MJ9A 3O6FC 2VXSH 2VXQL 3KVPA 4GUPB 4B9CA 1W0VA 2X2JA 4UM9D 4FG6C 2VUKA 4EAGA 5LN8A 2YRBA 3X1GA 5I1LA 1IVTA 1LQBC 3GXNA 1B90A 5FO2A 2Q8BL 1WFOA 2XQYG 3ZE0E 4U4IA 1UGNA 2QZQA 3KPOA 4LGSB 1G7PB 3LQMA 3SJVA 1I9IH 2ENQA 4Y9BA 5BZWB 4JGJA 2TAAA 5KTEH 5C08B 1UM5L 3OG6B 3HC4L 2HP4A 2HG5B 2X4QA 3GMOA 3KPMB 4PRDA 4GKSA 4OZFA 1KENL 3UPRB 3D2UA 1YDPA 5FW8A 2PW2A 4XO8A 4WK0B 3TCXA 5J1AB 4FMVA 3IJSB 1CLOL 3BP6A 3MJ7B 4NQDB 4IOFD 1USQA 2RHEA 2W0PA 4WFGE 3RRQA 3VG9B 5I1EH 2WMPA 3MUZ1 4QGYA 3AACA 4S2SB 1D9KD 1XSJA 4R0LB 1DFBH 2I26N 2QKIC 5IJKA 1XTLA 2VMEA 5DRZA 1TZIB 3NIDF 5BW7A 1YYMH 1JGLH 4NQSB 2GITA 4AMKH 3L3HB 3LKQA 4HAFA 4JKPL 1JD7A 3B7TA 1MCPL 3MCLH 4X8JA 1GMIA 1BGXH 5FYKL 3B2PA 5FYKU 4A38A 5DJ0A 5DQ9A 1Q9KB 2ZWKA 4H8QA 4OM0L 2AC0A 3C6SB 1RUKH 2UV3A 4N2MA 1URIA 5JR1H 1P6FA 3FUDA 3T3MF 4OZIE 2ICWB 3EO1A 1WCBB 3JWNC 4HIPA 3L17A 1FG9C 4IRJA 3D4GA 2WLZA 3DJTA 1AGBB 4FQJL 4RESB 5IW1B 2FKFA 4U4BA 5D7JB 5GISL 1XH1A 3ZE1E 3KXFE 1GVIA 3HAEG 4XO4A 2NZ1A 3I2CL 3GSNA 4XHJC 3SB3A 3VFPB 3T09A 2E8YA 1FV1B 2BVUA 3DOSA 3NK4A 1F6AA 3KR3H 2BSCA 1CFNA 2IH9A 4OLVL 5TDOA 3SYAA 3LIZA 5HPMB 3IDJB 1N5YL 4MKMA 4FXGA 1MCFA 1CGXA 4HZLA 5I9QB 5CP7A 4OB5L 2ZG2A 3D18A 5CP3H 5DVKA 4MRQA 2VL5A 2PXYB 1YCSA 3RUGE 1I1YA 4P4KB 5GGSA 4IKIA 3MNMA 5KOMC 2HKPA 2X9YA 4OZFG 1OM9A 5LDSA 4KJYA 1FP5A 2YPKA 4QRUB 1EAQA 1SOXA 2ZOLA 2HFEA 3VXRD 1OGAE 4LBEB 5CBAB 1YMMD 4W9JC 4XMKH 4F8TA 2OSLB 2ZWNA 3NJHA 4P5TA 2P24B 4FQXB 3OM3B 2A77L 3HG1E 1NCWL 4IU2B 3QWNA 4URKA 1TYEB 5ANMA 1N26A 2OW7A 1KIRA 3TIDB 1DEEB 1VCAA 4LCWE 2P80D 3I6GA 2JQAA 1GZPB 2LVEA 3FOMA 2WIIB 4XOCA 5INCB 1EVUA 3UZVA 2EH8H 2H6PA 2QMJA 1JPGA 3RG1C 5ADPL 1A9BA 3T4NA 2BC4A 3II1A 4MJIA 4MCZB 3QPXH 4LCCA 2PYFB 4IBZA 3MUHL 3BEVA 2WWKT 4JE0A 1P4BH 3ZZSA 2X1WL 2WQVA 1J8HB 3EOAB 4U1SB 3DIFB 5EU4B 3U7AA 2BS8A 1C8PA 3FFCE 3Q3GA 3HEIB 1TIUA 4FLRA 1DE4A 3KDMA 3PQYE 2TRHA 1WAAF 1PD0A 3NSJA 4HH8A 5AAMA 4DTGL 2VR3A 3EYUH 4IL8A 2J43A 1TVBB 3A6OA 3BAIA 4JFEA 4X6CE 3GHEL 1J7VR 4YEFA 1F1AA 1T20B 4HLJA 5IB1A 3O2WH 1ITBB 1N6VA 5E8NB 1BPLB 1UXMA 2NLJB 5IVOA 5A2AA 4LMQE 5KBKA 4NHCH 1M42A 3DBXA 2YRPA 3TTSA 3VRIB 2H1XA 4HALA 3HBPA 3WL9A 2EO9A 1HL9A 4PRAB 1LP9A 1ZS2A 1B4LA 4U1MA 3HBGA 1NGYB 3FT9A 3G5VA 2YKKA 3BZEB 3L5WA 4PGBA 1FHGA 1NCUA 5DJAA 3EF4A 1B3JA 5K69A 1YLBB 5IB5A 4R96A 3BWAB 1DSFH 2PWHA 4C4KO 1U8HA 2CKBB 4NZTH 3QK0A 1TETL 2B08A 5H8DA 2BP0B 2GJRA 3FTUA 3HC3L 3QEHA 4WI6A 3WU1A 3UROR 4NOBA 2DQMA 3ESVF 5C0DA 1UOWA 3K46A 2D2CC 3IKCA 3JV4B 3OC5A 1OAQH 3C6LC 1E27B 3C09B 4HIEA 2YLKA 3ASNB 3A23A 2AKRA 2O26U 5KSAB 3OGDA 3EYQC 1F11B 4PJBB 1QWHA 4N0CC 4AJVA 1LE5B 3GT6A 4I48B 2Y3NA 3O4LB 4DETA 2B7DT 3PREA 1JVOA 4QKTA 3MACH 2MNJB 3CZNA 4F3FB 3HI6H 2X0UA 1E9OB 4KXCA 1V7ML 4GSUA 4GG6B 4UOW0 2PW1B 2DI8A 1Y1UA 3DVIA 3MRLA 3P9WB 5TF0A 3KPRA 3GF8A 3NSDA 4H1LA 5IHLB 1A3QA 4HGWA 1TVHA 1OSPL 2R5XA 5FGCE 2ZXGA 1G7QA 2AEOA 1LO0L 3IKKA 4WEEA 3QCUL 3INUL 4X80H 1A9EA 2F58H 2K7PA 2YUVA 3CLEL 4KJQD 1BMWA 4EBQL 4XPBL 4XXWA 2Y6TE 3QORB 5AOZA 4I0PC 5EBLB 2IV9A 3ROLA 3OR7A 4PJ5D 1PZCA 1FZMB 2XA8L 1C16B 2AEPL 2UZIL 2EYRB 3AW5A 5ESVB 4FTVA 4MA1B 3CVHA 2YD6A 1FVCB 1IX2A 2BJMH 4AV0A 1VDGA 3TBVB 3KZ8A 2R7EA 3ZIYA 5FDYA 1AJ7L 4J12A 3CDGA 4NKMA 4P5MA 2G3XA 4XBEL 5C08E 1RURH 1Q9UA 4WHTB 1NBZB 1I85A 1KNOA 5FKPA 5JORB 3SY6A 3TFKD 3R1GH 5KVDE 3QAZB 2AJXH 4LLVB 1NDMA 3PIQA 4J23A 3L7FA 3LQZB 2F5BH 4JR9H 5CJQH 5HDQH 1RZIA 4YIQA 3O2DH 4NQDE 2G60H 5F8RC 3HRPA 4NEHB 4AKOA 2XWTB 4PLJD 3C75A 3IJYB 1CXKA 1MIEH 2R69H 2Y69B 2CJUH 2D7TH 2OMTA 3QUHA 4GPVA 3D39B 4XZUB 5JPMC 3RPIA 2P52A 4KGJA 3OKKB 3ABMB 4GSRA 1YUHB 1ZWIA 3MRBB 3OXSA 1JNNL 4UTAH 5ISZB 3AADB 1SQ2N 1JRHH 3V0WH 3FDWA 5EF2A 2Q7YA 2NOEA 3KJ6L 4FHJA 4HIQA 5AW9B 2ZWZA 2K7QA 1GKOA 4AYFB 2C9VA 5IF0A 3CWTA 4WY7H 1T1ZA 5L4IA 3AMLA 4QTFA 4P5RA 4NAQA 2BOCB 2HKFL 3RIAK 4ZMXA 1E5UI 1I75A 1QLFA 2VWEC 2HRHA 1HILB 2YBRB 4PLNC 1P5VB 3KPQB 1KTKE 5FF6A 1EAOA 1GZHC 4XNUH 1XF2B 5AVWB 1EHLL 5IQ9A 4HJSA 2BIQA 4FQCL 4JRYB 4ZXBD 3WS6A 4XP5L 5G4NA 2IPTH 2RFXB 5ITFA 1U3HC 1E3FA 4L9LA 1YMHB 5DWUL 1CO1A 1RJYA 1V3JA 3TVMA 4HIJA 4R3SA 4L3CB 4TTDC 1HHJA 1Z9OA 3LHPH 2A6KB 1MP9A 1AZUA 2VB5A 5GJTH 2A6JA 2Q9OA 4A2MA 5F21B 4HKXA 2DTMH 5DS8A 3BW9A 4I9WD 1DQJB 3AGWA 3ILQC 4XMTA 4XPAH 3NVQA 1KDJA 3GIZL 3HZ3A 4G3YH 4MDJA 2P46B 3THMH 1EZLA 3ARBC 1KYUA 3CFEB 3OKOA 5C0BD 4PJXB 3QUYB 3TJPA 3QR1A 3UC0L 1T2QL 2MPVA 3VWKD 2AEIT 3U6RB 5DD3L 5DMYA 1ZANH 4Z7NF 2AAVA 3I3BA 3KBFA 2G9HB 4HT1H 5AW7B 1T4WA 1YYLH 2FWOB 4OT1H 1IBYA 2XQ0A 4WW2A 3WO3B 5F7YC 2V2WA 4JZJA 3D52A 4LKCA 2VNCA 4LSPH 5LB1A 3VJ6A 3TURA 1DLFL 4FN0A 1JGUL 3NJLA 4UIMB 5JPNA 4ZMYA 2XYCA 2AXHA 2C8NA 3ASWA 4PJ7A 4GKNB 1H19A 1JPTH 1WHPA 5IW6B 3ML9A 4JQIL 1FO0L 1QBML 1QUNB 4NRYA 4BZ1L 5CEZD 4RAVA 2VJXA 1EAPA 1U93B 4HYTB 2WLIA 4HS3B 4LLUA 7TAAA 1T03H 2FKMX 1FFRA 1OF2B 3C60B 4WJ5B 2NY0B 5KS9E 3SDCC 4X4XB 5EDSA 3QIWA 4RGOL 2V5YA 3LS5H 4NO2A 4RNRA 3PF2A 1KY7A 3GS7A 2EEDA 1CU4H 3BP4B 1CB4A 3CDYA 5D55A 2YSSA 3FOLB 3O45A 2WGXA 2YJLA 1KTBA 4FNQA 1GYAA 4TPRL 4QRQA 2OX5A 4OCRH 2J8UB 4PW4A 2VDNB 3L4ZA 3EO0A 1AGCA 1CGUA 4M6OL 5CD3B 1EXHA 1BZDA 4G8EA 1X7TA 1XVSA 2O6EA 3F7YA 3MROA 3WD5H 3GXTA 3GO1H 3MO1A 4MFHA 2XIDA 5AAWC 2V5MA 2BX5A 5G4MA 3R8BB 3NGBC 3FN3A 3QCTH 4MMXA 5EU5B 5IBUB 2Y22A 3FN9A 3NJKA 5LAPA 5B1JA 3KGUA 3MX0B 3PNWB 2CCWA 1R0AH 1P84J 3O81A 2VXUH 2CDFB 3QC5X 4RGNB 1UURA 3FZUD 2MPAL 3X13A 1QN6A 3S8WA 4RIRB 5DJDA 1TITA 3NACH 1RJLB 2O3OA 3ENOC 4X9IA 1BJ8A 1PCSA 3T4AB 1Q9LA 3LZQA 3Q8CA 4GRLA 4HFUH 2R0KH 4M8QB 1T1YB 4G83A 1VFMA 1UFUA 1KTLB 2XX1A 4UIKL 2RH0A 3KYNA 4GXUN 2AK4D 2JVUA 4PCKA 4NXSA 4PV8B 5EC1A 5HHVH 4P23C 3PGDA 1SOSA 4XVJH 2NTFA 4PJBE 1I9JH 3K3QA 4MD0A 5L4JA 3T2PA 1C7TA 3O4LE 5J9PB 1EDHA 1TMQA 3DO4A 4NZDA 5HHMD 4E9RA 3AABA 3LKNA 5FYJL 3SO3C 5HYJD 1PKQA 3EZ8A 5FYJU 4GG6E 3FH7A 1BD2D 2CO6A 2KMWA 4MMZC 2BFVL 2E5EA 2IEPA 4PJDF 1GTFA 3OR6A 5I82A 3QJOA 4Y19D 3MLPA 1CZ8L 3W5NA 3BUPA 4JQXC 3W57A 2QVFB 1IRAY 4J3OC 1JGEA 1JJUA 2BMKB 2OJ1A 3EGDA 2E7CA 3OAYH 4EI5B 4NFBA 2EADA 4FQ1L 2X4TA 3K80A 4XNBA 1FZJB 4W9CC 2JKIS 5E2TL 4HKZB 5F1IA 3ZDYB 1EJ6A 1XL6A 2FGWH 4XP9L 1JDAA 3MSPA 5DUBA 5FV2A 5GGRB 2WW8A 3RJQB 4PB9H 3SOBH 1E2ZA 2VDPH 1CK0H 3M45A 2ZCLH 2EH7H 4IRZH 1RZ8B 4Z7IA 1UYWH 2NY2D 4EAEA 3UOAB 4I0KA 4FYRA 1BLNB 2BSTB 2I07A 3QQDB 3TO4D 2J2ZB 2XKSA 3ULSB 3VXMB 5I8OH 3V0HA 5JQHC 2HMIC 4HSCX 3PUUA 2Y1VA 4EN3B 2D0BA 4NRXB 4NC2B 3AMKA 3P4OB 4LSTH 1IGJB 2QGDA 1CN4A 3IN2A 5EF3A 4CSPA 3UBHA 3PPEA 4ALAH 1HCYA 3WY1A 3BSZH 3D12B 4IDJL 4IU3A 2GJ6B 2CHNA 4Y4FB 3ARWA 3K81A 5TDNB 5B8CA 3Q06A 1DBMH 4LHUB 5FHAL 3D39E 4OFYA 4ZMNA 1W2KT 1W8OA 2EIZA 4LLWB 1Y6MR 2DWDA 4PBWD 2NY6D 3DBSA 3IDGB 1SVBA 2H45A 3GB7A 5ISZE 1X6LA 4QR7A 1JGVL 3TT3L 3D0VA 3QZPA 1OHZA 3W0WB 4JGUA 1IFHL 1F3DJ 4JO5A 3TIEA 3S98A 1NGXB 1A6VH 2C1OB 3VFOA 2VRKA 3WGVB 3DTXA 2VDQL 3PAUA 4XOEA 3UADA 3BH9A 3L5IA 1FE8H 5D6DC 5TK4A 2CMRL 2WJ7A 1NFIB 3UCRA 1NC4D 1XH3A 1XT5A 3WSQL 1NWPA 4RDQG 3ETBF 3DVNA 4M4RA 4P2OA 1JZJA 4JRYE 5IVZB 3MRRB 3QZNA 1JF1B 4B9GA 5SWQB 3N41F 3AZUA 3QUZB 4BK5A 2ATAA 3PDOA 1X5YA 3UDWA 1T3FB 4FFVC 4Y9GA 3A6CL 2CK2A 2AMGA 5FX3A 1Z2KA 2QMKA 3WHXB 2F54D 2FBRA 1ZA6B 4KMTL 5DUJA 3RYMA 4BZ1A 1AHWC 2MZ8A 1JDCA 3CWAA 1GCFA 1J0YA 3BVXA 4JPWL 4AUYA 1V7NL 5GS0D 1X9QA 4KOBA 3DXAB 3ARDB 2DQJL 4ORGB 4PJXE 2XOTA 1CICC 2WXQA 1IGTB 5DHEA 4AYSA 4BDVA 3HG5A 3TBYA 4G8IB 3O3BA 4LSSL 4Y9FA 4MAUH 3QWOB 3MVSA 1ASQA 1BQUA 2HYMA 4P5KB 5D1QD 3SCMC 3WEAA 1FFPB 3QH3A 5B3JE 3S37L 4M7LL 2CA3A 4JDVB 4IW4C 1S6NA 3O11B 4TKWA 2HWZH 5T1DH 4UILL 4QJ3B 4X0NA 5EO0B 1WGVA 2Q86B 5J4MA 1QI5A 4H1LH 1P0SE 1ZDSA 3O41A 3HN3A 5D7IA 4LIQL 1LP9F 3FQXB 5SWSB 4IRSA 4OCMC 4ZT1A 1CFQB 3B3IB 4D2NA 2UVEA 1EHKB 1JZIA 1DUYB 4GIOA 4LPTA 3ULUH 4C8XA 2BVQA 1R3IL 3MBED 5EU7C 4NN7C 4QOKA 2XZQH 2VXSL 4OBSA 4KU1A 3IFLL 4M8RA 5BRZB 3DTDA 1SLWA 2QR0B 3CVHH 5J1SC 2FB4H 1ZD6A 3QIUA 1I3RA 3EXJA 2NQ3A 1TDQA 4EJ1C 4PVMA 1ZEAH 1VFAB 2J8UE 2EDOA 2VDLH 3FBKA 2BNRB 4GS7B 3LRMA 2QADC 4JM4H 4JMXA 5H2BA 3DI2B 2FX7L 2QEJA 3DRQA 4X6EA 1AQMA 5L4MA 3VD4A 1ZTMA 4WRLA 3VRJB 1QBLH 1RFDH 5TQ0H 3BISA 5GGSY 5BV7H 1Z6JT 4DO5A 2FZ3A 2YWYA 3IMRA 4C47A 3EG9B 1EFXA 5ELIA 2H6OA 2EC8A 4JW3A 4R7VA 1PTZA 4MNGA 4HLZG 3DUHA 4QCIA 4RGNE 3L9BA 2WBJD 3I6LE 4KWUA 4GXUM 2QSVA 3LEYH 1MJJB 4ZSOA 1QZNA 4A63A 1AXIB 1A6UL 3N43F 1RZGB 2NUTB 1JNHB 1ZSDA 1L3NA 2HLAA 2OZNA 4EALA 4PBDA 4H8WL 2F6AA 3GSRB 2CDGA 3MCLL 3U1SH 3N6YA 4XNMA 5IFHL 2Z1KA 3QNZB 3SY0B 4UNVA 3U4AA 4FFZA 3K1DA 1H3PH 4Y4KA 2IDSA 2ENYA 4YBQC 4JDTH 2IDCA 5FOJA 4PB0H 2FNBA 4QIRA 3L3OB 3TESA 2HT2D 3B2UC 2GSGA 5DJYA 2OR8A 1NKGA 3V4PA 4X2UA 2E9WA 2G75B 1OGTA 2J57A 5E2VL 2B39A 1EHAA 3HE6D 3CMOL 2EDEA 4PV9B 4A6YA 2YKLH 4G8GB 2RBLA 3O8XB 4RFNC 4GBXA 4Z95H 1SLVA 3OHMB 3FUIA 3P4NA 3CDZB 4LF3A 4H0HB 4NSKB 3WEBA 2H3NB 1JRHI 1QI4A 5HVGB 4GH7B 2AXGB 1X7SA 2YUXA 2OTWB 4JVWA 2VDOH 5A2LH 3OLIA 5IR1A 5CGMA 4G2AA 4Z0BL 3HBQA 1CBJA 1GJUA 2XA3A 1KGCE 4OIBA 1NGZA 5FAAA 3E6FA 3KR3L 2JJTA 5FFLA 1RAMA 1TBPA 4QXUH 1HN1A 4J4PC 5EH1A 3QUXB 1LO3L 3ZDYE 2Y6SD 3CAFA 1MCWM 5E5MB 3VFSB 3HZYB 4HUXB 3P0GB 5KYUA 4JVUA 5BMPA 2R2BA 3GMLA 4GOSA 4HETA 5EIQA 2FWLB 4BH7A 2CDEB 3VXME 2OMXB 4ODUA 4MDIB 3B9KC 1TQTA 2OI9C 1J1XL 4QRPA 3MUGA 12E8L 5B7MA 3MLSL 5J13B 2BHFA 3WJLC 1PLCA 4IOSA 2Y1YA 2OMBA 3KPTA 1AH1A 5I0VA 5H35A 3L45A 2K0RA 2YZ8A 3DIVA 1XR9A 3STZA 3BD4A 2WQSA 2HCZX 2GJ6E 3CZEA 1COBA 3FB5B 5H94A 1EJFA 3FCBA 4LNVA 5IJBC 1QWNA 3V52H 3L2MA 4LVNC 4X6DA 1O7SA 5C0IB 2XY2A 1KYOJ 1MW3A 1T0NB 2VM4A 2BVYA 1UZ8B 3ESUF 3FN0L 5GS1B 4FQQB 3ZGHA 4A2FA 1ED3A 1A4AA 4UB0L 2RJMA 4O2FA 1XF5B 5EDXA 1UD8A 1UVQB 2WSKA 4PWKA 5JYLA 5ILTL 4KTDL 3W0WE 5DVOA 4H25A 5C6TH 5C71A 4PJ6A 4AQ1A 1AC0A 1ZT1B 4V11A 4IGBA 1LEGA 4WDIB 5EU6B 5TH2B 3LVTA 4M7KH 4P4RB 2Z31C 3T2NL 3CFJA 2DAVA 4ODXB 4DF9A 4F15B 1BQSA 4OCWL 4EDXA 1U4FA 2CGRL 2WIMA 5JIMA 1OK8A 1HOCA 2NT1A 4IMLA 4M1DH 3S3PA 5I6KA 2BHZA 4LT7A 5T3XE 4UT7H 5EUOB 5EZLB 1XGYL 1NEUA 4L37A 3V0AC 3BAJA 5FFOA 3SKJL 4HHAA 3ZJAA 1OO2A 1JCVA 1V3KA 2NDFA 4O02B 4PJFB 4WW2F 4XE5B 1VTLE 1TEGA 4JO3L 5ALBL 3QDMD 3M17A 4ZYKA 1RHHB 1PFOA 3GBML 1MFCH 3UO1H 3I3WA 2BFGA 4G1MA 1MFBH 3UYPA 4F58L 4PWEA 5DYOA 1XGRB 4PJ7F 1KJVA 1YY8A 1HSBB 3QULA 4PLKD 4UTBL 4N9OB 5ICYA 1R5VB 2BRRH 5F9OL 1GHFL 2J25A 4OFVA 3TYGH 1WBZA 3NFPA 5D4JA 2B16A 3IN0A 1WTLA 3DXAE 4BKLB 4UYQA 2VMJA 2ITFA 5EOTB 1L3WA 3MRDA 4HKBA 3HZKA 5AEAA 1S9XB 4GNKB 2QDVA 3FL7A 2EKJA 3PL6A 3B5HA 3TYFA 3Q8EA 4M6AA 3SKNA 1KCLA 1XZWA 1ZDQA 3R4RA 2J71A 4HJTA 4WAFA 3TONA 5E2WH 3GMNA 3L1OH 3AQYA 3VB9A 5DFVC 4OLEA 1M2VA 1WA1X 2QDWA 4QMEA 2E6QA 4KUZH 4S11A 1YQRA 3HLAB 4CC4C 2ZP9A 3NCJL 4LPCA 1XV8A 3ZO9A 2PO6C 5I6PA 4L2LA 1JV2B 4KHTL 4L4JA 4PD4J 2FJHA 4PP1C 4LRIA 5SWSE 5I19L 4GXVL 4JREC 4IK6A 4JPKH 5E8PA 3KYKH 1R5WA 5AWNL 3HMWL 5HDWA 2OXHB 1TGHA 3KWWA 2F58L 3GSOA 3U83A 1FNSL 2X70B 2HLEB 5BRZE 2BSDA 1UD5A 4H26B 1U8PB 1CLYL 2G0LA 3NA5A 3O6FB 1R5IA 4N0YH 3QR2A 5EZJA 5EPMB 3EOYG 4MMYB 3C6LD 4J3XA 2BNRE 2DZEA 3MNVA 5GS2H 1GXEA 2R1WB 4HUWB 4EIBA 1KC5L 4QWWD 1VACB 4YDIL 2FSEA 2VIRB 1ASPA 5T5FH 2KYIA 1A6PA 4BQ8A 1MFVA 3CLFL 3IAQA 4FEMA 4JM2F 4BWWA 4OCXH 3NZ8A 5C0JA 1G7JB 2AJUH 5KZCD 4YXHL 1Q9WA 2BNQB 1UM4H 5GSRB 1CVSC 2CGZA 4F7TB 2G60L 3VU2A 3ZXAC 1M7IA 4XP4H 4RDQF 5E0QA 4PJGF 5HYJE 2BPBA 3OG4B 2AJYH 3BRDA 1J10A 1ETB1 1MIEL 1ZA3B 4HHGA 1F8TL 2XWBA 3HUJF 4FA7B 1C9BB 1VPOH 4BFRA 3ABGA 1DVYA 5E24E 2QQLH 3UP6A 4WU5A 5IWLA 3PJNA 5C09D 5E4AA 5AALA 2QVTA 4JFOA 1QW8A 4JUSA 2QR1A 2DRUA 3SDYL 2QKIB 1D7CA 4NGHL 5HDOA 4BIKA 3R18A 4MSWA 4CVZA 2VLJB 1BFOA 1ILSA 4AGPA 5HD8D 2D0CA 3BAEH 1KO9A 1AGFB 1CD1A 2K6WA 4NCDA 2DM7A 3P1VA 3S88H 3KXFA 1ILUA 1XGUB 2MRYA 4LK4A 1T5WA 4G8GE 2QL1A 3QNFA 4R7DA 4G7VH 1A6AB 1HU8A 4XMZA 4Z76B 3PAVA 4GAJH 2PR4H 1F4HA 5DD6B 4PGCA 4YDVB 1WA0X 4PJAB 4DK6A 3DO7A 5FC9A 1B9KA 2NCEA 4AX3A 3QWRA 3AUVA 1W91A 2P7TB 3GIVB 4OJDH 5AZEH 4MNHA 2HLFC 4PY8I 3VGHA 3LZFH 5CZVL 4GP4B 3S96B 1F4AA 4FKEA 4N2EA 2GTZB 3HRZC 2QHRL 4X4KA 2GABA 3B1TA 3IRPX 4IBYA 5IM7A 2CIKB 1R3HB 2WTRB 4CU8A 1L0XA 1HZHL 3ZHLA 3QI9C 3RUGA 1CDUA 4K3JL 3BZFB 4P2YA 4Y5YC 5AVYB 2XUWA 1HH6B 1L9SA 4OUUB 3U4EB 2A9ML 2FECL 1XF1A 1IGYA 1TTBA 2AEWA 3TTYA 1BA9A 4NQCD 1JI1A 3RVWC 1FVEA 1OGAA 2FHBA 3CC5B 1PLBA 1QO3A 4S1QH 1F13A 4Q6IB 1YJDH 1CCZA 1M57B 1JUFA 5E1HB 3ZL2A 3NCMA 2JCCB 4HT1L 3VE0A 4LCWA 1YC8A 5LGHH 4F37F 4MZ2A 4NJ9H 2R0WL 3BVWA 3VD2A 5J6HA 3BH8B 2XBTA 4J1UB 3TZVC 4WVRA 4TTDD 4DUXA 2BVPB 1FJ1A 4KK6C 5CGBA 4PJ9B 3U7YH 1WRFA 3FFCA 4M00A 1X5GA 1TZGL 2DLEA 2EDKA 4HP5A 4NNXB 4YDKH 2V17L 3ILQD 6PAZA 1T03L 4ANVA 2ZP0T 3PQYA 1VGEH 3PWPB 1MVUA 4F9PC 4XCFH 2VQ1B 2QFRA 1PSKH 3EDEA 2NXZB 3KCPA 4TYUA 1OTSC 4X6CA 2E6JA 3ARBD 4AM0Q 3TF7C 5D2LB 2FO1A 2Y9RT 2A9DA 1G9NC 3M7FB 1K4CA 4MGXA 4RA0C 8FABA 1J0KA 2F8VA 3D3VB 2WLKA 2R56H 3BESR 3OC3C 2P44B 3MZTA 3BPNC 2VAAA 3EBGA 4Y2OA 2E7DA 2Y5QA 1IILE 3SDAC 2CJTA 2F0CA 4JX0A 2XPGA 4HWBH 5EUOE 1KTDA 2VAJA 3QC6X 1RKRA 3LX9A 1RZ7H 4JPVL 1UZGA 3S3CB 1T0MA 1OW0C 1J1OL 1EEYB 4PJFE 3GKWL 3I85A 3BZ4B 4M6ML 4YE4L 3SDXB 3NEEA 4HK0B 3I0XA 1TEFA 2EDFA 1Q9OB 4EZMA 5K93A 4YUEH 3APMA 1EJ8A 4JG0L 3ARYA 4UV4H 4UAOB 4EN2A 3SGDH 1IEAA 4TSBH 2HL9A 1DJSA 2ZPKH 4ZUSB 3LQAH 1F90L 2NSXA 3VMOA 2J72A 5E9NA 1DQDH 3SDCD 1KB3A 1MHCA 2ZCHH 2V9JA 4CDGC 4HHWA 4J3UA 5EUKB 4AQEA 1YG9A 2R0KL 4D0CA 3TNNB 2DD8L 1IM9B 2XN9B 3ILEA 4FFZH 4XAWL 5FUCE 2XZZA 4AT6A 2KERA 4JN2A 4L23A 3SQBA 3FT4A 4ZOBA 1B0IA 2C3XA 2CUHA 3GSVA 5JHDD 5GZOA 3OJDB 4XOAA 2E7LC 3NMEA 5BJTB 4WI8A 3CZLA 1CXEA 4L8SA 5CD5D 2KS0A 3ARED 2JPIA 4A7TA 1S3RA 1NAKH 4GW5A 5ID0B 1LWWA 6PCYA 1T80A 2Y4SA 2EECA 3TO2B 1IAKB 4LQFH 1S7SA 1JOIA 4M9OA 5D1ZB 1E6OH 3DRTB 1E90A 1NUDA 1ZY9A 1P5DX 4H8UA 2CKBL 4GUPA 3SO5A 1BQHB 3GPEA 3KJ4C 3F05A 4GW1B 1UKTA 3V4VB 4TRPH 1V5JA 4M48L 4HPYL 1NUFA 4CU7A 3UTTD 1HXYB 2J20A 4HH9B 5AQ0A 1ZLWH 2DKAA 1MFNA 3S36X 1G7PA 1ZE3H 4ENEC 1A7RL 4GW4B 2ZKHL 2R2HB 5D96B 5BZWA 3ZW3A 3B43A 5C08A 2YAQA 2XWRA 2HG5A 4S0TD 4PRHB 4AIZB 3PMGA 2ZCLL 3KPMA 2B1AH 3CUPA 2OQJB 3GLDA 4I0PB 3TJEH 3UPRA 3GBNL 2DLIA 2X2UA 5EN2B 1CG9B 3UPCA 2GCYB 2IDFA 2OMWB 2DQCH 1MCDA 4XP6L 2OYPA 5BW7C 4G1EB 1ECZA 4XVUC 3IJSA 3MJ7A 2DQDH 4JFTA 4NQDA 4DQAA 2WSDA 2BNQE 4AQAB 4X7SH 4S2SA 2JIXD 4QKXB 3HC0B 3HI5L 4R0LA 7FABL 4TVPE 3FJTA 1OP3K 4GO9A 1TZIA 2H1PH 3GLAA 1T2JA 4W4OA 4NQSA 1DQVA 1UD4A 3L3HA 5AKVA 5JQIB 3MOAL 4R6UA 3UAEA 3VU1A 3H9YA 4GG8B 3UTSD 2FBJL 4J3OD 1HHKB 1HJBC 4KMQA 2IC2A 4MXVF 1XEUA 1Q9KA 4Z7VB 3C6SA 4FQIL 1D5XA 4A2GA 5I1HH 1IFGA 1BEYL 1MELA 3O6LL 4D7QA 2Z7WA 4MD5B 3SQRA 2EUVA 1CVRA 1F4XH 1A6WH 1WCBA 3CVDA 2VLJE 3COOA 1QSED 2ALAA 1AGBA 4RX4A 5T1LD 5IW1A 4NO0D 3T0VA 5D7JA 5E6UB 3KPSB 5IYBP 3PAZA 4W9DC 4Y1AB 3QXDB 2BP8A 1IC5H 1G5GA 1T1XA 3ARRA 4FXGC 3TBWB 4NQCB 2PETA 3BIAX 4R97B 4KQ4L 3RL1B 4WKZA 1N59B 2PTTB 3VFPA 4PJAE 35C8H 5TPWH 1FV1A 5DMGC 4FQHB 3C08L 5BUPA 2QPDB 3H55A 2UXVA 1D6VL 1RQ5A 1KPVB 5BS0B 5HPMA 4HPOH 3APCA 2UYLB 5DZLA 3BQVA 5IG7B 2DKMA 2QHLA 3BZDA 5JTWA 2XTLA 3CFTA 3FO0H 3H3BC 4V1DA 1U3HB 4UOW1 1NGQH 2BDNH 2I32A 3MMEB 4P5TC 4Y4HD 1CURA 3I6SA 5A2CA 1FBIH 3F04A 3OB0K 3K71B 4DKFH 5E7FA 4V2BA 3WE6B 4OQ1A 2MEJB 4WUUD 4E9VA 3LOWA 4QRUA 1PW3A 5CBAA 4LBEA 4J27A 4YHNA 3LH8A 2OSLA 1TFPA 2ESVD 1J0IA 5IOKA 1KN2L 5J6SA 2P24A 3ARTA 4FQXA 4PJ8C 2EEBA 3ZRCC 4IU2A 2IVFC 3SGKC 3UZQB 2DEXX 4RRPA 1YPZB 3K74B 1DEEA 1XDTT 15C8L 1I82A 1DBKL 2JCCE 3TIDA 4MAZA 2AXFA 1GZPA 2WIIA 2Q2EB 5INCA 1N19A 1ZLSL 3S36H 3CU1A 4Z7WB 4MCZA 3HC2A 1U92B 1V5SA 4KTEL 2PYFA 3CN2A 5CWSA 3WKPA 3EFFB 4FFVD 4KK9D 5AAMC 2KLSA 5E6IC 1AKJD 2E9JA 3EOAA 1J8HA 1DVFB 4U1SA 3DIFA 2JKJA 4M7LT 1I3GL 3MV7B 4X50A 3DX0A 2K9UA 4J6RH 4K9EH 1MSPA 1OE1A 4YLQT 5I2IA 1ECYA 3PWPE 3TPKA 4F2EA 5C07A 2ZOWA 2J5WA 4BKSC 3M86A 5FA3B 2MQCA 1MCEA 5ITBL 2VLKB 1NCAL 1TFHA 3RI5F 4MS6A 4OKVB 1CICD 3D3VE 5E8NA 3OCIA 1OT2A 2IOIA 3DX8B 4LLYB 3SCMD 3MV9D 4XCCL 3VRIA 3MRKA 2MIZA 3RGVB 1AS6A 1KPRB 2OBGA 3LHAA 4NPKA 4L0YA 4PRAA 2YMTA 4XC3H 2YA1A 3FF7A 1NGYA 3IVKB 1YNKL 2XN2A 5TDPB 3ZL4H 4Z77A 3BZEA 2YARA 3SDXE 2P47B 2VR6A 4KKAC 1CUOA 5IK3B 3BWAA 3HFFA 1B0GB 1KDIA 1AZNA 4HD9A 4K55A 2CKBA 3DV4B 2BP0A 1Z3RA 3QDGD 4OH2A 5JOPD 4ODSL 4KY1H 4KRPC 2X9XA 5IUSA 3REWA 4ETYA 3WXWH 5LKNA 3HNSL 4Y8AA 4N1CA 2YRZA 3CWGA 4BQBA 1VKXB 3RIFK 1SVCP 2GG1A 3JV4A 3EO9L 2Y7LA 3GZKA 1BIIB 3A22A 3ZZ1A 3CFMA 1ACYH 1E27A 2XN9E 3GXDA 2I27N 2WXKA 4LVEA 3ZE0F 5INDB 2AQPA 2YPVL 3CBRA 4RRPG 3UTTB 2D7NA 5KSAA 4LKXB 1F11A 3ISRA 1LE5A 1KJ2H 4EDWL 4F80A 4I48A 1YAIA 4ZPTB 1J8KA 4F3FA 1E9OA 2EUWA 2BVTA 4DKEH 4DGVL 2W9DL 4JUTA 5I71C 1UZ6F 2W1NA 4OFQA 4TXVB 5CINL 5FUOH 5GIRB 4Z7QF 2IV8A 2C7UB 2PWGA 2Y7NA 4P23B 5HHXH 1MJ8H 5E0FA 3LNHA 3LD8C 1T5KA 5E1IA 2Q6WB 4HUNB 3CH8A 4A7GA 1U9KA 2V8MA 3TEXA 4PW9A 3SO3B 3HZMB 3QORA 2NOIA 5EBLA 1PBYA 2EEAA 3KGRA 1FZMA 5DJ6B 1C16A 1I85C 5ESVA 4G71B 2R59A 1MNUL 4JO1H 1FVCA 3KEDA 5FGBA 1A7NL 2XFGB 4N25A 5D7EA 3TBVA 4WUKH 1KCRL 4BUHA 4YMPA 1LK3H 1OPOA 1MXDA 2HKHL 1U3YA 5CS7A 1RVFL 2N0KA 4F8NA 4LOUD 4WHTA 2VRQA 4PRHE 1J5IA 5JORA 5F2FA 1NEZB 1EGJL 4LLAA 4AYGA 1FUNA 1W0WB 3KLDA 2EDNA 3B2UD 1CDIA 1LEKB 2CU9A 4LLVA 3VSUA 1CLCA 3LQZA 3RY6C 1O5PA 4DP0X 2NCMA 1NIEA 4ZFGL 4K5LA 4JJHA 2HH0H 4YSCA 2XWTA 3PV6B 3ZE1F 1JE6A 5DA0B 4BJLA 2IH1B 3C8KB 3MBXL 5T1KD 3GJEB 3D39A 1A4KB 1ADQH 3OKKA 5JXEC 3MRBA 2GIMA 1KCBA 2XNAB 4U1KB 1YN6B 3BUYA 4ZTPH 3QG6A 4O58L 2WGNB 3NJNA 4G8AC 1QFHA 3UAJA 4NXKA 1MJUL 4KXZH 5DZVA 2GAZB 4Z7VE 4CMHC 4QXTB 3FUNA 3OHXC 4A7SA 4K8RH 1GC1H 4AYFA 5FV1L 3WS6C 1WIUA 4Z3GA 5E8EB 2ITCB 2PUQT 3AY4C 3WKYA 3VXSB 2ADIB 2BOCA 4L9LC 4RRPM 2VR4A 4NIYE 1HILA 2YBRA 2D03H 5IMLB 3RKPA 1P5VA 3KPQA 1DDTA 1XF2A 1PVSA 4DP5X 3KPSE 1WISA 1UWGL 3IU4L 3B9KD 4Y1AE 4R8WH 2DI9A 2RFXA 4NQCE 4WI4A 4WSJA 3IAGC 1YMHA 1S7RB 3WNIA 2VXTH 3FU7B 5I6MA 4A7QA 1JYWA 4XT1C 1KY6A 4Q4IA 3G5ZB 4JB9H 4RFOH 2A6KA 2WY3B 3UTZB 1R19A 2VWEE 5BS0E 4R4BB 1H3UA 3RA7L 3RSMA 1MFDH 4IKLA 3Q43A 3DA0A 3GSQB 4YC2C 4YE0A 3GMRB 1DQJA 4QUOA 1HKLH 1Q94B 1T7VA 2Y36L 3WFDL 3M6DA 4KQ3L 3GI8L 1AY1L 2PCFB 3CFEA 1YEGL 4PP2B 3MTXA 4M5YH 4PJXA 4WW2C 3QUYA 4BFOA 1WP6A 4JZJC 4XPHL 1IO4C 1TENA 2QVKA 3U6RA 3T6VA 2Z31D 1RIHL 3NZHL 3BP5B 2G9HA 5T3XL 3DJRA 2J44A 2QLVB 4QTIL 5LBSL 3MV01 4MVBC 2FWOA 5E8OB 5TE6L 2QKSA 4JFDA 1TUOA 2D7MA 1N6QL 4X4ZA 2H9GB 1YPZE 2EDHA 2LE9A 3K8MA 1P7QD 3CSBA 1KEGH 2AJSL 5E2WL 3A47A 4UIMA 3MLTB 5I8EA 5C7XL 4GKNA 4Z7WE 5DHMC 5IW6A 1V27A 2HRPH 4UDUB 1MXGA 1QUNA 2HZHA 1WFTA 3FHQA 1BMGA 1U93A 4HS3A 3CWUA 2J56A 4H8VA 5CILH 1OF2A 2ZF8A 3C60A 3IGFA 4WJ5A 3LS4L 3MV7E 4X4XA 1KBGH 4ONOA 1DQLL 3D7QA 3BP4A 5CZKA 2FT6A 1HC1A 1M3IA 2NOFA 2ZCKH 2VLKE 3HB3D 5F70A 4MMXC 4XVTH 2J8UA 5T33L 1AP2A 3BOVA 4MB4A 1T83C 5HI5C 4Z23A 3P9MB 4NN7B 1DCLA 3IDNB 2YPVA 1XFPA 2V33A 5KVDH 3K7UA 3HG4A 5CJOL 3P77B 3RU8L 4DHLA 1G0YR 5L8JB 5DJ2B 3PE9A 4M5TA 4YDJA 3MX0A 1P6WA 5DFVD 1OP5K 4YBLC 5GXBB 2IBZX 3CPUA 1UD6A 2CDFA 4P05A 2CO2A 1I1AC 4PGZA 4PG2C 4QRRB 5A2BA 2PO6D 2QADB 2Q8AH 4RIRA 3ZDZB 5I0DA 1N64H 3D9AL 5TF1L 1RJLA 1E4WL 3JUYA 4LVOB 2X09A 4FA6A 3PHSA 4I7ZC 3N9GL 3HN5A 3RWDA 3T4AA 4CC0A 5DZ9A 4M8QA 1T1YA 4AGMA 4JM2C 1KTLA 3RBSA 2FBOJ 4Z8FL 4KK8C 4MNQB 3T5WA 3DNKA 1BLIA 5DUML 3MLVH 2NZ9D 3NP4A 4LE8A 3KBHE 1FDLH 4PV8A 3MLUH 3APDA 2OMYB 2FEDC 2NDGA 3UTTE 2A2QT 2DWSA 1S7TB 2XWEA 5J9PA 1NH2A 1R4XA 4DEWA 2VGLM 4ONHB 1N68A 3JZ7A 5LQBL 3R0NA 2EEXA 4PBVC 3T08A 1MQKH 2R4RH 3GHBH 3JSSA 1S9KC 4LU5L 5A3IC 1T2XA 2I85A 5IBTH 5GZNA 1N8ZA 1O7DC 4FXTA 3T77B 4NQVB 4G6KH 5JW4N 2Z0FA 3EAYA 3NIDB 5E56A 1H6UA 1WO2A 2J5LB 4IMKA 4L3ED 2FLMA 5EOCJ 2BMKA 4EI5A 2DQEH 4KRLB 4RBPH 2DPKA 1U8JB 4JFXB 1FZJA 1U3NA 4N0RA 4N3UA 4KVCH 3U9WA 25C8H 4TQEH 1FH5L 4I1NB 3JTSB 5GGRA 4HVBA 3RGBA 2DYSB 4IBSA 3GM0A 2EE6A 3CZFB 5HGAB 4PR5B 1G84A 2WWMD 3NA9H 4ZDHB 5TE4H 2CBTA 3VXMA 1TF4A 2J2ZA 5IBUG 3ULSA 3UX9B 2AQRA 4G5ZH 4EN3A 4NRXA 5TGBB 4CVWA 3P4OA 5B8CC 5E4EB 3LH9A 5EZOL 3QPQC 4OIIL 4OTXH 5DMIH 3X1FA 4K3EH 3DX9B 3S5LG 2VYRE 1SEBB 1E5AA 2O30A 3JTTB 4Q0XL 3MA9L 1DJZA 3OSKA 2YGQA 5DJ8A 4MQXC 1F00I 2GJ6A 4Y4FA 5TDNA 1Z0NA 4LHUA 4OZ4B 4Y9CA 1AR1C 1II4E 2WQXA 2XVLA 5IVXF 4AEIL 1G7HB 2HLFD 1KGIA 2VZVA 3IXTB 5FW7A 4C7PA 2R9HD 4R4FL 3X2QB 4AH2B 4EXPX 1P4LB 3V5KB 4XTRC 5DQDH 2UVFA 5DD5H 2X3BA 1TZOA 3QI9D 4XPGL 2XRAL 2XQBH 3QEQD 5DD1H 2TSAA 1NGXA 4P2OC 2C1OA 1D2PA 2SEBB 1SZNA 1EBPA 4K15A 2EVIA 1MN4A 5AB0A 2X6UA 1E50A 1RSYA 3RTLA 3Q05A 1NFIA 3A6BH 1YQKA 2Z6FA 5CSZB 4H40A 3UDWC 5L6YL 1IMHC 3U0PB 1GTNA 3WIHH 3OLGA 1N67A 5IVZA 3MXWL 5LBSA 5LNEA 2WVVB 4DKDC 2LU4A 4BE6A 1OEZW 1PYWB 2MQGA 3MRRA 4JFHD 5SWQA 3N1MC 4BH8B 1MFMA 1VJSA 2M26A 3EDDA 2Z31B 2A1WH 2ESVE 1T3FA 1U8LB 2AGJL 2YQ3A 3PXJA 4G6JH 3QG7L 3VDBA 4U0RC 3WHXA 4G6AD 4M4PA 2EXWD 1C1EH 1ZA6A 3L9EA 2IWFA 1FVDB 3HNVL 4FQ2L 1NMBL 3TZVD 5I0WA 1OAYH 3GMMB 2VDKB 2YMXH 3EZJB 4FP8H 4L8BB 4KK6D 4IK7A 4I9XA 2YEZB 2YAEA 4YHLL 1GAFH 3KWTA 3DV6B 1ORSA 2QZ5A 1NLDL 4JFZH 4LPXA 2QSTA 3ARDA 3DXAA 3RX9A 4DESA 3Q6GH 3TEYA 4ORGA 1Z3GL 4DN3H 1IGTA 1DQDL 1OCWH 5HI4D 2VR8A 4G8IA 2XV3A 2WNKA 3FCSB 1OTSD 1GW6A 2Y7OA 2D0GA 5L88H 1D7BA 4K9JA 4P5KA 2X10A 9CGTA 1SM3L 1FFPA 3K91A 1J5CA 3QDJD 4IRSC 4JDVA 4OD1L 4P2RB 4O02L 3O11A 3H2PA 3QZBA 3QRGH 4OGQC 2O61B 3SDAD 2DQGH 4CC1A 2ZG3A 1KB5B 2OR9L 1NLBH 4K94L 3CQFA 1MWAL 1WITA 2UY6B 5SWSA 2LFGA 3WAKA 1CFQA 3B3IA 1DUYA 2MJ7A 3SE3C 4GSDL 1TCRB 2EDTA 5JIIA 1F3DH 1OP9A 5IBLC 5AOMA 1PX3A 3NJGA 5AENA 5FEBA 4U6HB 2J88H 2MQ3A 5BRZA 2ZP8A 3WIFB 2QR0A 1CGYA 1KCWA 4JHZA 2IGTA 3GRBA 3L3KB 1EMTL 4JREB 2HB0A 5E9DD 3VXPB 1VFAA 3HBZA 5I6NA 2BNRA 3C5ZB 5EU7E 3T0BA 4FHKA 4KK5C 2EDJA 4ES8A 4NDMB 3KVDD 3V6ZB 3VRJA 1O75A 4ZQTA 3FO1B 4NUGL 4F5CE 1A3RL 1RZKH 2A6IA 1HESA 1ADWA 1VFOA 2L7UA 3BSHA 1IBGL 5AG9A 5JXAL 3EG9A 2OOYA 4HU8A 2JK5B 3QJFA 2IG2H 1OB1A 1A4JB 2OR7A 2YS4A 1MRCH 3S3BB 5DFWH 1KN4L 2OJZL 4BZ2L 2VSMB 3AWEA 4AE1A 3RDTC 4QRRE 1AZZC 1G1OA 3OPUA 5CMAB 4GMSL 4PMFA 4LLMB 2IGLA 2Q87A 2HZMA 1RZGA 3SJVD 1I9RH 4ETQA 4Y4KC 2NUTA 1JNHA 1OGSA 4JPSA 4A7GF 2B14A 3MJ6A 1TNMA 4D3CL 3GSRA 3RILA 5IHZA 2NY1B 4X5PA 3QNZA 1FGNH 4MNQE 4OV6F 3SY0A 4L3EB 2JKXA 3VM5A 4LOVA 1WIOA 3AM8A 4ENED 1IAIL 3D2UD 3F7VB 1I8IB 2QJDA 4GBXC 4XCEB 2VSKB 2H32B 2NVMA 5FM5O 5JW4M 5DK0B 1XB8A 4U3SA 3LN5B 3EYOB 2W92A 3P30H 2PMZA 5IHWA 2HFFB 2G75A 4QDGA 1B88A 5FO8B 1H6TA 4PV9A 3FU3A 4G8GA 4KX7A 3O8XA 1HYSD 4N5UA 5E2UH 2YZ1A 4BQ9A 3CDZA 1CLZL 2YD3A 2JJTC 4TVPL 4NSKA 4YHPA 1URZA 2H3NA 5FWRA 3MODL 2DM2A 2YD8A 3WE1A 1Y07A 2IBZY 5JDJA 1WYJA 4YXKL 2AXGA 4FI7A 4KXZI 1E43A 2OTWA 2BH0A 3NIDE 4I3SH 4UBDC 4NWUL 4AL8H 4M5ZH 2YGVA 4OF8A 5CIPH 1JZ7A 1A1NB 4BELD 4NIKB 3QCVL 3LYRA 2YA0A 3QUXA 3GZPA 2BRQA 3IGKA 2NNAB 4IIQC 5E5MA 4IRJD 3HZYA 1VENA 4HUXA 4ABQA 2YBGA 5I8KH 5DEGB 5IESH 1MIML 4P9ML 4GQRA 4XR8C 1BECA 4GP8B 3AG1B 4TQIA 4OCSL 2X4PA 3WKMH 2PPCA 2CDEA 4NYLB 4HJHA 1PCMX 4CDHA 2BIPA 5I6LA 2OMXA 4CVUA 1TO5A 2DIAA 4MDIA 5IZ7A 1FRGL 1H9DA 5F0LB 3UJIH 4QNPE 2GBTA 1NDGB 5HVHB 3KAAA 3E3QC 3OKMB 4I4WB 2JI3A 9PCYA 2GY5A 1NWOA 1F1GA 1IGCH 5DD0H 4ZX5A 3WG7B 5HHQB 3ERXA 4H88H 4BHUI 4JHAL 4M29A 4A39A 2BHYA 5GRVK 1LVEA 1AO7D 4AQ1C 4P9HH 2K4WA 5C0IA 1T0NA 1T4KB 3GRWH 2OZ4A 1I8LA 1V10A 2W81C 1UZ8A 3DHUA 5GS1A 4FQQA 1JHKL 4GAGH 3EH2A 4XBPB 2WUCL 4TNVK 1NCBL 1M2OA 1XF5A 4L1BA 1OV8A 1IGFH 1UVQA 2B9BA 3CJJA 4F2MB 1OT4A 4TOYH 2IGFH 5I1IH 2C9AA 4EEEA 3BDYH 4UQ2A 4ENZA 2YRLA 1ZT1A 1USZA 4P5TD 1AQKH 3AG3B 1NPNA 4WDIA 5EU6A 5TH2A 2A9AA 4P4RA 2GUOB 3H2WA 5FB8B 3U2JA 4CILA 3VXTB 4ODXA 2VDNH 1G94A 4PJXF 2YXFA 4C56B 2X38A 3CFUA 3LPFA 4HK3J 3U4BH 1OF0A 4MQ7B 4RWYL 1F18A 3GJFH 2Y06L 1KXQE 1ZLDA 5EUOA 1Z9NA 5EZLA 4MJID 3M46A 1YEJH 4O02A 1Q38A 4L18A 4ACTA 4QJ4B 4POZD 2XJKA 1OCZB 2HVBA 5EA0H 2ZUXA 1KFQA 4FFTA 5EO1B 3P4LA 1FLRL 2EDMA 1U42A 2O5ZH 3UJTL 1L7IH 1RHHA 2J4WH 5JW3H 2OYLA 4Y16D 3WJJC 4XVSH 2QRCA 4Z18A 2WN2A 5HI3C 4FS0A 5E4IA 1HSBA 3VD1A 1LD9A 3AITA 5C0AB 3S8FB 1ZPLA 2DS4A 4PWIA 4JFED 3FU9A 1JXJA 2W0KA 3PL6C 1WAAE 4JY4B 3L3JB 3IPFA 4AG4H 3W2DH 4KKCC 4BKLA 4CAGA 3D85B 4J3VA 3VVVA 5DJXB 1CE1H 3QQ3B 5EOTA 4W6XB 3MDJA 1S9XA 5ENWA 3DHMA 1ETJA 1JHLL 2R29H 4FYTA 5MENA 2CWRA 2X28A 4OLXL 5B22A 2J8UF 1CF8H 4M43L 1JK9B 4LRIC 3QHFH 1GR7A 5ES4B 2FX8H 4P2RE 3IRCA 3SKOB 3P2BA 1M56B 2ZD0A 3HLAA 3ZRSA 1PJ9A 3DX6B 1JV2A 4FF9A 4M03A 1I1RA 2OP4H 1UOVA 3LSOB 4H8WC 4I8OA 1N9PA 2ZX6A 5HHXL 5F6IB 4KKAD 5A7EA 2ICWI 5E5LA 2C9RA 2OXHA 4L9DA 1BZOA 5F6HI 1NIDA 3SZ6A 4DVRH 2X70A 2NOYA 4KRPD 1CPUA 4PRNB 2P43B 2J1WA 4H26A 1U8PA 4JGMA 4P3WA 1MG2C 1DBAH 2CO4A 4WHCA 3V0EA 3O6FA 2G4EA 3Q1SH 4XPFH 2NOZA 5MEOA 3TV3L 1CGVA 3QEGL 4HJ1A 2CK0H 5EPMA 1K8DA 4DAGH 3QS2A 4MA7L 4MMYA 5F72S 4UM8A 4D7BA 1ZPUA 1IQWL 2R1WA 4HUWA 1VACA 2VRAA 5DS2A 3KPRD 2VIRA 3DOIA 4JO4H 1RUML 1L6PA 5HGGS 1XGTB 1G7JA 3SNSA 2NY5L 3NYKA 2BNQA 4R7NB 4PJDB 5GSRA 1T0PB 3ULUD 3Q2VA 4PY7B 5CN3A 3BUTA 3BE1H 2F9BT 2DW5A 2B1HH 2HT4C 1BIHA 5IWLC 4XN8A 3RL2B 3V8CA 1MHPL 3ISWA 1BM3H 4M8VA 3CHQA 4FG4A 2RQEA 2ZSWB 2XCMC 4OFPA 1ZA3A 4DO6A 3DJSA 2A9CA 1NIFA 4LEXL 2CE6A 3H6JA 4WI5A 4D9QD 4JANB 5FM4A 4RETB 1ZVYA 4K2UH 2CALA 2N4IA 5DJ0B 4D9LL 2QKIA 1SMDA 4URTB 4L3EE 5I15H 5DJZA 2OK0H 4KAQH 3SKUD 2K78A 1UC6A 1XGUA 2VJ0A 2W88A 4YQXH 2EIMB 4YWGH 3EW3B 3I9PA 3HG2A 4RMUA 5ECGA 3LY6A 1FN4B 4Z76A 1BFVH 1ZVSB 1TQCC 5E08L 5CCKL 5DD6A 5FWQA 4PJAA 4QEGA 1JL8A 1RUPL 5KSVB 4W6YB 4OV5B 1A7QH 5K9QG 1YY9C 2P7TA 4JKLA 4OD3H 3GIVA 1OWRM 2VXTL 2WC7A 1OPGH 3IU3A 1JZFA 4MS8D 2MTPA 4OFDA 3S96A 1MI5D 2GTZA 4NKQB 1K3IA 4JFUA 2F74B 5TDOB 3G6JB 1TJHL 1R3HA 2CIKA 2WTRA 4FXGB 1MCHA 4R2GC 1OD7A 2WXHA 2VDMB 1JWSB 4LVHC 1SBSL 2HTKC 3BZFA 3KH3A 1HH6A 4L8CB 4OUUA 3U4EA 3N40P 3CMGA 4OY9A 3DTUB 2WKOA 2EXTA 4KVNL 1U6AH 3PUCA 1Z9PA 2I69A 3HG0A 3CC5A 3DKHA 4MX7B 4NWTL 3WUZA 4NPYA 2F19H 2FR4B 4OJAA 5CCHE 2F7IA 4FQLH 2AVFA 1T7XA 5ETUB 4Q6IA 1RCYA 3N04A 3TVMD 3ZZLA 4Z7AA 4KKNA 3SDDD 4OZHB 5J11C 3JYCA 2JCCA 5EF1A 3N41B 2G0KA 3A0OA 4M1GH 4HQQH 4BYHA 1HU0A 3RVUD 4W9GC 2R51A 5GGVL 1MDTA 1UA6L 4KO7A 3I6GB 3L2LA 2LVCA 1QFUH 2V9TA 2F7OA 1MRFH 3BH8A 3MLYL 4J1UA 5I0XA 1G4MA 5E6ZA 1UWEL 2BVPA 4PJ8B 1HT6A 2E76C 4FJYA 4PJ9A 4F7PA 3RPJA 3K6NA 4DQOL 3V9FA 3VACA 1ZLEA 4NNXA 1N3CA 1MF2H 5E51A 4F2ME 5IHBA 4ZMVA 2IH3A 2VQ1A 2D4DA 4PAZA 3QO0B 4S1RL 3EBIA 3KDMB 1AXTH 4PVBA 4F57L 3DDFA 3MLXH 5D2LA 1CLVA 2CPCA 3VI4B 4AZUA 4E9QA 5CFAA 3ULVL 1MREL 5E6IB 3D3VA 5ICUA 2ZKXA 4BINA 2PPFA 2W9EH 2CLZB 3CXHK 5BMFL 4C56E 1DYZA 1WSST 4Y7MA 5L7XH 2GYSA 3ELQA 3EH4B 3T6XA 3QRBA 1ZGLB 1IE5A 1I3VA 4MVBD 4P59L 3QZOA 3VQ2C 4WI0B 3UAAA 1CDHA 3I9IA 4WFED 1EEYA 3EFDH 2PR9A 1KJ3H 2O6FA 3BZ4A 2BW5A 4B6ZA 3SDXA 4OVUA 1Z1WA 3GGWA 5F7DB 2OA9A 5FO7B 1Q9OA 3QIWD 3POHA 3KLAA 3KLKA 4YSEA 2DI7A 5JIPA 1JYVA 5IB5B 3F7KA 1IL1B 1DQKA 5F3FA 5C0AE 4KDWA 4ZUSA 3M8OL 1ORQB 1DJHA 3RWFA 3LRGA 4J39A 1CE6A 4PRBB 5GZOC 4ZPVB 1IAIM 3F6JA 2F5AH 1HINL 2Z3FA 5I73C 3TNNA 4L8SC 2XN9A 4OZGF 1AHKA 1CR9L 3SN6N 1PG7W 2HJFB 1ZV9A 2BIMA 2VABB 1YEKH 1QNZL 3KWVA 1E6JL 3HNTH 3OJDA 5HI5D 3K8LA 1NCCH 1FAIL 3K2UH 1N10A 1KIQB 5BJTA 1B9ZA 1R3LB 3F64A 5IMKA 4D9RE 2XG5A 3F10A 5ID0A 1TSHA 1X3DA 4LNRB 4NKDB 3TA3B 1IAKA 2WD0A 3TO2A 1C08B 5D1ZA 4HWEH 3DRTA 1F58H 4XB3A 2WXPA 4M61B 4KHXL 1TMCB 4GRLD 4LL9A 2DM3A 1BQHA 1QW9A 3IGUA 3Q5OA 1Y6KR 2CGYA 4GW1A 2LLGA 1B6UA 4ZRGA 1SY6A 2OL3L 4F1SA 3V55A 1A25A 5I30H 2GY7B 1A9EB 1QHQA 4UT9L 5C0RH 5SX5H 4XNAA 1KB9J 1JZHA 3FU0A 4HH9A 4OIFA 3VTAA 3U2SB 1IKFL 2F68X 1PY9A 3GTVA 4GW4A 1PCJX 1BZ7B 2R2HA 3ZE2B 1OZUA 1AOHA 3NFSL 1PLGL 1LNUA 4FTVB 1GA2A 3SJVE 3ARGB 3MCKB 3UEQA 4PRHA 1CXIA 1HX0A 4N8PA 1SEQL 1IKNA 4G7SB 4P5MB 3RAJL 1QN9A 1AG0A 2OQJA 2RB8A 3VTMA 4WCYL 4R0LC 4N5ED 5EN2A 2ZJSL 1CG9A 4E9SA 2PTUA 2OMWA 1H15B 1KLGB 1KCSL 4YSDA 4G1EA 4W4OC 3LKSA 3H0TB 1MLCB 4KO5A 1KXHA 1DVZA 2AQ2A 1UGKA 5EEUA 3PHOB 3GXFA 2AZUA 4PJDE 1YQVH 4AQAA 5GSVB 3HC0A 1TYRA 2K1MA 4UT6H 2XXGA 5LCVL 1MPAH 2JELL 4GRMB 3LMJL 4HZAA 1MFEH 3AS3A 2OZ4H 4YHOL 4IBWA 4GG8A 3KS0H 3RNKB 5LNDA 2AXJA 4A2HA 3D69A 2O5YH 2WXMA 2HVJB 4NKOB 3X1BA 2YFOA 5F9JB 4Z7VA 5L88L 4KPHL 3P4MA 4XRCB 5EPCA 5GGQH 1WA2X 2F7RA 1KFGA 4KVPA 5GS2D 1YECH 2ZAGA 4LGPB 3CQPA 5D7JC 3TC9A 5FYLE 4MD5A 5IFAH 1NAMB 2NNRA 2XVGA 5ADOL 3A67H 2A4ZA 2WHVA 4QO1A 1CBVH 1SF3A 5IF0B 3FMGH 5F1NB 2XV0A 4OLYL 1WZMA 1ZSHA 3KPSA 3SD5A 4CMHB 2C9UA 3OHXB 4Y1AA 4WGVB 5DRNA 3S3SA 1A66A 3TBWA 3QPQD 2WLJA 4OFYD 3RL1A 3VFRA 1N59A 2PTTA 1BQHG 3SOTA 1INDL 1ZK9A 4JHUA 3RJDA 4MZRA 5ITFB 2OCCB 2CM6A 1YEDB 1CFVH 1RJYB 4MDRA 4PRPD 1ZJAA 1KPVA 5BS0A 3G6AB 2WO2B 2KHAA 2UYLA 1C5BL 3GNMH 1AR1D 5KW9H 1Q0XL 5IROA 4ZNCD 1O9VA 5IG7A 1UWXH 3G6JE 5BO0D 3CDCA 4WFFE 1U3HA 2R83A 4HMCA 1PLAA 4ZUVB 2WXOA 3MMEA 1Q1JL 4MAYB 4FQXC 4B96A 2EABA 3U79A 3K71A 4W9LC 3H3PH 4XTRD 3WE6A 1YEEL 4Q97A 1QKZH 5JHLH 2ALWA 3HHRB 3WMPA 5DMKA 4OFIA 2WZ0A 3VI3B 4YC2B 4QXGL 4DN3L 1IC0A 3G9AB 1Z32X 2H2SC 3CD4A 2G5RA 5MEPA 3BGFC 3UZQA 1VZIA 5F9AC 3B8YA 1YPZA 3DO3A 1D5BB 4KNUA 2FQDA 2VN5A 2ZKMX 5CKGA 5LG6A 3VD0A 4WW2B 3IJHB 4FLSA 2V2WB 4JZJB 4FFYL 4LKCB 5EUOF 2IADB 2MJWA 1U92A 1JTOA 4HXBH 3VJ6B 1LQSR 1KCUL 2O5NA 4PJ7B 3D08A 1DVFA 3ENCA 5DHVA 3VG0L 4PUBL 3MV7A 3P2TA 4U6VL 3R0MA 4KI1A 3MJWA 4PCTA 1N4XL 1A6ZB 5DHXB 1KTCA 1V05A 5FA3A 2J88L 4YSAA 3IBOA 4WNSA 1B6DA 1UB5A 2ZUQC 4R26L 1CFSB 2ORBL 4UQAA 3VH8A 3DX8A 4WJG3 1H0DB 4LLYA 3D8MA 2R0LL 3APFA 4NP4H 5EG6C 2QVIA 3RGVA 1KPRA 3T9WA 3TL5A 4HC1A 2XWXA 3MCYA 3TXAA 3IVKA 4R5XA 1AZBA 5TDPA 4OCYH 4QOKD 1E4XL 2N1KA 1HWHB 2YD1A 1KELL 5IK3A 2FNWA 3EOTL 2APFA 1B0GA 5AAWA 1Q0EA 3NJVA 3DV4A 3T4YB 3QIUD 2V3DA 4WO4A 3FUEA 5IBLD 3ATBA 5KBNC 4KFMA 5FHBH 4FXKB 4YBLB 2Z8VC 1F4WH 1I1AB 1MCLA 3I3DA 1RMFH 4MA3B 4OLZL 1BIIA 5INDA 3GINA 3RWGA 3GMPB 2YQ2A 4HXAH 3EF7A 3DGDA 4LOFA 1X5HA 4JEGB 5I6OA 1IC7L 3BGMB 1RJCA 5T8IA 2XZAH 3JWOL 1EFXD 3J27A 4PY8J 1GGIL 4ZPTA 1Y1DA 2NTFB 4JM2B 4YR6B 3RVXC 3LXCA 4LEOB 4N24A 3FUHA 4KI5F 4E41D 3QORC 1FIEA 1MRDL 2BK8A 4A68A 1WZ1L 5GIRA 3JWNH 2C7UA 4P23A 1YEHH 5E5RB 2BHUA 5D71H 4QJ5B 1FORH 1JSYA 1KEMH 3MRCB 2IPKB 3MYJB 4KX9A 4QF1A 4B9FA 1F56A 5FGBC 4PJGB 4ONFH 5TFSL 5I16B 2Q6WA 1BJ1H 3HUJB 4LARH 1EPFA 3HZMA 2XBZA 1S5HB 2K3HA 3BPOB 3SGEI 5DJ6A 4HUKB 3OSEA 4Y4KD 2E27L 2A6DB 2Z65C 1LE9B 3DK0A 4PGDB 5DURB 3QAZC 3WENA 3TT1L 3ZE2E 3BI9X 4FTVE 5DFTA 5E2JA 5FYKE 4TSCH 5CSBA 3VH8G 2VL4A 2FHFA 1Z9SB 2H0JA 3NTCH 4JNXA 1OP5H 5AVRB 4PRIA 3O9WD 3UTPD 1NEZA 4GBXD 2EO7A 4P48A 4X8CA 5F96L 2HUHA 3JVFC 1RLWA 1W0WA 4HJJH 1LEKA 2I07B 4HBQA 2B1OA 4XB8A 1DHKA 1FZKA 3WDIA 1MFUA 1XR8B 4TUOB 1GH7A 5BMNA 2VTFA 2Z91B 3PV6A 2FIRT 1K6QH 2V3FA 2WVUA 5F7LB 3UAJC 2FATH 1X7QA 2IH1A 3C8KA 2Y7SA 3KL5A 4GMTH 3GJEA 5DD0L 1NZRA 4WENB 3ES6B 4TQHA 1A4KA 2QSQA 4LEBA 4PJAF 4WI2A 3C5XA 1SLXA 2X4OB 3BKCL 2VJ8A 2XNAA 4UBDD 2F8IA 4E0RB 1NMAH 2BOBB 2DQHL 3LCYA 3UBXB 1DVTA 3V0FA 1IEHA 1RZJL 2GAZA 3B9VA 1MQ8A 4JRFA 4QXTA 4NZRH 2CLRB 4UYPA 1CGSH 1QHOA 3V4UL 1U4EA 2E9IA 1INEL 5MEQB 5E8EA 2ITCA 3BDYL 3TIEB 2RD0A 4QRPD 2ADIA 3VXSA 1X5JA 5F0PB 1WTGT 4TTGA 4E9XA 2XT1B 4CN4A 4IOSD 3ZKQD 3BLKA 4BKTC 1OAZL 4XP1L 1A64A 3JYBA 3VRLE 2IH8A 3NH7H 4AIEA 2HPOA 1LDPH 3J2PA 2FAUA 2L7QA 3U4BL 1X5IA 5I18H 4RISL 4M4RB 4OLWL 1S7RA 1H8NA 4P2OB 3FU7A 3LXBA 4XHQA 5HPOA 2NZIA 3UCQA 2AEQH 3G5ZA 2YUZA 1SXBA 5AW0B 1KG0B 2C7FA 4PU2A 4FFYA 2NY3B 1L4IA 3L6FA 4N3TA 2Z8SA 1F4YH 2O5ZL 3QUYC 4YO0B 2JKTM 1JZEA 3GMRA 1IUZA 4PS4L 3H42L 1Q94A 2HAZA 4IGBD 2E75C 4M7JH 4WWPA 4GJTB 3R7RA 1FO0B 1R24B 1Q8MA 4N28A 4P2QB 5IMOB 2GBAA 1OVZA 3NFNA 1O9ZA 2PCFA 4PP2A 1NEZG 3RWEA 1K5WA 3QT2A 1G43A 2Y2YA 4N87A 5DU7A 4K3HA 2Z0UA 1KTJA 4AIOA 4HV8A 3VI3E 2MOVA 1WGOA 3BP5A 3WTUA 2GUYA 3O3BB 4JG9A 5D2LF 3DSFH 3MRQB 3OPZL 5E8OA 5GJSL 1GGTA 1JERA 5CR1A 1ZHNA 1NL0H 2L04A 1VADB 3CVSA 3B2VL 2WLHA 4KGLA 5F3BB 4M93C 3EGSB 2VC2H 2QQKL 3MLTA 2ZKWA 4K73A 2J6EH 2CO7B 2F1EA 4UDUA 2VDKL 3HMXL 2X89A 3OWRA 2VM3A 4PJ7E 3VA2C 2BSBA 3CU7A 2Y8QA 1A5FH 5HI3D 1S7XB 2A73B 4IRSB 2XX0A 3V4VH 2EZ0D 1S9YB 4HF5H 4JDZB 1B4JH 2YN3A 3P02A 4TLSA 3PL6D 2O5XH 1QN8A 1BXUA 4IJ3C 1CF1A 1QPXA 3U2IA 4DOHB 1JTPA 3IBEA 2UUDK 2VDRL 3P9MA 1WFUA 4PS8A 4K3DL 2CBPA 3IDNA 4XPFL 5HBBA 4RGNC 4BFKA 2Y0SA 3P77A 4KZEH 2XPYA 1LDSA 2F1BA 3HS9A 3KPPB 5H2BB 4F5CA 4DGYL 2Y5EA 2APVA 1KB5L 3GSXB 4H20L 1E7UA 5DJ2A 4JN1H 4DCQB 5F0MB 4M6NH 1FPTL 1RK7A 4WW1A 1M7DB 3DJZA 1YUKB 3KNBB 3T4AC 3OAUH 3SBWA 2F61A 3NRFA 2MWCA 1EFXB 4QRRA 3KPNB 4MNGB 4QCIB 4XMUA 1P4UA 3TASA 2B1HL 1SHSA 3CK0L 3OMAB 4H0GA 3E1F1 4JHWL 4K7PX 3UIZA 4G82A 1I8MB 1RHFA 3ZKND 2QBWA 3Q2LA 4ANWA 3NABH 4MJ4A 1OSZA 4LL1A 1LWYA 3ZQXA 1HXMA 3V0VA 4MNQA 3QAQA 1RH8A 4U1NB 1KXVA 1BZQK 4BE5A 2IF7A 3QNYB 3RDTB 2CDGB 1W6WA 2D0HA 1HI6B 2OMYA 3O6ML 4WFGD 4NZJA 3DPTA 1S7TA 4HEPG 5GZNC 3U0WH 4ELKB 4ONHA 2X05A 1M3JA 4HCIA 2LT9A 1U91B 1Q72L 5PAZA 1YEIL 1FHNA 1OAKH 2Y5TB 3ZT5A 4EJYA 4EI5C 3MREB 1KYFA 4TLKA 2AI0H 2FSDA 1GGBH 1KXTA 4B9YA 3T77A 1KBKA 4NQVA 4EAIA 3NCBB 1VIWA 3PXLA 3NSFA 3MLRH 4PJGE 4FFWC 5TTRA 1MKFA 3HUJE 3F58H 3PWNB 3QJUB 5IR1B 2X2HA 5M7QA 1U8JA 4JFXA 1HZKA 1S7WB 5T3ZL 2WANA 3E6FB 4MD4B 3U30C 4CW1B 3ESNA 5B38B 4OUOA 3JTSA 1YO4A 4EN3C 1MLBA 1O7DE 5I75B 4NM8L 2OTPA 2WYZA 3OKEB 4XNDA 3T71A 5EU3A 5ACZB 4PR5A 3JQOB 4L5FL 3KXFD 3QUGA 4ZDHA 1H3GA 1T1WB 5AW5B 2HFTA 5CEZL 1EUTA 1X5ZA 4J4PA 1B2WL 2G5BB 4DPBX 4G7QB 4Y4FC 3SKMB 5L0QB 3W5MA 3EIFA 1ZTXL 2VDQB 4AZ8A 2DKDA 4IIQB 1SDDB 2AQSA 2CNZA 2HX8A 3QWRD 3DX9A 5GHWH 3T2QA 4AJWA 1QP1A 1HE8A 1SEBA 3P0VL 1LTXA 1UT9A 2BP5M 4OGXL 4M1GL 3L5HA 4OZ4A 1OTTC 3FHAA 1DTUA 3EHBD 4WEBH 4JPQA 3PXHA 2C9SA 2WLNA 1G7HA 4YHZL 4LB8A 4R83A 5H4YA 4KRNA 1I1FB 2X4NB 3S34L 3PABB 4AH2A 3AT9A 3WJLA 4AQZA 1KCVL 1P4LA 4L2YA 1FL6B 4I87A 4FLOA 4NNPL 2OMUA 4LLDB 3V5KA 1SHXA 4R2GD 1OGAD 5A6IA 2DTSA 1DIZA 2DB8A 1ZHKB 2XC8A 2HTKD 5B4MC 5F7EH 3HG1D 1UCTA 2NTSP 5DVNA 4U6YB 3WNPA 3QYNA 5CZXC 4LCWD 5CSZA 1QFWL 5K5YA 3VMPA 1TOXA 3U0PA 2YQGA 3WEOA 1LWJA 5TE7H 1OTUC 1BYPA 4MTMA 3ULVF 2VQ4A 2XWDA 2WVVA 4K7PH 1HOCB 4AEHL 1PYWA 5D2NB 3UBGA 3BQUC 4HC1H 4LASL 2HTLD 4GQPH 2EDQA 4BH8A 5ALCH 5K9QI 4Y5XA 1CL7I 3L7EB 5EORH 4CGUB 2VITB 1U8LA 2WYTA 3WFBL 5F88B 4HHAB 3FFCD 5D1XC 3D4YA 1QG3A 2A5UA 5F7HA 2PPEA 1FVDA 1P4IH 5I1CL 1E2VA 1MDAA 4O9HL 2VLME 4Z7UB 5JNYB 3AB0C 3PQYD 5FUZL 1Z0MA 3GMMA 4YSQA 1WWCA 1Z5LA 2YEZA 1IAII 4K71B 3HKZA 1AFVH 3QUMB 5ACLA 5ICYB 1ZVNA 2ATKA 1WAAA 3DV6A 2VH5L 4HX1B 4JFFB 4P2QE 5K1NA 4NQEB 1KFAL 1RULL 2IAAC 2IBBA 3H54A 3DHJA 2VSCA 4UINH 1TYJA 1WH0A 1UWYA 4AI7A 1AHMA 3FCSA 4NO3B 3V0GA 5CCGE 5I26A 5IV2B 2ADGB 2I5YH 4A2LA 1NTDA 3CVIH 3IH7A 4U1IB 1S3KH 4GRWH 4RQQB 2NT0A 4YBHA 5KVGE 4P2RA 4DN4L 4U1JB 4F9LA 2O61A 3VGEA 3AS1A 4ZFQA 1KB5A 3OXRB 2PWWA 4OJFH 2R39A 1JV5B 1NM9A 4QYAA 1KJMA 4ATTA 5E99H 3ZIMA 2UY6A 1EHXA 2VT0A 3DPDA 3R06B 4PFEA 2Q1EA 3LPWA 1JG9A 4U33A 1TCRA 5TQ0L 4DGIL 2V6HA 1R75A 5E8PB 4F93B 2EVGA 1R5WB 4U6HA 3VB8A 3T0AA 1EWHA 1J0JA 3WIFA 5I0ZA 3ZYOA 1I8KB 1BZEA 4B3VA 4IBUA 5GZOD 3TBTB 1A7BA 2ED6A 5CAYB 3VXPA 3UEZA 3ZTNH 4DOHE 4J3OH 3C5ZA 1U8MB 4WEMB 2PPDA 2ZICA 4NDMA 4PJHB 1WWWX 1PQZB 3V6ZA 5DSCB 4QYOB 4N8CH 1NUNB 2ICCA 1LO2H 3JTBA 5BVPH 4LESA 5I5JA 3GI9L 1IARB 4YFLF 4YSTA 4B9JA 1WAEA 2JK5A 1KTRL 1A4JA 4UU9B 4ROCB 4PWJA 2BZ7A 2A74C 5FYJE 5C0BA 2XLLA 2JLPA 4I85A 2QTVA 3HA0A 3W11C 4P57B 3A4FA 4TNVF 1W72L 4MNGE 5IT2H 3MAWA 5CMAA 1I31A 2MOQA 2PCPA 2I7OA 1MCBA 2WPGA 3OAZH 4LLMA 4RVBA 5HHNB 3VWKA 4BGDA 2YAHA 1JNLH 3OZ9H 3AM8C 2J1XA 3ZSTA 4O4YL 3LDBB 4OI9A 1A21A 4ABWA 5IGXL 1UT1A 1NFDA 2R0ZL 2XWBB 5C08D 3OWEA 2FWSA 5DT1H 4G8FB 1E8ZA 4TLUA 3U46B 5C2BL 3OH9A 1RU9H 4TSAH 1PMYA 4ODVH 2RACA 1RIVH 3O8XC 3F7VA 4HOXA 1I8IA 5DR5H 4XCEA 2JKNA 4GB9A 2H32A 2X6CA 1GYCA 1N7MH 1SJEB 5DK0A 1IB5A 3GEFA 3LN5A 3NSYA 1LLAA 3CZUB 4NQDD 4CVZB 3EYOA 1SDYA 2PNDA 2HFFA 4Q9QH 1DQIA 3B34A 5FO8A 3WTYA 1RK0B 1NBVH 1T04B 3VFWA 1R3KA 4DW2H 4F7MB 1DZ0A 4GI6A 2EYSB 5F7UA 3F62A 3TH4T 4M7ZC 5GS0L 4GIAA 4ZOAA 4AJ0A 3QJHA 4RCAA 5I74C 3SYOA 3WTSA 3L81A 3QUXC 4YDMA 4G11A 4AENB 1GPOL 2WLLB 1MZYA 3DO7B 4UNTA 1VB9A 4TM9A 3IMVA 1RD6A 3QULB 2IANB 1XB6A 4K7PY 1S46A 5IJCC 1BQRA 5E95B 4MXVE 3IWVA 1QATA 5D7KE 1GW0A 2CIIA 4AJYV 4JK0D 1CDJA 1QYGL 1SMOA 2NNAA 1ZT7A 1RERA 3P3RA 5FYLL 2Y7QB 1DQMH 3WFCH 2FUVA 4GQ9H 5DEGA 1C5CL 3CXDH 1EUUA 4KH2A 3U7WH 4B0MB 3PNRB 4X5XB 1GOHA 1LK2B 1AMYA 2NXYB 5D7JD 2OCJA 4NS0A 2EIKB 3H3PL 4NYLA 3V0IA 5DI8B 1E42A 4ERSH 5EWIL 3WNMA 2I60H 2O4EA 4Z1PA 4ONGH 1YQLA 2IDTA 3RZCC 1NDGA 1UM6L 3TCLB 3OKMA 3OLPA 2RCSH 1NSNL 4I4WA 1I8LC 4XZ4A 2V9UA 5IEHA 1KGXA 5GS1C 3VE0B 5DO2D 5HHQA 4G6ML 1O6SB 1N0XH 4UV7H 2PXYD 2YK1L 3NAAH 5LNGA 3I74A 1T4KA 4P4KD 1KOAA 4WZSD 2JJVA 1S78C 1DEDA 5TQ2H 3T0EC 4HS8L 2AHIA 3EUUA 2VDML 4XBPA 5KYYB 4F15C 2KPWA 1EJOH 4XN7A 3U6X