1KYDA

Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 68
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kydA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kydA02
1KY7A 5CN2A 1NGMA 1QN6A 2G30A 1W80A 1OM9A 2D0BA 5IYDP 2DWXA 4B0AA 3H1ZA 1QNBA 1VOLB 1RM1A 2IV8A 1AISA 1TBPA 1E42A 1QN4A 3ZY7A 1NVPA 1KYDA 1VTOA 5IYBP 1JFIC 3OCIA 3HS8A 1YTBA 3MNMA 2A7BA 1PCZA 4BCXA 1QN9A 1YTFA 2MJ7A 1QN8A 2IV9A 1TGHA 1TBAB 1P4UA 1QNCA 1QTSA 3ASMA 4WZSD 1QNAA 1QN3A 4ROCB 1MP9A 1IU1A 1GYWA 4RODB 3ZHFA 4ROEB 1QN7A 1QN5A 3EIKA 2DWYA 1QTPA 1QNEA 2YMTA 1R4XA 2Z8UA 1CDWA 2E9GA 2VJ0A 1KYUA 1GYVA 1VTLE 2D0CA 5CN1A 1PZDA 3VN5A 1KY6A 1VOKA 4PY5A 1GYUA 5IYCP 1C9BB 1B9KA 2D0AA 3HS9A 3OC3C 1NH2A 1NA8A 1KYFA 1D3UA
chains in the Genus database with same CATH superfamily
1RUPH 3G6JE 1CGXA 3WY4A 1VFOA 2R9HD 3I6SA 3IRZA 3MOBL 1WFUA 3CQFA 2GI7A 3OSTA 2PYEA 3O9WA 1CGSH 5DK2A 5A16B 1XDTT 3WJJA 3TGXA 1ZLSH 2NNCA 3AUWB 4ZW5A 4PB0L 3WSQH 3TTYA 3UYOD 2YHGA 3PV7A 4MD0B 1U8MB 4G3YH 3UC0L 4L8SA 5LBVA 2FB4L 4MQSB 5EZJB 1WS8A 1H3WM 1N4XH 4MNQB 3LKNB 3PHOB 3STBA 3TIDA 4BGDA 2BVOA 1UOVA 4P48A 5A2KH 5E2JA 4PWKA 4X6BB 5IM7B 5I15H 3GXPA 4OCYL 1NCAL 1X7QB 1G7PB 2FNWA 3BKJH 3KPOA 1NC4A 2X2UA 3T77B 2P8PA 3NCYS 4GMSH 2GC7C 4DESA 1BAFH 2FX9H 4MKTA 4JK0D 4MXWL 4OSUH 1GCYA 1IEAA 4J3VA 4WI0A 4KY1H 4RIRA 4C7PA 4R7XA 2OL3B 3ZE0F 3WLBB 3BEVA 2XJKA 1H9VA 5KSUA 2VL4A 2VN4A 1KLUB 5MEPA 2W0PA 7PAZA 2QPDB 4H20H 4J23A 4TSCL 2VLKA 3CVIH 4XNYH 5C6PB 1MW2A 3UG3A 5LG6A 1TCRA 3QJZA 4BK5C 1XXDC 4G9DA 1FGNH 1Z5LA 3R06B 1FVEA 5HDBB 2GBAA 3BHBA 4Z7WF 3CPUA 2Z7YA 3KJ4B 1YZZA 2XWTA 1BD2A 4W9GC 4RFOH 3H9SE 4APQA 3GT6A 2JJWA 2E27L 3HHSB 3UEQA 2WLJA 3TEXA 5IHBA 3ZL4L 5FB8A 1I1AC 1WICA 1A64A 4H7VA 4Y5VB 4FLOA 4X6CF 3V6BR 2QPEB 4ROEB 4QRPA 5TDOB 4AE1A 5K9OB 4PWIA 5T1KB 1COBA 2NYZA 4PU2A 2NOYA 3QEQA 5H2BB 3D2TA 2R2CA 2GTZA 3MUZ1 4PSRA 5F88B 5KBLA 3JYCA 3STLB 3U0TB 5IB1A 4GBXD 2FEEI 4N2OA 3C2AH 3AFLA 4ZMPA 4TQHA 1RZGB 3RI5F 2EC9T 4RISH 3SKOB 2HH0L 4AVJA 2WC7A 5CIPB 3H7LA 2V9TA 5CZVH 2WZ5A 3QEGH 4N0YL 2GSGB 2AP2A 2W9DH 4MAYB 1TETH 3RVXC 4C55A 1U33A 4JGJA 4UTAA 3H2WA 3F5WB 5D1XA 1I9JL 3RWCB 2YXWA 5F44A 5FHBH 1KCVH 4RLDA 2BVPA 3SGEH 2O6CA 2V2WB 5K59F 4FQCL 4QHKI 5GGRY 4FFZH 2NY2B 3IT8D 1XT5A 4UNVA 4L05A 5CUSH 2ITCA 3AG3B 3KEDA 4F9LA 4LLAA 2AGJH 5KN5B 3ZQXA 1G9MH 3EOBA 3EO9L 1XZWA 5B8CA 2F7IA 2YPKB 2PYED 1YQKA 1VPOL 3M17A 2DQUL 3OKEB 3QXTA 4GMTH 3US0A 1MLBA 5JOFA 5MEQA 3BN9D 3REWB 2DF3A 3F12B 2YPVA 4F57H 1S5HB 1DJYA 1BVOA 2V7NB 3RY4A 3P9WB 4YZFE 3D18B 2FEEL 2WYZA 1WV7T 3QRFM 3S3JA 4ZS6C 5F6IB 1U8LA 4OTXL 4I48B 5IT2H 1VENA 2VMFA 3WYRA 5C0GA 2DAVA 1S78D 1NC4D 1HNFA 4OF7A 1JFQL 4I2XA 1DANT 3DI2B 3H56A 4XPHH 2H0PA 4Y4FA 1PCZA 4KROC 1SYSA 2JHJA 2NOLA 3GUFA 5DDHA 2GAZB 4KRLB 2XX1A 3QQ4B 1LO2L 1L7IL 5ALCL 1G7HB 1QRNE 5KVFE 1SPDA 3EJQA 5JO5A 1E3FA 2H5UA 2AC0A 4P23B 3EAYA 4X5QA 3QDGA 4NWTH 4P3DA 4FRWA 5J11B 1KEGH 1XGRB 5FWQA 4AIOA 4UYQA 1N8ZA 3NJIA 4PV8A 3ESNA 3E1F1 4TUKL 2FX7L 5EFIA 1NGPH 2WBJC 4XZUB 4PJAB 5CAYB 4BBWA 12E8H 2PCFB 1AQDB 2Q9OA 1G1OA 5I8EB 4WNSA 1OP4A 5JQ6H 2WNWA 1CG9A 5E08L 2XTJD 3VD3A 5DGQA 3BIKA 3LQAL 1QFPA 1XF1A 4OM1L 3MPCA 3ULUD 2X4SB 2OQJB 3AQDA 3QEQD 4LAJH 4UV7H 2JJUA 1J10A 1FCGA 1S5IL 3BX7C 2PWWA 5JHDD 1KYUA 2BMKB 3T71A 1OPGH 1HSAA 1NGWB 4UT6H 4FA7B 2GK0A 2QGBA 4O5LH 5J0BA 2YD2A 3QRGL 4K71C 4NKQB 4YDIH 2FCBA 5F93C 3V6FA 5IG7A 2O1AA 4XWGH 4D0DB 3KBEA 3KLDA 2NNAB 4K94H 4ODHH 3TN0D 3GS0A 3NZHH 1XGPB 3QG7L 5IHZA 4HBQA 2PP7A 5IFJA 5IJDC 5D1XD 2NY6D 4OF8A 3QDMB 1F6FB 1NPUA 5HDQL 3FN0H 3VXSA 1S7XA 1QNZL 5E6IC 4JG0L 2J3SA 3MFFA 3QJXA 1OT2A 1JGEB 3WFDL 2KERA 1B9ZA 3EOAA 5ILTH 1WD9A 1OK0A 4XP1H 2R9HC 5HYJD 2K6WA 4MQTB 2VUYA 3IJYB 2HLEB 3EYFA 3DSNB 1I31A 4O2FB 1MZZA 5DYOA 1IZKA 3WN6A 1RIVH 2EADA 5CJOH 4EVNB 4JKMA 2OJEB 1EZLA 1J1XL 3ZE2F 4BKLB 4E42A 2BH0A 4AWJC 1PX3A 2A77L 3G5WA 4XCYA 3RWGA 2LU3A 4FLSA 3RVVD 3WJMA 3L4ZA 1DQQB 1KFAH 2GQHA 3V8CA 2IGFL 2Y2TA 3FL7A 3D06A 2VLKE 3US9A 1H3PL 3FH7A 5IW3A 4O58H 2CRMA 3U1SH 3TVMA 4TPRH 2OMTB 1HT6A 4XN2A 2WQUA 3CQPA 4OFDA 4A66A 1DQML 4I5BB 4CC1A 5E1GA 1I1AB 4Y4FD 3MC0A 1JGVL 5EOQH 3FQRB 2Y24A 4JJ5B 4CGUB 1BD2E 3RTQA 3OQ3B 5LDSA 2RA1A 1WLHA 5T33L 3MNDA 1EH9A 2XPZA 3QS2A 1NAMH 3GSVB 4QRPE 1Z0NA 1TITA 1S9WB 5CGYD 3QEQE 1U8JA 4HYTB 2BPBA 4HJJH 5DCCA 3QEUA 1KTDB 4OJFL 4P59L 2MQ0A 5EA0H 4WEMB 1ZHKB 3T8XB 1D5XA 5FHAL 3ZYZA 2HT4D 3PQYA 4K73A 5EUOE 5AD0A 1BZEA 3EBIA 2R1WB 5F3HB 3O3AB 3GS7A 1A4BA 1UD5A 3V10A 1YN7A 3W5MA 1TENA 1FO0L 4FQ2L 5ACLA 3EYVA 4ENED 4HHAB 4HXAH 5C08A 2EO1A 1P5UA 4HKJB 4GRWE 4D9QE 5EO1A 4UM8A 4XNBA 3DXAA 3TFKD 2ESVB 5TE6H 1AR1D 1KV3A 4Y5YC 2IFFH 5I6MA 2ORBL 3WNLA 3BW9A 3VFOA 4PG9B 5EOCH 4HJ0C 2QL1A 4W4OC 3D07A 3VWJC 3VXUD 2AEIT 4ZDHA 4FQXA 2Q20A 3NK4A 5IFHL 3BO8A 1MHEA 4OLVL 2DLFH 4GBXC 1A21A 1Z3GH 4KX9A 4CA4A 2CRIA 4WFED 3AS0A 2BZCA 3FB8B 1P7KB 3DUSA 5E03A 1DQLH 5LGJB 1BBDL 3G5ZA 1A7OH 1UD8A 3GMOA 4JHAH 3EG9B 2ZAGA 4JZOB 4UQ2A 5DURB 4NWUL 3TO2B 3RFRA 3IF1B 1IAKB 2J5WA 1BGXH 3VQLA 1I85A 3UP1A 1UT4A 1PFOA 4FHKA 4N8UA 4DGYH 4NDMA 5KYXA 4JFXB 1RMFL 3G6JB 3VXSD 1YEJL 3N3EA 2ZP9A 5C9KA 4XMVA 2CGZA 1ETB1 3BE1L 1FIGH 1F2QA 3GJFA 2XV2A 2UZYB 3NSJA 4KQ4L 1R3KB 3IJSA 4KROB 2DQEL 2O5ZH 1FLRL 3QXDA 2Z4TA 3IK2A 4OIAA 5EC2B 2AQTA 4GRWF 3ORJA 4I2XE 3WD5L 2F2HA 1J48A 1WUNT 3MBEC 1B0WA 4C4KO 3O9WC 3CHOA 4PGEB 1JAEA 2UUDK 1GGBL 2K7PA 3GI9L 4YH6A 2GYSA 5DT1H 3WJJC 3WUZA 3O2WH 5TE4L 4LCIL 4Q9QH 3MRKB 2M83A 4L8SC 1URZA 4PV1C 1XIWC 1IZJA 2WBJB 3TZVA 2BIOA 2E46A 3TBCA 3L7EA 3ZMEA 5LGKA 3QDGE 1FYTA 3MBXL 4B96A 4AC2A 5KYNA 4ZX6A 5L4FA 4FE9A 1IB5A 3W0WA 1KGYE 3NP4A 4IM8A 2OL3L 4Q2ZA 3C9NB 4KPHH 1MAJA 4EXPX 4ODVH 1JV2A 3RTQD 3AACA 2ZUSA 5KVDL 2K4AA 4I0CC 4MJHA 4GKSB 4NM8H 1ZANL 3G9AB 4CRPA 4PJ7A 4PLOB 3GIZH 3L9RA 4WI9A 3SPVB 2CM5A 1FH2A 3GHBH 3RU8L 4AIZA 1JHKL 1Z0MA 2CMRL 2V6HA 4X2UA 3ES6B 3ESVF 1TQWA 2Q6WB 3TL5A 4NQUA 2JH2A 2CXKA 3R18A 4K71B 1S9YB 4OF0A 3H9SB 3KYMA 4HC1H 2YA3A 4ODSL 4YO0A 4KTDL 1J7VR 3PQYD 2Q10A 1YY9D 4DK3A 5EHFA 5IV2A 2I07A 3FUIA 1P5DX 1REIA 4WFEE 2AK4E 5GGUB 1UL7A 2QELA 2V9RA 5C08D 4APQC 3IETB 5E6IB 2PP9A 4PN6A 4KWUA 1NMAL 3DTDA 3T4AA 4QOKD 4UMGA 4GUPB 3MV8D 2WBXA 3EJUA 1QLFA 3CSTA 3L5WB 4WDIA 1L9NA 2MJWA 3VXSE 5L7XH 1IC4H 2DIAA 3DX1A 2AVFA 5D2LE 4CBZA 2QKIA 4MQ7B 3D08A 1OAUL 2EVGA 4UQ9A 3NUKA 4F3FA 2N1KA 1XWVA 1XSIA 3CC5A 5HYQA 3L3GB 3DIFA 4BWTA 5KVEE 4Z7QE 1RXLA 1R1CA 3ESOA 3F65A 1I8AA 3BLBA 3THML 3FPYA 4PW9A 2B5IC 2IWFA 3MCLH 1WWAX 5E56A 3F2LA 1B4JH 1YEHH 2B7DT 2IAAC 1Y18A 2G75A 3OJDB 4P0DA 2FYVA 2Q1EA 1JF1B 1J1PL 1V27A 1DLFH 3BP6A 3K6OA 3CZSA 3HLAB 3HUJF 2SODB 3L9BA 4GRMB 3VFNA 4YSSA 4YGVA 1D7CA 4TUOB 4JBSA 1BZOA 4M48H 3LH2H 1KB3A 1SBSH 3T0XA 3V0WH 3NDZE 1GYCA 4WNQA 3NJMA 1F13A 3U6RB 5HJ3B 1INQA 1LO0H 4F9LC 2IWKA 4ZUVA 2W81C 2ZWKA 3MA9H 3O45B 2HFTA 4PS4L 2W92A 5B8CC 5AW8B 5DFVD 1F6AA 4FEMA 2H3NB 3TF7C 4DP6X 4NUGH 3IGLA 3L4YA 2R2BA 3MO1B 4QF1A 1VACA 4Z7VA 4B9YA 5C9JB 3GSNH 2IADB 3G5XB 3IWUA 3Q5TA 3S3DB 4CKVX 5CJXA 3HE7A 2CAKA 4AMKL 1C8PA 3CVHH 1FPTH 1KN4H 2DWDA 3MRMB 4E9SA 1H3XA 1OB0A 2GJJA 1JYWA 2MJ7A 3UJTH 3S3PA 3GSQB 1FYTD 1MJ7L 3DBSA 3O11B 4LSTL 4I77L 2PYFA 2Y2WA 3B9EA 3IN0A 5FGCE 1AZZC 5I0WA 3W0WD 2K6YA 4Y4FC 1QRNB 2BVEA 5I6LA 1IGFH 1GYAA 1HZKA 4WKZA 4Y5YB 3NCXA 4MDIA 2F19H 3BT2H 4MA8H 4U6XA 3M45A 5C08E 1N6UA 4PRPA 1C5CL 4IBQA 4BFEA 1BVNP 3BEWB 2WXHA 3I3EA 3VWJB 1KXTA 1NFKA 1MUJB 1AKJA 5LGYA 2HKFH 2L7UA 4MCYB 1OP3H 4GBXB 5HDOA 3DXAE 1TU2B 5MP6L 4FLQA 4R26L 2P8MB 2RR3A 4AV4A 5BV7H 1G9NL 4EJYA 5M7QA 2O5YH 2M26A 5I6PA 2VSKB 3HNTL 3PF2A 1A4JA 2IPTL 2VXVH 3QCUL 1RPKA 1OE3A 2Z65C 4GJTB 3FSAA 4HZLB 2DJSA 4NN7C 5C0CD 3TIEB 1NAKL 1CL7L 2CK0H 2WQWA 5DEGB 1WAAE 3P0VL 4KKCC 4OGXL 4LF3B 1BQHB 1AS6A 4LEXL 4ENEC 4TTGA 3ZJAA 2IANA 3DLQR 3L48A 4CMMB 3IPEA 2DQCH 3KGTA 1TQSA 1X5ZA 2WINB 3T4NA 1QG3A 3JT2A 1S8DA 4GO6B 3TFKC 2QZQA 4JFWA 1EO7A 2HFFA 3OLGA 3C8DA 1F4WL 3EJYD 3NSDA 4YJZL 4GG6A 3MBEB 4KRMB 1HXKA 2YLKA 2FEJA 4Z7OF 3O9WB 1EEQA 4ZOEA 4XMUA 4ONGH 2IMMA 4GIAA 3FUFA 2YD4A 4R6UA 1TVBB 2HRHA 5JQIB 2XFXB 2HX9A 3K8KA 2V17H 4L8SB 5C71A 3AS3A 4JR9L 2QTEA 1YJDC 1L0YA 3TIDB 1E9QA 1XIWB 1XMEB 4KZEL 1Z5HA 2ATAA 1EEYA 3P30H 1SDDA 1PNCA 1W6LA 4WJ5A 5DFWH 3C8HA 2D03L 3KPOB 2R51A 1J1OH 3P3UA 1VESA 2P8PB 1G4RA 1WWBX 1MCKA 4F2MA 1BP3B 5JQHC 4YAQA 1KDJA 4P2RD 1QI5A 3GB7A 1FYTE 3D3VE 5ID1A 4WI0B 3ZY7A 4RIRB 2DLHA 2IDTA 2VN5A 3BEVB 1NM4A 3W0WE 5E99H 4PRHD 5IOPA 1E7UA 5MEPB 3TH4T 1RZIA 4ZMZA 1SGKA 2HTKD 2EVIA 4K7FA 2IG2H 3FTVA 1O9ZA 3C09C 2VLKB 4AQAB 2A7BA 4L29A 1PG7L 2R1YA 1TCRB 4HFWB 2H1XA 4G9DB 3DO3A 2YRZA 4RMQA 3HE7D 1YTFA 1IIKA 1OAZH 3KGSA 4UTBA 3EJPA 1YQVH 1Z5LB 4X80L 1KC5H 4M7LL 1HS6A 3BHBB 1SN5A 2FIKA 4AIXA 4D8OA 4HJGA 1BD2B 5BZZA 5D8JH 4APQB 1CPUA 4C58B 1MRDL 2E56A 3TVMC 1DEDA 1KV7A 4XO5A 5FB8B 2Y3NA 1TTBA 2YC1A 2OMNA 2YMXL 3NFPA 1RUQL 2XRAH 2A9BA 4QRPB 1OCOB 5CIPH 4XX5A 3RTQC 4OJYA 4Z0BH 3HHMA 3QEQB 4PRPD 1JP5A 2J4WH 3NIFE 2GTZB 3TV8A 2HVBA 1X5GA 5E6ZA 1AKJD 1Z9OA 5EUOB 3MJGX 5C0RH 2RMNA 3TDHA 3IDUA 1VKXA 5GISH 3TEWA 4JFQA 4BE5A 3SBWA 3DOIA 4RGMC 1BMGA 3D2UD 3ML8A 1PS3A 2B5IB 1EAQA 5E4EC 1QTPA 4GRWB 1YY9C 5C0NC 4DEPC 3ZDXE 3V4VL 1T3FA 3U9PH 2R27A 4U0RC 1O9WA 5AB1A 3MJ8A 4AJ0A 2FJSA 3L13A 3ZL2A 3CXHK 2BVPB 4OD3L 2AF2A 2IAND 3EYOA 4G9FD 4MZIA 1JI1A 3WNNA 5J7CC 1P5UC 4I9WE 4JM2D 4W6YB 3TP4A 3I9GH 1HKLH 1OL0A 4RMTA 3T3PE 2BSSA 4JHUA 1OGAE 5TFSH 2VDNL 2EH7L 3MLYH 2ITCB 2AJSL 4L8CA 5T3ZD 1U0QA 1ADQL 3Q1SH 4FQXC 1AJ7H 2PWFA 5B8CB 5J3HD 2WV3A 1PTZA 3NH7L 4GSUA 1MLBB 5MEQB 1QBLH 2I7OA 3L3OA 3NIFF 1T0PB 5HHVL 1PZ3A 1N6VA 2XQ0A 1GAFL 2CWRA 3P3TA 3FU7A 5BMFL 4KK6D 1I85C 1U8LB 4QXGL 4B3EA 5TF1H 1U8OA 4Z7VE 4MS6A 4AXWA 1AIFA 4QJ5B 5C0GB 2HVJA 2YKKA 4I2XB 1Q1JH 5D5ME 5F7NC 3IDMA 3BZEA 1HILA 3MU3A 2N7AA 4NEHB 4Y4FB 4DERA 1PG7X 2NY5H 1SYSB 2HG0A 2CHXA 4TOYL 1QO3A 5DDHB 2YUZA 3SDAD 4FERA 2CNYA 5EU3A 1AO7E 2V8LA 1N2RB 1LP9F 3GINA 1TEGA 5DFVC 2V3EA 4XCNA 2AK1L 3EJZC 1PZAA 2EDTA 1GHFH 4GSDL 3KLHC 5FC9A 3ZN6A 2GCYB 4N6RA 1IQWL 3BPCA 3NYKA 3UCRA 3QDGB 1YNTB 4P3DB 3TT3L 4E9QA 4OLEA 3MJ9H 2ZJSH 2J6EH 2WVTA 3OJVC 3SE9H 2NTSP 2J8UF 1N8ZB 1KBGL 2K0RA 2RHEA 4PV8B 4NN7B 5EFIB 4UT9L 3V5KA 3S88L 3TZVC 1OF0A 3DETD 2V92A 2HVKA 2QLYA 2CA4A 2Q2LA 4PJCF 1I3UA 4ZFGH 4OM0H 4AYGA 3TBWA 2CK2A 1R34A 1T7WA 1E6JL 5FUZL 3KLSA 1CG9B 1SUJA 4JFED 1IGTA 2OR9L 3BIKB 5JXEA 1DVQA 5DRNA 3RPBA 4LOEA 5DZVA 5EEVA 1IM9B 3HN3A 4IOFD 1NCHA 4PJXA 1JYXA 1MW3A 3CPLA 5IVZB 2X28A 3BUIA 1EMTH 1HSAB 1JD9A 2JFCA 4KHTH 3DX0A 1A7BA 3NAAL 2GK0B 1I8KA 1U8CB 1KELH 2AK4B 4MD4A 5T3ZE 5I16A 2GFBB 2GTQA 3BWSA 5JYLA 3V6FB 4GG6E 4M6NL 3GKWL 5IG7B 1BF8A 4DKDC 1YQLA 1CGWA 1F18A 1YA5A 1N67A 5IFJB 3EO0B 5KOVC 2A6DB 3QCVL 2BNQA 2WOBA 5IHZB 1SVBA 4K9EL 3G6DH 1SLUA 1UFGA 4PBVC 4R3SA 3IMBA 4RMRA 3VXSB 5I8CB 4KZDL 1HU8A 3MFFB 5D2LB 4B9FA 1DJIA 4HWEL 1VADB 1IE4A 3BH4A 3EOAB 4HS3A 3TV3H 2GBTA 4HIEA 2J88L 2C9PA 4Z7QB 2OSLA 2VDMH 5E1HB 2NY1C 3EJYC 5LBSH 5KBKA 5F7WC 3CWGA 1WGVA 4RZCA 2QQNH 1QYGH 4KQ0A 1MCPL 4MCMA 3ZZSA 1RUAH 2BDNL 1YNKL 1YQRA 3C09B 1ZVNA 4OH2A 5F89A 4JQIH 1F4YL 4E42B 4AGPA 3GFUA 5EN2B 1KB5A 2B0SH 2ZZUT 3ELAT 4HAFA 4QHNA 3QHTC 4XCYB 1FZKA 3HPLA 3U46A 5L2KD 3RWGB 1OPOA 2NRDA 3VRLF 4F8TA 3QXWA 3OH9A 2J2ZA 3I74A 5TPWL 1SY6L 5LHDA 4KI5D 4U1KA 4Q11A 1YEIH 3QJHA 3TJEH 2OCJA 3VH8A 2O5NA 5TE7H 3TVMB 3I6GA 4CSZA 4UZSA 2ICEA 4N1HB 3F0ZA 4A63A 2NNFA 3HZYB 4BSWA 1ES0A 4W9JC 1N7MH 3EJJX 1OAQH 3RTQB 3RWHA 4R96A 3N41B 2PN5A 4OQTL 5HHME 5FW7A 5C3TA 3QULA 4PH8A 5T5FL 3QPKA 4DKEH 3ARBC 4NQQA 2CZNA 4LOFA 3CFCH 4OIFA 3V5DA 5AG9A 1CDIA 1EK3A 4LBEA 4LSUH 4RGMB 3D0AA 2WLMA 4MXVF 3QEUB 4FFWC 4Y9EA 2OR8A 3INUL 3QNYA 5CJXC 4EAEA 1DQDL 3C5XA 4RH4A 5E4EB 5FGCB 5AD0B 4H0IA 4IRSC 4DEPB 4WW2A 5FWRA 1T66C 4U0RB 3NJGA 5KVFL 1U91A 3EYVB 3KWTA 5FO7A 5C08B 2ZAHA 1OSZA 1RUML 1HWHB 4PSPA 1SDYA 5IBLC 3T04D 5JA8B 1QFUH 1P5UB 3T0DA 2FT6A 5DMJB 3AS1A 4NN6C 5CEZD 3AB0C 5C86A 3DXAB 3UABA 5K1JA 5HD8D 3B43A 3DX9A 5D71L 1WE5A 3WN5A 3BW9B 2I69A 3VFOB 2Z91A 3FT2A 4NXKA 4WW1A 3HG5A 3NPSC 4FQXB 2J43A 2Y1ZA 3BO8B 3BUYA 4KJQD 4HIHA 4TQ8A 1MY7A 3EFDH 5I8OL 2DI7A 2BSTB 5ISZA 3RPJA 4RDBA 3DUSB 4PJ9A 5SX5H 3G5ZB 3GMOB 4NIKB 4UQ2B 4PP1C 4JO4L 3MOQA 4DP7X 1IFRA 1MCWM 2EDWA 2VZVA 5L8LB 1IEHA 2A9NH 1EJOH 1CS6A 4XCFH 1KFIA 2AV7B 3E38A 1UB5A 4MYWB 5KYXB 3AU0A 2BY0A 2DJUA 2F5AH 1L7TH 2D0AA 3QIUD 3GJFB 1KFGA 4NNPH 1SVCP 4NZFA 1P6FA 1ZPLA 3IJSB 3QXDB 2FEDC 1A6UH 2ODIA 2D7MA 5JN5A 3BWUC 3KWUA 1F58L 2CDFA 2ITFA 2K1MA 1GKEA 4AT6B 1DR9A 1SHXA 1P4IH 4N9GA 5I82A 5MI0C 1JZ7A 3P9MA 3BIBX 3LB6C 1NCIA 1M3QA 5GGVY 4G6JL 1QVOA 4ZS7L 1MAKA 3H9HB 4OQ1A 1MJ8H 1D5MA 2H5AX 4KK6C 3TZVB 3ZTDC 3KAAA 1MFEL 1OHQA 4XXDA 3L7EB 1ZMYA 4AGNA 4E9YA 2QQLL 4GIOA 3X3GL 1FYTB 3D3VB 3WY2A 3S4SG 2W88A 3QO0A 1EQWA 3ARQA 1XCQA 2FHCA 3C6LD 3IFPB 1YYLL 3U25A 3W0WB 3B9KC 2WP3O 2JKJA 3QEHB 8CGTA 2HL9A 5F7DA 3RSMA 1OD9A 1OE2A 1JK8A 3U4KA 3DHUA 1JV2B 4V1DA 3L9YA 3L6FA 2ZNXA 3MRGA 2YZ1A 1KIRB 1MKFA 2B14A 2XVBA 2WJ7A 3VD0A 3MYJA 4QRRA 3ASNB 3L9RB 4QCIA 2OJZL 3MRCA 4AIZB 1YG9A 1QZ1A 1O9VA 4OIIL 1JYNA 3RX8A 2XVKA 3ZKMD 4JUSA 1OIOA 5AVYB 3DRTA 3JTBA 3OAYK 3FT1A 1OV8A 2FT8A 4YO0B 3ZT6A 4UUJB 3PGFL 2H6OA 3BPOC 5DHVH 5SWSA 3QQ9C 5IV2B 2I07B 4OLYH 1LO3L 5GRJL 2Y7MA 4FQJL 3GBLA 1Q9WA 3SODB 3CSYB 4XXWA 4ZFFB 1FBIL 4GKNB 4AMXA 4AVIA 3O6LL 3HG3A 4MQXD 4PJHF 4AI7A 2FYYB 3FUHA 2E9BA 3NIFB 4L3FA 5BCAA 1ODUA 1DQJA 3KDPB 1X7SA 2BNQE 3ZRCC 4JFUA 1QLFB 2XWRA 1VZHA 4WDIB 3EDKA 3QFJA 3WNKA 4M7LT 4IOFC 2IMNA 2NY1B 1HZLA 1P5GX 1QNEA 5I6OA 3RPIA 1JGLH 3X14A 3GLAA 4F3FB 3L8QA 2O93L 1BF5A 4GAGH 3CC5B 1QR4A 4GP4B 3ZDXB 5HYQB 3SBWC 5JOEA 5ISZD 5EBLA 3U4BH 3CXHJ 3KYAA 5AOIA 4UTAL 4LVHC 3ULVD 1SEBA 5AOZA 2NY3D 4NS0A 1T7VA 1Y18B 2YMOA 2YUWA 3T3PB 5L6YL 5IYCP 1T21A 1MFDL 1OGAB 4IJ3C 3VFNB 3FSWA 4YGVB 3VFGH 1J0IA 2VDQB 4JFSA 1GW6A 5HY9A 4ABUA 2AEPH 3RVUC 1MWAL 1KJVB 1E42A 4WFHD 4XNUH 4PYGA 2FE0A 5CZKA 1UEMA 5D96C 4WNQB 1INQB 1Q1PA 2D7PA 4WHTB 1QBAA 4EUPG 3KS0J 4IOIB 4ZUVB 4BCYA 4UANA 2GUYA 3ARBB 4KAQL 4WFGD 3WIIH 1F6AB 4KMTL 1W0YT 2XHNA 2C7UA 4K8RD 4XVSH 4FYQA 2WO4A 3DI3B 4QF1B 1VACB 1VDGA 4Z7VB 3L3OC 5SWZD 3BKYH 3PS6A 3WEAA 1NICA 1A14L 4NP4H 2P80A 1CBJA 2FX8L 1SNRA 5D5MB 1QI3A 5AYQA 1F2XK 4XNMA 4H8WC 2XV6B 4IRSB 1WC7A 2X4UA 3O3UN 1ZLWH 5C0DA 3AVEA 4OLUL 4JO2L 4PGBA 2PYFB 1AO7B 4MRQA 2HJLB 2G4GA 4NN6B 4NRZB 4GNKB 2VN7A 3AB0B 1G5AA 4X4KA 4BZ2A 3BRGC 1CQKA 3PYCA 4XTRD 1TZAA 4V1DD 2H2SD 2Q7YA 5DMGD 4C59B 1KXTB 3NPSB 1AXSA 4JG5A 2KZWA 3NCWA 2Y25A 1QLEB 3ZU8A 1JK9A 5LNDA 4FGMA 1UT1A 4XCEA 3DTXA 4ONHA 4L0ZA 4KUZH 3APNA 3QNXB 3CHSA 4YHLL 3QO1A 2EKJA 1A4JB 1E3XA 1UT7A 2NY0C 3OKNA 4J8RA 4NZUL 5SWSD 2X42A 2YKLL 5EU6A 1ZDQA 4R4BB 2WQVA 2DDQL 5F0JB 3M1BA 3KJ6H 1J5OH 2YFNA 3AREA 4RA3A 3PV6A 4GG8A 3RPKA 4DKTA 4H8QA 1S8DB 2BVTA 3HJEA 3CC1A 3LAFA 5JXEC 3W56A 2NDGA 1W0VA 4LEOB 4BWWA 3WKPA 4GG6B 4Q0XL 1KUMA 2E9GA 4ALAC 4LOUD 1ZLVH 4AG4L 5DZPA 2AQSA 5MI0B 1ZLEA 4UINH 2R2EA 3E8UL 1HWWA 1YUKB 4K23L 3FBQA 2EDBA 1FC2D 3QISA 3BZFA 4D3CL 3BSZA 1E9QB 3SDYL 4ELMA 3SE4A 1DDHA 1JRHI 4Y2DA 1GC1C 1EEYB 4P06A 2QSQA 4PP2A 5BZDA 4YIQA 1SDDB 4G6AC 1XHHA 2Y1AA 4PRBA 5FCSH 3ALXA 2VMJA 3CFEB 3SE6A 4YE4L 3QDHA 1H8LA 3MLSL 3B9KB 2WWMC 3FTYA 3V0JA 3KCPA 4GPVA 4FXLA 4MMYA 3SYQA 1EGJA 3ETBJ 4J12A 3GB7B 3GRWL 2W95A 2GJRA 5ID1B 3UPRA 3ZE1E 1Y7VA 1Z1WA 2QREA 1IC7H 4IGBA 5JOPE 4TNWK 5IOPB 5GGRA 1ZV2A 1CR9H 2P8LA 4YX2L 1F8TH 1HYSD 1FQ9C 3ARSA 2C9SA 4Z3IA 3UYRL 4L29B 4Q58C 4Y1AA 5C0JA 1PSKH 2QQKH 5EDSA 3W57A 4QRRE 4QR7A 5ICXB 4MZRA 5AVRB 3T6VA 3GPEA 4O4YL 3BPOB 4NJAH 1N59A 3FHQA 4LL9A 1O6SA 4BFNA 2GJ6A 2FIKB 4Z8FL 2R56L 1IAIM 4MA7H 2NLJB 1EDQA 1F3DH 5HHMB 1ZSHA 1JRHL 2ICEC 4NJ9L 5FPIA 1A1MA 5IQ7L 1KMGA 2F53E 4HKXA 3NFPB 2YC1B 5J6HB 3AWFA 5B1KA 4OZIA 1Y6KR 2OTUA 3QGVA 1VFAB 3P11H 4G7SB 4YDVA 3GZOA 5CJQH 3CLEH 3R0NA 4TLKA 1RK7A 3D4GA 3H6JA 3IDJA 3DECA 3MHZA 1ZLDA 3CZNA 2A4CA 4M5SA 1AD9A 5MENE 1VKXB 4JFQB 2XWJA 3OC8A 3QFJE 2C1PA 1C08A 4DN3L 5GGSA 4LVHB 4HFUH 5KVGE 3DVIA 1XD0A 4X5WA 4GSQA 1IC0A 1BOYA 4YSCA 4IJ3B 4WW2C 3JVGA 2H26A 5EU6D 1N18A 3MJ8B 3T2OA 4TV3A 3L7FB 4J3XA 3QAZC 2XG4B 3EYOB 4QG5A 1ETJA 1UJTA 3JTSA 3WHXA 4OCRL 2Z31A 2KPWA 1LK3L 3ARED 4GQ9H 2YPVH 1WSST 3QORA 3DJZA 4X0KB 4HS6A 5D96B 1IKNA 1MCHA 3BQVA 4RBPK 4L8CB 2MIZA 4OCWL 2ZF9A 4KVNL 4R9HA 4A2FA 1XGYL 3HE6A 2MCPH 1XAKA 4K5MA 1NCDH 2YQBA 2K8QA 1W72A 3LX9A 1RK1A 2AQNA 4KDTA 4ZW7A 3OKOA 3MODL 3L3OB 4PJ9C 1AH1A 1RVFH 4TULH 5HVGB 3VYPA 4JPVL 3LRGA 2DJ4A 1CGVA 1KBBA 3FU7B 3G04A 4MZ2A 1ZT4B 2QTVA 5JMVD 5GPRA 4JRYA 1OD7A 4AXWB 1AIFB 1UOLA 1A7PL 2DZEA 3G08A 5BRQA 1KIUA 4DWHA 1WZ1L 2YARA 5ABZA 4AK1A 5GZNA 1A7RH 3PHAA 4TS6A 3IDMB 4KO9A 1HILB 5EWIH 3ABZA 3D12B 2K45A 1UOKA 5HGDB 3VGHA 1FA4A 3R1GL 1QO3B 3BFOA 1USQA 4LHJB 1R3IL 4B0MM 4HWBL 4YL9A 5EU3B 5AG8A 3DV4A 3O3BB 5DHEA 3UJIH 4IGBD 4OCLC 3HJ0A 2EVJA 4XCNB 3ZTNL 4N2IA 4N5EC 1N0XH 4QHMA 1PY0A 4N6RB 3WELA 2NY7L 3BPCB 4CC4A 1CICD 1GL4B 4Y1AD 4PYHA 4XMLH 1OOAA 1KULA 4M3JA 3I75B 4XPBH 3QUHA 4BCZA 3K5SA 2QVIA 3V5KB 2NY0B 1ED3A 3TO4A 3WNJA 2GJ6D 1D2PA 1T1YA 1G0XA 4QWWD 2V33A 3ET9F 3FCSB 3WMSA 2KKQA 4YLCA 1G1YA 3V79C 5T1JA 3TBWB 3WFCL 1KB9K 4KVCH 2WUCH 4QIRA 3NFSH 1X5FA 3MBWB 3MRRA 5EU6E 5DRNB 1A8JH 5SV3A 1Q0EA 2H2SC 2ZCKL 4KTYA 4BFIB 4LSSH 4LHUG 3DGGA 3CPLB 4PJ6A 1H3GA 2UZPA 2WY3B 5LNEA 2ZXCA 3U1PA 2J72A 1RZFH 1V7MH 5E1QA 1QI4A 1DJSA 4ZUTA 4MD4B 1S7VA 3IMRA 2RGSA 1OY3B 3KLQA 4I4WA 4F91B 1OARH 2B2XL 2JV6A 3N44B 3ZZ1A 5KVEH 4DN4L 4N68A 1YO4A 5K9QG 2BNQB 1OT4A 1W6WA 1ASQA 3FN3A 4R3SB 4W6WB 4XXWC 2KS0A 4A68A 1ZHBA 4S1RL 1WGOA 2DQGH 1E4WL 4X6FA 4NZTH 4ELME 1NUFA 5DJDA 3VFMA 2I60H 2ZOLB 4TVPE 5F7AA 2P52A 4HS3B 5D1QA 3VXRD 4YSEA 1N3NA 4HIEB 4IBYA 3Q6GL 2B1HH 3L2MA 5IZ7A 1R0AL 3JWDL 1OCWH 3S8FB 3C5SA 3NIDE 2HWZL 1Q8MA 4RZCB 5GRWA 3HE6D 1K4DA 2C34A 4U4IA 4M8UA 5TQ2H 5FYLD 4GXUN 5E4AA 1K8IA 1WFTA 1NA8A 5F89B 5GZOC 1T6AA 1KB5B 2NX5A 1KGUA 3N9GL 3QXUA 3U46B 1FZKB 3HPLB 5ID0A 1BDYA 1I9EA 1XF4A 2ENJA 3AG1B 4XP6L 5DUBA 3W39B 1PF3A 4TN9A 5MEOA 2J2ZB 1EHNA 4S1DD 1YECL 1J5IA 4U1KB 1AQKH 3VD7A 3QJHB 3VH8B 3DPDA 3CK0L 4KXBA 2ICEB 5IQMA 4KU1A 2WKLA 3AMLA 3PFQA 2EE2A 5DZLA 1UM6H 1OCZB 3QJVB 4BSWB 1P9MA 2D9CA 1H15A 4DQOL 5JIKA 3QYNA 3RWHB 4R96B 4E5XG 4ZMYA 1ZK5A 1Z32X 2GBVA 1N6QL 1BMZA 1TBPA 1YAZA 3IXAA 3L5HA 5HYSA 3P77B 1DN0B 3VTAA 1BM3H 3MLPA 4OZIE 2ZUXA 2DEYX 4RWHA 3U83A 2XUWA 5DRWB 3V5DB 2OSYA 4HZ1A 4PB0H 4LBEB 4HLEA 2P26A 2A9DA 2KC0A 4PREA 1EUVA 3QNYB 4ONFH 4F8PA 5CCGE 3SY6A 4K4KA 4YXKL 2DKUA 3LKSA 2RFXA 1BLNA 2APXA 3TO4D 1XO8A 4WW2B 2ZUTA 4JFHD 2F6AA 1NLDL 5K93A 4JQXC 1U91B 3WUWG 1Q94A 1TBAB 3QAZB 1JVOA 5F7YC 1A6AA 1K4CB 1GGYA 3F7RA 1L4IA 1CLOH 4MAUH 3S37H 3PWLA 4KKBD 5BRPA 1HCZA 4ZT1A 1XSJA 4JQVC 3CFDA 4JL2A 2HG5A 1GR7A 3WENA 3DX9B 3P3YA 3OPZH 4F80A 3GNMH 2CKNA 4Y9GA 5AB9A 5DS8B 2X9YA 1R9FA 1NZRA 2Z91B 3FT2B 2WHVA 4L0YA 4WW1B 4I89A 2QPUA 3MLWL 4WEBH 4RNRA 3BUYB 1O75A 4HIHB 1AOHA 3V6OE 4PJ9B 2X4QB 1SXSA 3LKQA 1A9VA 1NCTA 1I8MB 1E28B 2GK2A 2VLMD 3MAWA 4LASH 3FC8A 1JDCA 2DEXX 1UB5B 3B37A 1ACXA 1Z6JT 3IDGA 2E27H 4DO6A 4U3SA 3DX7B 3BN3B 4Z77A 2HRLA 3ZL4H 4IL8A 2CIIA 4LLVA 1J0JA 3WXWL 3ILPA 4DTGH 4GW1A 3NJXA 3RZCA 4JRYE 3WFBH 3NOIA 1VIWA 4JPIA 4YK4C 3KNBA 4TNVK 4YDZA 1DBJH 2HA1A 5E5RB 4R8WL 4NGHH 3KE0A 4N8VG 3OMNB 4FFVD 3N42B 1FNGB 1U3YA 6CGTA 5EPMA 2KLTA 1K3ZA 4WI8A 3X12B 3OF6A 3NEEA 3P9MB 1NINA 1UCBL 5F7LB 1SLVA 3CDZA 5E8PA 2NX5D 1FZMA 1HE7A 1D5MB 4M43L 1B4TA 4IYKA 1DO6A 3SE4C 4Y2DC 3BESR 4AUUA 1WT5A 4XXDB 2G2PA 4HCFA 1S4IA 2AJYL 2HZHA 3LS5H 2JTYA 1JXGA 1AY1L 3ZE1B 3QO0B 4UOW1 1DUZA 1AG6A 1XCQB 1NCWL 3GK8H 3I50L 4R90L 3ZKQD 4J3OG 5IHLB 4E5XA 3L17A 5F7DB 3L4CA 1JK8B 1AZRA 4FEIA 5B3SB 4F33A 1HX0A 5EZOL 3L6FB 3MRGB 2QLVA 1QQDA 1CE6A 1FL5B 4IGBC 3MYJB 4FULA 4QRRB 3LNHA 2ZOUA 3MUUA 3IWVA 4IKKA 4QCIB 3QJSB 3MRCB 3IKKA 3SE8L 5MHSE 2TAAA 2X88A 2I32A 4AYEC 4WWID 1FHGA 3DRTB 1YEGH 3IN2A 2R15A 4LDOB 2ZOOA 1HCYA 4KNSA 1UB6B 4NO0A 4UWQB 2F53B 2SEBB 2VR7A 1QW9A 3APMA 1N39A 1FFQA 1Q9WB 2W80C 2AQRA 1XGTB 4WSKA 5AW9B 1MAMH 2F58L 3AG2B 4IBTA 3RB5A 3SDCA 3WBDA 4BZ1A 2VLME 3D87B 3MLZH 1DQJB 3MUJA 3UL4A 1RUKH 3NCEB 4F8LA 4A38A 3IDNA 5MENB 1ZDSA 4NRYB 1VSCA 1G1KA 4N87A 3V7MA 3QFJB 2CIKA 4UOZA 1EPFA 4OVUA 2Q8AH 1R24A 3N1QC 3RPIB 3X14B 2VDQH 4P4RA 4LNRA 3HR5A 2BS71 3BXNA 3OAZK 1JPSH 4GP8B 1BQKA 4NQDD 5D1QE 4U6TA 4NKIL 1A8ZA 5BOJA 5EBLB 1NCUA 2Y6SC 4PJIA 5AL0A 5EZIH 3DURA 4MVBD 5FGRA 1SEBB 5AYUL 3RILA 1BA9A 3LCYA 1KEML 4L1SA 3QXVA 3ILQC 5GGTL 4LESA 3JVGC 3BQUD 4JDZA 4KKZA 5IVXA 1BVLA 5HY9B 3V52H 1QKZL 4PY7B 4GUCA 3ZTEA 3VG9C 1G7JA 1SOXA 2Z31C 3NDYE 4YL4A 1NMBL 3QORC 1GYUA 1LDPL 1IKNC 3EGDA 1P2CA 3O6MH 4JFOB 4YHPA 3SPCA 3V6OC 4N8VA 5FUCE 5IMMA 5J6SA 4GT7A 3WJLA 4LRIC 4KK9D 4P46A 1XF3A 3V0VA 1I7RA 5HHOA 3GSWA 3NSFA 4NQEA 4LCUA 4KVPA 2C7UB 1NCNA 2BS9A 3OF6D 4EI6A 5BS0E 2OXGB 3CTTA 3QUXA 4MFHA 4KDTC 4H8WL 1SJMA 2WLHA 1MCRA 2JI1A 3PWUA 3HAEG 1CFMA 2F7LA 4XNMB 3BLPX 5I26A 2PW2A 4ZAKA 1BAGA 3RDTC 4J6RL 1WC7B 4F8QA 5I5RA 3S4SB 3LZPA 5HDQH 1QNZH 1M6UA 3DJ9A 5F7KC 3FQNA 5C0DB 1QLEH 5GZNC 4PGBB 3JXAA 1U92B 4PJBE 4WGVB 4XVJL 4Y88A 2IVFC 1YDPA 5LG1A 2Q3ZA 1CVRA 1QWNA 4MCZB 4NO3A 1CK0L 5CEXA 5DJ2A 1DSFH 5D1ZA 2Q7YB 4PGJA 4X7TA 3B1UA 1AXSB 1XXFC 3BWAA 2DLIA 3CZFA 1XVSA 3QIBA 1BJ8A 1EUTA 4HPOL 3CWSA 1JK9B 1JPTH 4CC4C 3JUZA 4PVNA 4XCEB 4YVUA 2PO6A 1YMHA 2BIHA 1JOIA 4PCTA 3VG0H 4RSVA 1EDYA 3QO1B 35C8L 1KB9J 3VYOA 4J8RB 4NO0D 4TL4A 5T3ZH 4OBSA 1TVHA 1JF5A 4WENB 2XXGA 1VKLA 5EU6B 1F97A 2V4LA 3T6WA 4FNPA 4WZSD 3F58H 1FORH 5L8JB 2WK2A 3LTVA 1TNNA 4Y2OB 2Z93A 3WEBA 5DF0A 1LP9A 1A1NB 1JGVH 4ZOAA 5T3XD 3PV6B 4GG8B 1IU1A 1TYRA 2BP0B 1O6TA 2RJMA 1IMHC 4ALAL 4YK4B 1W0VB 1BIIB 2TSBA 5T33H 5DUJA 3EOTL 4L5FL 3N40F 2J8UA 1FAIH 4BA8A 4DW2L 4EBQH 1UEYA 3I84A 2R2EB 3VQ2C 4NT6A 2DQTL 3HCVA 2W38A 4M3KB 1NSNL 2IBGA 2R69H 2O5XH 3LIZL 2M2DA 3ARZA 2VR9A 1NGYA 4Y16A 1DDHB 4Y2DB 4ELMB 2WLNA 4ILDA 4F37F 2F8XC 4PP2B 3FT0A 3WFHA 3QR0A 5BZDB 4YIQB 2CUIA 1PQZA 3OGCA 4K3GA 2X9WA 1UACL 5HXMA 4PRBB 3VFRA 4K5NA 4J2XA 2E7CA 3NIDB 1QABA 3KCPB 4MJ6A 4MMYB 4EUPB 5D1QC 4X9GA 1THCA 1B4RA 2CGRL 5AENA 4UTBH 1AMYA 5ABAA 4IGBB 4OLVH 4YDKL 1G9HA 5GGRB 3CBJB 5HHOD 1R3LA 2JKSA 1KB5L 2B9AA 3ZKSD 1NGMA 1SEQL 2VC2B 3ARPA 3SPHA 1OM9A 2P8LB 4HCGA 2HX7A 5CLTA 3WKNA 3HAEA 3ZO0A 5C0JB 5CILH 5HHNA 1FNLA 5H94A 2GABA 1OF2A 1NBYA 3MACL 3KH4A 4ZAKD 5JLZA 1N59B 3Q8CA 5DJYA 4P5TC 1M5Q1 4N0RA 4HSCX 3B9VA 3L4XA 1AE6H 1LTXA 5FUCC 4LU5L 1RAMA 4J3OD 4KO5A 4LPXA 1EFXA 4S1SL 4MLSA 5DQDH 5KBNC 3MOAL 1WBYA 5TTRA 1CXHA 2RALA 4HKXB 1P9MC 4OZIB 1L9SA 2OTUB 3WS3A 5JHLA 4OZFG 4YDVB 1UJ3C 1OB1A 3QR2A 5D1ZD 4JFVA 1MFUA 5E1AA 5B3JE 3U2SA 3QIBD 2EC8A 1WAEA 3CU1A 3BCDA 3GI9H 3U0WL 1AD9B 4M61A 2IV9A 5TE4H 4LCIH 5IBUG 4F2FA 2C1PB 1C08B 1DCLA 2EO9A 5GGSB 3ARRA 3E80A 4X5WB 4HCRL 1CCZA 3QUYA 4JS7A 1UUSA 5GS0D 3KMDA 1J0ZA 4LIQH 1E5CA 1UM4H 2YPLA 3SHSA 5IIEA 4TQPA 1J86A 4NRXA 2YGOA 3PABB 2G60L 2O4EA 2EXSA 1UYWH 4PJIE 1YNLL 3JTSB 3VG9B 3MRBB 3WHXB 3T3ME 2Z31B 3DJSA 3KXFD 5HVHC 5LGHH 3WE6B 3QORB 5CP7A 4HS6B 4R4ND 4PVBA 2E6JA 4KQ3L 4CMHC 5IVXE 5AKRA 4F58H 2IDUA 2LOEA 4O02B 4FZ8L 1PKQA 2NXYC 1ZANH 5DD5H 1WTGT 3P69A 5I8KL 3SJVA 4Z76A 4HMCA 1UD4A 1HZHL 2UZIL 4W9DC 5J89A 1RK1B 2N0MA 2DI9A 3OKOB 4HEPG 1AGEA 4PJEF 4XBMA 5SX5K 5F6HJ 3OAWA 4KTDH 4XT1C 1SZNA 1CWVA 4YC2C 2JKLA 2YWYA 3D69A 5HHOE 2V8QA 2X38A 4H8VA 4NQEE 3RDTB 3VQ1C 4Y16D 2ADYA 1K3IA 3G04B 2ADJA 3RHWF 2P45B 5BUAA 4JRYB 2VOTA 3PP4L 2QFRA 3G08B 4ODUB 1KIUB 1NMAH 2BWQA 3V4UL 1RL1A 5FM5M 3B5HA 3OV6A 5FYKU 2VRKA 5BO1L 3RZCC 4U6YA 1ID5I 5GS3A 3BVWA 4XNXL 1ZVSA 4L4VA 4RDQG 4AYDC 3GLEA 3HB3D 1EFQA 3TC9A 3TT1H 3DV4B 1V7NH 1JZ8A 4L4TA 4NZRL 4QHMB 3OTTA 2BY1A 1L6XA 2LLLA 3ZZQA 3QUML 4AX3A 2BJML 5CEZH 2ICES 1TT6A 4NBXB 2R29L 1PLGH 5AZ2H 4KXAA 2JF1A 4N86A 5BVPL 2FIRT 1PX4A 4BFKA 4FHBD 2X6BA 4C56A 4PJGF 2AABL 2C9AA 1T1YB 4ZOCA 3BZ4A 4HIJA 3AZUA 3KG5A 1MI5A 3QZNA 1W15A 4WRLA 5CJBA 4HU8A 2WAHA 1AGFA 7CGTA 1JTTA 3EGSA 2DY2A 4OZFA 4PMFA 3MRRB 4XP4L 4WV1A 2EHBD 2NYYD 1A0QL 4NKDA 5E95B 1O5DT 4OUUB 4UTCA 5HVWA 1DJWA 2D2OA 3IGFA 3DYOA 4PS4H 1GC1H 3DV6A 1KCUL 3HC3L 3T65A 3IFNL 3PCYA 4OV5A 1JZHA 1DBML 2VDOL 5CLWA 1AGDA 3P4NB 3QSKB 1BFTA 4M1DH 1E43A 1LILA 2LV4A 3HKFA 4CW1A 1CDUA 4ZUTB 3UJJL 5IHHA 1B2WH 1S7VB 3ASMA 1JIBA 1KIPA 1PD6A 4I4WB 5D7LD 3RZWA 5C09A 5J6GA 2BHZA 2P5EA 4GSRA 5F9CA 5EEUA 5HGHA 4X8JA 3A47A 2DBLH 4PRAA 2YPLD 4TVSa 4NQTA 1BQRA 2K4WA 4NNXA 1CFTB 1DYZA 1R46A 4I77H 4JHWL 3U2IA 2LAEA 1GIGL 4H0LC 1ZHBB 4RAVA 1X5LA 3SDCC 2DWEA 4ZNEA 5DRZA 2P5WA 3HZMA 2X6CA 1FCCA 4PW3A 1HIML 3FOLA 2R2HB 3GF8A 4ZYKA 1CUOA 4M6MH 5D1QB 1N3NB 5EOTA 1DHKA 2EILB 1V55B 5BW7A 1P53A 2EIEA 1MVYA 1A66A 3V6ZB 3SN6N 4WF7A 1K4DB 2YN3A 4R26H 1UM5H 3VD4A 1UADC 1BG9A 1K8IB 1VA9A 3SQBB 3VI3F 4DVRL 1BQLL 3QCUH 2P4AB 4Z78A 5ID0B 3TESA 2QR0A 3O4LD 1LWJA 1UCTA 3A67H 3NRPA 5DUBB 1X6NA 4HX1A 1NUNB 3P0VH 4P5TB 5F97E 5MEOB 1CFNA 3F7PC 1BVZA 4FG6D 4N28A 4IRZL 4PI0A 4UQ3A 3SPJA 5IUCA 1KBPA 3O3EA 4KH9A 2X6UA 3EOYG 4Z3HA 2X1WL 3KLLA 4JRXE 1RFDH 4P3CL 4MJ4A 4J2QA 3MLUH 1H15B 2O6DA 3W11D 5BS0B 4JM0A 2PWGA 2E3VA 3WJLC 2EC9U 3LNDA 4HU2A 1LNUA 4D0CA 1UJ3B 2YUVA 5ALBL 4DGVH 2E7MA 1OWRM 3CUPB 3IXAB 4P46C 4M5YL 4TLTA 1OM3L 1JZFA 5F7EL 5IB2A 3RBGA 1AQHA 3ATAA 5E8NA 5A3ID 3K2UH 1RQ5A 2VRAA 3QUXC 2A73A 4P8QA 4ABQA 4PREB 1BX2A 3BVDB 1MPAH 1AS8A 4JR9H 4MA1C 5HJBA 2ED9A 3V0IA 4QJ4B 4PJBB 2IWGA 3ZDZE 1K5WA 4JKKA 2NYKA 2VJXA 5FYJE 1MW1A 4I3SH 1E30A 3J8F7 3GTNA 1TZGL 1RZPA 4HW6A 4MJ5A 4MSWA 1Q94B 1KJ2H 1HHIA 1MI5D 2DMGA 4J3OC 3HS8A 1A6AB 3WIHL 4E9WA 2BO0A 1F4HA 1S9XA 3OL2A 5HVHB 4P2YA 4BJLA 4W9KC 2YQ3A 3ULVH 3U7WH 1U4FA 1AZBA 2AI0L 2YPLE 2HG5B 2OR7A 3H6AA 4LHUB 4PWGA 3NK3A 3WNOA 4A7GA 1GGIL 4CMHB 3JQOB 3UROR 4N0CC 4I7ZC 2NXYB 2OXHB 4HLJA 1QEWA 2B3IA 2APTA 4RNRB 1AZCA 3LVTA 3MKGA 5BRZA 1UGNA 5AOKA 2PO6C 5DJCA 3DX6A 4IQHA 1PKQE 3KWXA 3LZRA 3SJVE 1DANU 3LKQB 1E2WA 4YC2B 4JPKL 4WWOA 1AYRA 2P5ED 4JFFA 2R0WH 4AW4A 4UBDD 4DAGH 4DGIL 3CSPA 3MSPA 2NWVA 1WFMA 3D50A 4FI6A 1AZVA 1K5NA 3IDGB 2FUVA 1LQSR 5IBTH 4IOSA 4BRVA 2DQDL 4U3SB 4K8RH 1M7IA 3P1VA 1BBJA 3U7AA 4Q8BA 3FSZA 2CIIB 4LLVB 1SF5A 2P5WD 2I7SA 3ILPB 3IRCA 4IBZA 4WO4A 4DIXA 3FO2A 3RZCB 5FA3B 2AJZB 4MJIA 2MPAL 2ZX7A 3QE5A 3MTXA 1M1XA 3P0YL 2WLZA 4XMKL 1JHTB 3AXLA 4FXGA 5JHAA 2R0LL 3QJQB 3K6NA 2W0LA 2PP8A 2HFGH 3LXUX 3UBXA 3S9DB 4C57C 1CMOA 5EPMB 1SHSA 5GQBA 3I02B 2YOCA 1MHHA 1UUNA 5EV7A 2AAVA 1TJHL 5FFLA 4L4VE 2EXYD 1CFVL 4P5SA 2HZSA 1YMMA 3NZUA 3CDZB 4FFYA 5F0PB 1YC8A 5CINL 5E8PB 3CDFA 4RMWA 3SDDC 3GMMA 4GKLA 5DC2A 3SY0A 3AROA 5A2BA 3TNMB 4HDIB 4L4TE 3I9AA 4NO2B 1WPCA 3V4VH 1CDYA 1U3JA 3NJVA 1FNEA 5IEKA 4YDJA 2NQCA 1JJUA 4YR6A 4QGYA 3AQYA 5IQLA 4NHUA 1ZE3H 2JJSA 3CWTA 1DUZB 25C8H 3LZLA 3X3FL 3BYYA 4N2NA 2OKMA 3MRDB 2X1XR 4X7CC 5EORL 4E5XB 4C56E 2QMKA 1VLXA 4RAHA 2AJSH 3O0RH 1Z9NA 3TX4A 2QLVB 4UDTA 1BFVL 1CE6B 1MCOL 5E2TH 4JKPL 1H6TA 4CC0A 3AJ7A 2AXFA 1E4XI 1AXTH 4FFZA 5IQNA 2XZQH 4AGQA 4TTDC 3ZMNA 1QRKA 5FK9A 1OP5H 4CSTA 3HTLX 3P2TA 3T8VA 3SOBL 1LWYA 1XL6A 5DVMA 2FGZA 3HI1A 4QXGH 43C9B 3IB4A 3WUWB 5JW4N 3NJHA 3ELQA 5KVGH 2CBMA 4BA0A 5CM1A 4KXCA 3B7RL 3DUUA 5B22A 1GTNA 2O3OA 4F7MB 1KDIA 5C09E 3SDCB 2P5EE 2PR9A 3IBOA 1A2YA 5I76A 1FL3A 1OLZA 4PBDA 4MXQD 3WIFB 2HRPL 3IDNB 1JUFA 4MA3B 2F9BT 1MQKL 4TF4A 3IM1A 2BVQA 1BV8A 1KLFA 1M57B 1MFCL 5CZRA 2P5WE 1R24B 5F9OL 4ZNEE 4Y4KA 1NDMA 2XHIA 5IGXH 4P4RB 4LNRB 3HR5B 2FBJH 4IJTA 4F7TB 4RA0C 2CPUA 3V2AR 2VR3A 3CIQA 3B9DA 5IOKA 4PJIB 1K35A 2OX5A 1XTLA 3DURB 3IGAA 4UT9H 3OAUL 4JFFD 3LHAA 3T3MB 4MB3A 4MS8D 3QUYC 1OALA 5KBDA 2YN5A 3DOSA 2H41A 5JIPA 3SYCA 1TZ8A 1R3JA 1IM3A 5IVXB 3VA6A 4P2AA 1AGCA 1EHLL 3ATEA 1G94A 1CF8L 1G7JB 2Y5TA 4O02L 4Z18A 2OR9H 2ICWJ 3COOA 3EGDB 1BZ9A 4YHPB 1JCVA 1K72A 5K39A 4F20A 1XTMA 3NA9L 4N8VB 3SDXF 1MCIA 3BAXA 3PPEA 4BFRA 3LPOA 5CN1A 3MXVL 3TBBA 4N1EA 3RY6A 1HHGA 4P46B 3V0VB 1I7RB 5HHOB 2I5YL 2ZX9A 3GSWB 3VXPA 4X5LA 2BSDA 4NQEB 4LCUB 3RG1C 1I1RA 2BSED 3NAAH 1B0RA 3POHA 4EI6B 4LGRB 3QUXB 3TCLA 1YMMD 4I0PA 1E4KA 4BZ2H 4MA1B 4M1GL 2PXYD 5F7FA 4RWYL 5AOMA 4R7DA 2PW2B 4K9EH 4GINA 4KRPC 2COVD 2IAMA 2VZ1A 5D72L 4OKVA 4KZDH 4HHGA 3FQNB 4UILL 3T2PA 4W4NA 4FZEH 3B3IA 4Q6YA 2D4DA 4GFXA 4C47A 3O8XC 2VXSL 3FJTA 2GI0A 4YHIB 4PVMA 3O6KL 2FQEA 1BPLB 2J88H 2DYRB 4NO3B 4W9LC 1ZS8A 4HG4K 3DVFA 4FKHA 5DJ2B 5CEXB 1P84K 5HHPA 5AWNL 4X7TB 4QI3A 1DBBL 3LKOA 1MCPH 4AJVA 4ZMWA 1L9TA 4D7RA 1T1XA 4QRSA 5KBMA 1Y07A 1A6WL 2EDRA 2BCMA 1K85A 2PO6B 1VTOA 4NX0A 2IALB 1YMHB 1MN4A 2ZNWA 2W07A 2X2IA 2HTLC 4GEIA 2X40A 4B41A 3AAZB 2Y07L 1CU4L 1P7QD 1XQ4A 1PG7W 1QOKA 1TVHB 3SCMD 5BRZE 4F7EA 4GIPD 4MDRA 2A3TA 3GMQA 2B16A 3FMGH 2Y36L 2Z93B 4ONOA 1ZTXH 3MTRA 4JFFE 2ZD0A 3INOA 1FRGL 3H7BA 4WV1C 3BSZH 3ZDYE 1Y0LA 3HI6L 2X09A 5CEYA 4NM4H 4HSQA 3QUZA 3L95A 2PWDA 2FJHB 1JWSA 2Y5QA 1NLBL 4OB5L 5TDPA 3QCTH 1QSEA 4MJIE 3K4ZA 3LZFL 4NT6B 5I19L 3INUH 3L2NA 1W2KT 1PDKA 4NKMA 3HCVB 5K9JL 1EJ8A 4FCAA 3SDDB 4LVNC 4A1RA 3QQDB 4UBDC 3OKDA 3MUHL 4ZW8A 4NBZB 3VSQA 3WFHB 4M5ZL 3BRDA 1IM3D 2VXQL 3OGCB 3OZ9H 4FQHB 1NWOA 2WLLA 3RNQA 3S3SA 4AQEA 5BUGA 2R4RL 3OZKA 4YFLF 2X53A 1R19A 5CMAB 2Y2YA 2CCVA 2EYTA 4MJ6B 4TVUA 4OGAC 1PVSA 2NTFB 4YBLC 4R5XA 2ZUVA 4ZO7A 5DVPA 4G6KL 3PIQB 5BW7C 4OV6F 4JRLA 1VFBA 4NP9A 5A1AA 3DPBB 3LEVH 3S36H 1R3LB 3QDJA 3HZVB 4OZGE 4JY5H 5KWYC 1IBDA 3HRPA 3EYUL 1U6AL 3K3QA 3HAEB 1RIHH 4F7CA 5E8DH 4FTVA 1B6DA 4F9PA 4QLRA 5H94B 3VM5A 2VMCA 3REVA 5JLZB 4D9LH 1MFAL 4JRXB 3V4LA 2K3HA 2IAMD 5IMOA 5LN4A 5CP3H 3ZIMA 2R8SH 4JPWH 1B4LA 4HT1H 3I0WA 3Q2VA 3QJTB 1EFXB 2VN6A 3TTSA 5TF0A 3G6AA 1WBYB 5F1IA 4IKIA 3CFJA 4ELKA 3WS3B 5K9QI 1U58A 2CKBA 1LM8V 1OB1B 5E1AB 5LAXA 2FBOJ 1T5WA 2WQRA 3KWVA 3U2SB 1E4XH 4DCQA 3ZDZB 1KYDA 1WEJL 3O6FD 2R39A 2X2HA 4I88A 4UB0L 5KYUA 4GI6A 2V5TA 3L3DA 2H0FA 4ANWA 5L2JA 1H6EA 1JPGA 3TPUB 4ERSH 2FNBA 4JO5A 5KYWA 3HG1D 2VCOA 3QUYB 3WLWD 2YPLB 2Z0UA 2QQLH 4NRXB 1TJIH 4E2OA 2D2CC 4PJDA 2ZKXA 1NEUA 2A1WH 3DSFL 1W72H 1XD1A 3GGWA 3I85A 5FYLH 3NTCL 1WQAA 4XPAL 1C5BL 2FATH 1NCOA 4JM4L 4JANA 5DHDA 3V55A 4N2AA 2ZCHH 4YQXH 4P2QD 1OTSC 32C2B 4NQSA 4Z7UA 4WUKH 5JMOC 5FDYA 3OSEA 1PKQB 4KK8C 3SJVB 1I3GH 2QHRL 5DLMH 3N89A 3B7YA 2YD6A 3ARGA 2OJZH 1ZEAL 3IJHA 1AC6A 2VUOA 1INDL 4PD4K 4AH2B 3IFLL 4ZO9A 4G82A 3MLVL 5LN8A 2VJ8A 4DNLA 1RCYA 1YEFL 2GJPA 1AGEB 1IJNA 2WUBL 2EAEA 2WO3B 4P4KA 4YOKA 4L3ED 5HSHA 4Q74A 3UO8B 3D69B 3NFNB 5GRJH 3UOAB 2CLZA 4JRWA 2ZCLH 2ZXBA 2ATPA 4ZXBA 4B9PA 3CZKA 2GKIA 1FBIH 4KRPB 3D34A 2JELL 1DZ0A 4L9DA 2W0FA 2R7EA 1TZIA 3PGDA 1YN6A 1UWFA 2VB5A 3O8XB 4LLWB 4XWOD 4WO4C 5E7FA 4K7PL 3WAKA 2BP8A 5G4NA 1A4AA 1YPZF 3S96A 2GPZA 5C0AA 4U6YB 1OP9A 3GXIA 3ENOC 3O4OC 1ZVSB 4L4VB 3T0BA 3Q2WA 2YH5A 4FXGC 1IGCL 4OW6A 4R5TA 2HCZX 3P73A 5C6TL 1J0HA 4JCMA 4WY7H 3V9CA 3MRHB 2VT0A 4TNEA 1XGQA 3VW3H 4H1LH 1F42A 1OAKH 2ZKHH 4L4TB 3S35H 3BVNA 3UZEA 4L1HA 1ICTA 4OCXH 3KYNA 4FN0A 3LNEA 4FTVD 4KKAC 4NYLA 1JVKA 1KWGA 1TO5A 1VZGA 2JSFA 5FOBA 3EZJB 4QUOA 3QZLA 1UXWA 3FAWA 3UAJD 4C56B 1FC1A 4R2GD 3BZ4B 3MYZA 4HIJB 1J8KA 1MWAH 2JJSC 3UGXA 1QZNA 2WXFA 1AGFB 3LN9A 2HL8A 1Q90A 2CDEA 2DD8H 1E6OL 4OZFB 4WUUA 1CLZL 4WV1B 4I1RA 4ZZFA 4NKDB 4GYBA 2P24A 4XBGA 2EH8L 1S3KL 1UURA 1FFOB 2H32A 1CD0A 2YQ2A 3DV6B 4WTZA 3T65B 4OV5B 2R83A 4NUJA 1DVFA 1AGDB 1WWWX 4J3WA 3FTWA 3X1EA 1Q38A 4CW1B 2ETWA 2LVEA 3CXFA 2KBGA 1VGEL 2UWEA 5I1KL 1KIPB 1FAKT 3IJ7A 3MJWA 3LZNA 1G9MC 4LVNB 5C09B 3SDXB 2FO4B 3V9FA 1MCCA 2P5EB 4HEMA 3PWVA 5HGHB 2E8YA 4X8JB 1QSEE 2YAQA 3CIAA 3QUGA 4HZAA 2VDLB 4PRAB 3VMOA 5I17A 1C4GA 4JRFA 4LARL 3LPFA 4NNXB 2Y72A 3GSNA 1QTSA 1FIEA 2XQYK 2PABA 2R23A 4RAVB 3Q8BA 2DWEB 5EZLA 2P5WB 3HZMB 4ETQB 3UPAA 4EQ2A 2YFOA 3CVHA 4HWUA 5IKCA 4ZYKB 2AJUL 2D7TH 4XE5B 1F11B 1ZK9A 4YBLB 4H5SA 1U2CA 4JE0A 1CYWA 1U4EA 3ARGD 4Y4KC 4AUJA 1D2OA 4XN9A 2XN9A 5AW6B 3GI8H 1H8OA 3WEMA 1IFHL 4W70A 3V4PA 4Z7NF 5C0FA 4K7PX 2JCCA 2FGWL 2EECA 2L0DA 4O00A 4X7SH 4Z78B 2QR0B 3GEFA 2QGDA 3QDJE 4W93A 2YKLH 4HX1B 3KWWA 3KHOA 4Q52A 5D1ZI 1CFNB 3NACL 3QJUB 2Y22A 4P5KA 4FTVE 3U2JA 2VERN 2X89A 5FO2A 3HPJB 2Y9RT 4GP5B 4UQ3B 3SKJH 1D5ZB 3O3EB 1H8NA 5C8JA 3PWPA 3HC2A 1RZJC 2Z7UA 1WS7A 4PJ8A 3WS6A 1FP5A 3VFSA 3MMEA 4ZODA 4D0CB 1MSPA 5C2UB 1AD0A 1VGKA 2CO4A 2ZT9C 3RY6C 5DLLA 1DO5A 1PIGA 1YEKH 4NC0B 3LMJL 5E8NB 4ZSOA 4N24A 1DJXA 4NENA 5D7SL 2A73B 3ARYA 4CVZA 5F71A 1Q0YL 3BAIA 1E4KC 4I0PC 5FKPA 5I1EL 2CO2A 3T1FA 1EBPA 2WKOF 1N9PA 3A6OA 2XBDA 4ODTH 2ZXDA 4Z95L 3SDYH 4UM9A 3VD5A 4L3CA 5KW9H 1AFVH 1WH0A 4B3VA 1UXLA 4Z0XA 4IMKA 4N3TA 1OWWA 1J8HD 2IAMC 2ENYA 2K8MA 4MJ5B 4MSWB 4JFZH 4HG4J 1HHIB 1P84J 1C8QA 4I87A 4YE4H 1LO5A 4OLZH 3S5LG 4K94C 1L9OA 4XMWA 4WUUD 2HMIC 3OKLB 3GRWH 5IESL 4PJDE 4QNPF 5E9AA 3KPSA 4FABL 4U33A 1QEWB 4RGOL 2ZUWA 3FT3A 1DVFD 3KLKA 3OXRB 2DMCA 1ZGLM 3L1EA 1M7UA 4IW4C 5BRZB 2CO6A 3DDFA 1ZHNA 4Z7UE 5DJCB 3DX6B 4EAGA 2VH5H 2V5RA 4JNXA 1HHKA 5CZXD 3NSCA 3U9WA 3GM0A 4YWGH 4I1PA 3QWRA 2JTDA 4IKNA 1P4LA 2WB7A 4JFFB 3ZTCC 2VWEE 4H25A 5T1MA 5I18H 3VD1A 1K5NB 5GS1C 4Z8FH 5I66B 4KGJA 3ZDYB 4KX8A 2P47B 5EN3A 1OEZW 2BFVH 3MLXH 2VIRA 1BBJB 3FTGA 4WWKA 4L4JA 5ENWA 2V7HB 4WO4B 5KYYA 1MIEL 1ZHLA 5JUEL 2GEEA 3VX0A 3FO2B 1IC5H 1KXQA 4JY6A 1FDLH 4MJIB 3ISYA 3O4OB 5LO7A 2YD9A 1E4HA 2AKRA 4FMVA 3AXLB 1CQYA 3QUZC 4FXGB 1GS8A 1UTDA 4G5ZL 2QPFA 2FR4A 2IOOA 1AMXA 1CBVL 1MHHB 5C0AE 1J9CT 4HIPA 4G43A 1NFAA 2P1YA 4LP8A 4LKCA 4L2LA 2YQGA 3GMMB 3SY0B 4XI5D 4EI5A 1ZCRA 3ULXA 3NCBB 3HLKA 3KLAA 5AW3B 1A7QL 3MGAA 1FNEB 5IEKB 2J7LA 2DS4A 3WEOA 5FF6A 2CH8A 5BXFB 4P9MH 4YR6B 3LHPH 3SO5A 1BZ8A 3SBQA 2OZ4L 4EDXA 4NHUB 4Z3TA 3QUKA 1BQ5A 4G71B 4U1LB 5DFAA 3TONA 4NAJA 4UT7L 5CGTA 1U93A 3KL0A 4A6YA 5I1IL 2DPKA 2EUXA 3D39A 4JPSA 1XH2A 2Y7NA 4NSKA 4OZGB 3UIZA 1KYFA 1HXYB 2WVVA 3GIVA 5C0EA 3JT0A 1WBXA 1S7UA 4Y0GA 1A4CA 2LFGA 4U05A 2DTSA 3T09A 2AXFB 3DGCR 2ZF8A 1WDAA 4WUUE 1QBML 4PAZA 4BZ1H 2QBWA 3FFCD 4I3RL 2XYCA 5T3XH 4O9HL 3I9PA 2ZUQC 5FK9B 1KGXA 4F9PC 2IH8A 4UM9D 3LSOA 1IFGA 3HI1B 3QC6X 4FP8H 2GUOA 4JGNA 5FYKL 3RVTD 1EHAA 2PNDA 1QFWI 5AVSB 3B56A 2UWEE 4ZNCD 1IGYA 3DUUB 1DJHA 1RIUL 2DWSA 3RWIA 3SD5A 4HEME 1Q9OB 3F7YA 2BSRA 1FL3B 2ENQA 2VYRE 3KR3H 5D9SB 2X9XA 3H3KA 5DUPL 2H7WA 2ZSVA 4GXVH 3DROA 4P49A 4G7RB 5E6RB 5CF3A 5FYJL 2FD6H 2BVQB 1RI8A 3KPSD 4LNVA 1KLFB 3HNSL 4DPRA 2VN3A 4Y4KB 1NDMB 4BH8A 2R1XA 5CD3B 5IY5B 1UWGL 4OCNC 2NR6A 1L0QA 3B7SA 5B1AB 4NQCA 3QG6A 1OAXH 1A3RL 4G1EA 3QB7C 2FQFA 3QWRD 1XR9A 1M2VA 4G6FD 2XN9E 4D7BA 4N2EA 3DOSB 3KBHE 5FO8A 4M7KH 1R3JB 2JCCE 2QKSA 1KCBA 1AGCB 5DQJA 4Z3JA 2J6EA 4M4PA 1OTTD 3HEIB 3BKCL 4WWKD 4RODB 2Y5TB 5E9DE 1HI6A 4J8QA 4PD4J 4BQ9A 5AZEL 2VSCA 1QFWL 1NL0L 5K39B 3N85L 3GSUA 2X2YA 4RRPM 1BPVA 15C8L 4AEHH 4QDGA 4M7JH 2E6PA 2QSCH 2UZXA 4U3CA 1HHGB 4EIGB 2J57A 3ARGC 3SQOH 1SJXA 2BW5A 3PWPE 2VWEC 3B2PA 4IBLT 1KCRH 3VXPB 4IKJA 4J3OH 3MV7E 1B0RB 5DJ6A 3TCLB 4DKFL 1JYVA 4I0PB 3MLRL 3IFOA 5C2BH 4P4KC 4KTEH 2D0CA 2XA8L 4HQQH 4S10A 1RURL 4EI5D 2PPCA 4R7DB 3FQWA 4FXTA 4J4PA 4ZSOE 4BFOA 1RJYA 2Z8SA 5E6UB 4ZXBC 4KNTA 4YHML 2A83A 3K6IA 2IAMB 4U0QB 3FCGA 3TXAA 4OKVB 1XH3A 1MCJA 1PMYA 4S1RH 1NCBL 2TRHA 3A24A 3RX5A 3B3IB 5DC0A 2YGPA 2NOEA 1JTPA 4JLRB 3RWDB 3CFBA 2OK0H 1U42A 1ZWIA 1AVAA 3VFTA 3D39D 3KPLA 5I1HL 3LRSB 3AADB 1WA2X 4LSQL 3JWDH 1ZS8B 2J12B 4OU3A 5GS0H 3SGJA 1W91A 5HHPB 3RUGA 4Y9CA 3GSXA 4B5EA 5INCA 3TH3T 3ARFA 5D7JD 5I6KA 3QWQB 2R4SL 4U6VH 2C9XA 3QHFH 3SEPA 3UZEC 2JIXD 1FFTB 3F01A 3C12A 4QRSB 3UTSD 4UMSA 4XVTL 4KNUA 3HFML 1NDGA 4ELDA 1MFBH 3CZUB 3F7KA 5TGBB 5LBSA 2W07B 1OQOA 4U49A 3LPGA 5HI5C 1KF9B 4X6EA 2DYPA 3GEWB 1A7NH 4F7EB 4PJ5A 5GS1B 5C3IA 5HHXL 1QN4A 2EDHA 2YOAA 3LDBC 4MJJA 3OB8A 4MMXA 1T0MA 2X1PA 3ZSTA 1QSFE 4XMPH 4ZG1A 5LCVL 1JFIC 4OD1L 5E2VL 2V2TB 3H7BB 4B9GA 4OZHE 2CRYA 3FF7A 3K8LA 5ETUB 1Y0LB 3NCFB 5DD1L 1EEZA 4KK5C 2MNUA 2W59A 3FO0L 3OKKA 5CEYB 5IQ9A 3QUZB 3R7RA 1O5PA 2Q0ZX 2MQ3A 2Q7NA 4JKLA 1FI8C 4OFQA 1JWSB 5TDPB 3IMTA 4WZ9A 1KXQE 1QSEB 3NZSA 4HBCH 2JK5A 3J7HA 1MDTA 1PDKB 2GY5A 2VDLL 4WI6A 2VDKH 3K91A 1PEWA 3NRQA 5DD3H 2CPCA 4XCCH 2FHFA 1HDMA 1M05A 2WLLB 4AQEB 2APWA 5I1DB 1DL7H 3RKDC 2QVMA 4YPGA 1S7TA 3Q3GA 3HAEH 1PVHA 1KGIA 1A3LL 2N4IA 5HDBF 3K8MA 1MREH 2JKWA 2JI2A 1NBVL 4JG1H 5KEZA 3US1A 4RMSA 4AGOA 4NPKA 1WZMA 1ZVYA 3D39E 1HNYA 1UVQB 3KS0H 3QDJB 4AL8L 3K71A 1ETZB 4GUQA 3ULSB 1PY9A 1U8PB 4NHCH 1TTGA 4J3SA 3E3QE 4WU7A 3VXTA 4LPYA 3VDAA 1FNSL 5L9DL 2ZUQB 4FTVB 1UWEL 2VQ4A 5IFAH 4M9OA 4NPYA 3DO7A 4LSPL 2ZPKH 3L9EA 2D7NA 5JHLH 4J4PD 3REVB 5FGBA 2BIQA 2ZWLT 3LN5A 5BV7C 1GY1A 1E8WA 2BC4A 2A5UA 4UAHA 4TQEH 1MCBA 4X9HA 5IW6A 3JV6A 3HHRB 1FG9C 4A7TA 3ZK0A 1V3KA 5C07A 4LSVL 4YE0A 5LBGA 1D5IL 5F1IB 1ZT1A 5KJRL 4ELKB 2X7LA 4PJ8C 3WS6C 1U58B 2CKBB 2VLRA 3C5ZA 3Q0HA 3WNPA 2DQFA 1LE9A 1PZ5A 3D0VA 1RUPL 5LAXB 4FQQB 3EFFB 2BIMA 4DCQB 1GZHA 3FRPA 1UKQA 3PP3K 4JZJA 2A9AA 4YGAB 4CNIB 2NXZD 5D6CB 1C1EH 1CGSL 1SRDA 5KYUB 1WYJA 3L3DB 3NN8A 3QWOA 1CLYL 5L2JB 1JPGB 1NFIA 5L4IA 5GGVL 1ZLSL 4K07A 4N5UA 1QW8A 1UXMA 4YBQC 1XCXA 3WSQL 1HH6A 3ZHNA 2C9QA 2V5SA 4RFEA 1NVPA 4G3YL 2HT3C 1KTKE 4PJ5D 1N4XL 3UBXI 1SJEA 5EO0A 4NQCE 4AJWA 4PJDB 2PETA 2FQDA 4PLJC 5I15L 3GGWB 1YTBA 5CKAA 4S2SB 4HJ1A 2JMRA 2QRCA 4JANB 2ZXEB 5EZOH 3VI4A 1BAFL 2Z8WC 2FX9L 2VXTH 4NQSB 3GLDA 4Z7UB 5JIQA 5M95B 3EH1A 3L3JB 5B7MA 3ARGB 1EWHA 3IJHB 4KY1L 3SE8H 1GJIA 1IIIA 3R8BB 2JQZA 4XB7A 1T7XA 4M6AA 5BZXA 1I8IA 2V5MA 1HXMA 4TRPH 5IMLA 5J1SC 3IU3B 1M4KA 2CE6A 4FC3E 4P4KB 2D0HA 2RCSH 4XNYL 1OCRB 3S5ZA 2CLZB 3NG5A 2BRRL 3SGEI 2ATPB 3M8OH 4ZXBB 4EE2A 1FGNL 3GZPA 2W0FB 3P40A 2R7EB 1OTTC 2XACC 4WWKC 1TZIB 2UY6B 1YN6B 1IBHA 3PGDB 1CURA 2I9TB 2LVCA 4C4KT 1RJZA 4JO3H 4RFOL 5I1AA 1XB6A 4JN1H 4NQVA 1XCTA 5DHVA 2BP8B 2WCPA 5DI8B 4XVOA 2VISA 1UGKA 1YEDB 5C0AB 4PJAF 3S96B 1GXEA 2VW4A 1PFCA 5JIDA 3VRIA 3FUEA 4HIXH 3P73B 5AAWA 2ZSWA 1XGQB 3HMXH 4JFYA 3BVNB 4HPYH 3L16A 3FS9A 3KYNB 5ECGA 2VR6A 3N0AA 3RUGE 3LOWA 3X1NA 4NYLB 4PLKC 2H9GA 3C2AL 4KKQA 2FSDA 4FX5A 4LCWE 2O30A 4N26A 3SPIA 2UY7B 1IEBB 1HESA 2A6KA 1LVEA 2OMWA 5FOBB 3VJ6B 2Y1YA 4A2MA 1HNGA 5I1JL 5JW3H 3AITA 4AMWA 3SYAA 5CZVL 3LDBB 3QEGL 3BAKA 2W9DL 2MCAA 3OC5A 4YSPA 3LS4H 3BAWA 1UA6L 2EIJB 5FHBL 1KCVL 3DO4A 3U4EA 3F83A 3MV9E 2X4PA 2CDEB 3O2DA 1HCFX 4WUUB 3EADA 1V3JA 1LHZA 4TUJB 3C5ZD 1IBGH 3E3QC 4B9KC 2P24B 4XBGB 5AVQB 4AYBA 3MGTB 2H32B 3UTPD 3RQ3A 1FJ1B 4NUJB 5I75C 2AGJL 1IBYA 5I5IA 3VQMA 4GMTL 2UWEB 4U1JB 2J21A 1Z9SA 3WL9B 4F57L 3PWVB 3N91A 4HGMA 3FO9A 1FVDA 5AW7B 5I17B 1G7LA 5KS9A 1QPPA 3D51A 4ICXA 1WZKA 4RX4D 3GSNB 2WVUA 4ZUWA 4NN5C 2VR4A 5IT2L 1CE1H 1HC1A 4LP4A 4BINA 5EZLB 4ZW3A 3LKPA 3CVHB 3Q2NA 2PWHA 2WXNA 2HP4A 4XPHL 4DKAA 3TA3C 4DP0X 4H5SB 3GHEH 4J1UA 3V0AC 4AQOA 1WIUA 4PB9H 2QSTA 3H4FA 1X5JA 5GRVL 1OTUC 1QNAA 1YY8A 2XN9B 4PCKA 1WA0X 3GBDA 2NR6C 2C3GA 3MRLA 4LLQB 2JCCB 4OI8A 3KGUA 3RYMA 3VD9A 2V9UA 3PXHA 1AG0A 1IAII 1RHFA 4NWTL 2B4CH 5IW1A 5E9DB 2XC8A 3VXOA 1UATA 2F1EA 2EDEA 3RI5K 1G5GA 3KWWB 3LY6A 5BV7B 1NGPL 3N55A 5EF3A 3RWEA 4QXTA 3KPRA 2Z4QB 12E8L 3KBPA 1ET7A 5JPMA 1FN7A 1WIPA 1QA9A 2A2QT 3F6IA 3UTTA 3PWPB 2X4TB 4LL1A 2IQ9L 4Y4HA 5L88H 3L2LA 4EJZA 1SMOA 1T83A 1AP2B 4RGND 3MV7B 4FF9A 5EEYA 3FTXA 4PJ8B 2ZP8A 4ZUUA 3U30C 3MMEB 1AD0B 5FYKD 1M71A 1VGKB 3AC0A 4W81A 5D7HA 3NIGE 5C07E 4AV5A 4UV7L 4EAKA 5BZWA 4ZSOB 2MKWA 5FCUH 4KX7A 4H13C 2VLRE 4CVZB 5FKPB 4KV5F 1OPGL 2LAGB 1IO4C 4UT6L 3UTPE 3T1FB 5GGQH 4A2HA 3LIZH 1J5CA 4AKPA 4O5LL 3WU1A 4N2DA 2YRLA 4L3CB 2EE9A 5KSBA 4N0UA 4XWGL 2CHNA 4Z0XB 4K94L 4ODHL 1C16A 3NZHL 1LGVA 3ZXAC 3BH9A 1LO5B 1ERNA 4XO9A 1Q9LA 2P3YA 2YZ8A 4XC1H 2ITDB 2CGRH 4X4ZA 3TYGH 4WK2B 2NCEA 1NGXA 2P46B 3PDGA 3SGJC 5ILTL 3G6JF 4QY8A 3T1WA 3M07A 3ARFC 4XP1L 3FT3B 4XNDA 4G8GD 3TBSA 3UX9B 2AW2A 3OAYH 1N5YH 2CO6B 3VI4E 3TEYA 2CCWA 1RIVL 3IE4A 3BVUA 1HHKB 5CJOL 4WGKA 3D4VA 1NOLA 3EJCA 5DVNA 1KENL 1QSFB 1OSEA 4H25B 5T1MB 1QBBA 3RB7A 5EO9A 2VGLM 5K5YA 1QWHA 1XEDA 2Q76A 4OZHB 4D0BB 3NBNA 5D7IE 2R59A 4OLWH 4IIQA 2XLLA 1KFAL 1INEL 4MMXC 3LVEA 4KFZC 1IKOP 4WWKB 3MOAH 5ENWB 4O58L 2G3XA 4FFYH 3U1SL 5KYYB 1QX1A 4JDEB 1ZHLB 1GZPA 3UTZA 1T6WA 4TPRL 2CG9X 1HH9A 1F3JB 2XTSA 4HGWA 2MTAA 5JHDA 2HX8A 4WI4A 2AKRB 3EYSH 5EOQL 4ROCB 1ZSDA 4JGMA 2H8PA 1IGMH 3ESPA 2JLLA 2FR4B 2WXOA 2WIMA 3EBHA 1M7XA 2YRPA 3F04A 4G43B 1NAML 2ADGA 5GIRA 1D3CA 3A21A 3TN0A 3W9DA 5ITBH 3W82A 4LKCB 3KVQA 1A9EB 2RTTA 3T2LA 3AGWA 4HJJL 1PKOA 1GSKA 3MQIA 5EA0L 3KLAB 1WFNA 4HOMA 3RAJL 5IHWA 2DH2A 4AY0A 4HS8L 3MR9A 4WTWA 2I24N 2IC2A 3KPRD 1I75A 5IREA 4Z23A 1U41A 3QUKB 5EF1A 2Z8UA 5I5MA 2NZ9D 2WNXA 1U93B 4HXAL 1LD9A 3UTTD 1OSYA 4FLRA 5HYJA 3D39B 4Y4HD 2VW7A 1XSZA 3QFDB 4NSKB 3L5XH 3GIVB 2WVVB 3S98A 3U7YH 5C0EB 1H8SA 1FUNA 1NCCH 3S2CA 5TE6L 2YAPA 1S7UB 2IDFA 2IFFL 2IXQA 1C9BB 4Q9CA 5I75B 5EOCL 3LEYH 3A6BH 4MLIA 2X70B 5AEAA 1G6VK 3EH4B 3NEXA 2DICA</