2QREA

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-d-ribofuranotide (zmp)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
109
Chain Sequence
KWHFGVRCRGDAPEILLAVYRALQRAGAQFTVPKPVNSDMYTIKSRWEIPHCKREGKNTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSKSSFPFLDLCAMLVCKLFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 29
structure length 109
sequence length 126
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2qreA00
1UL7A 3TE5A 2V92A 2EHBD 2QR1A 4EAJA 4EAIA 4EALA 2QLVA 3OSEA 2ZFDB 2OOXA 2QRDA 2Y8QA 2OOYA 4EAKA 2QRCA 2V9JA 2QREA 2Y8LA 4CFFA 2YA3A 4EAGA 3TDHA 1V5SA 2V8QA 3T4NA
chains in the Genus database with same CATH superfamily
1WJWA 4HJHA 5F9CA 1YTFA 2JHNA 1Q9UA 1PZDA 1TBAB 3ASMA 2NOFA 2NWVA 2D0BA 2LAEA 1PVSA 3KRMA 3N89A 4Q11A 1QN4A 3PDKA 2NOEA 1YQLA 1J3MA 3C04A 3I3WA 1VOKA 2MJ7A 1KY6A 2FUVA 2NOHA 1RM1A 2IV8A 2QLVA 2HKPA 3OSEA 1QN5A 2F7LA 1LXTA 1HU0A 1YQKA 1PCZA 1P5GX 1EBMA 4EAKA 1YTBA 3CWSA 2IV9A 2Z8UA 4I8OA 3I0WA 1QNEA 1KY7A 3ULXA 4B0AA 2QRCA 1NVPA 3OSTA 4WXAA 1QNAA 1LWYA 1V5SA 4WX8A 4PY5A 1KYFA 2HL8A 1TGHA 1M3HA 3T4NA 4DULA 1UL7A 3TE5A 4D7RA 1WQAA 2EHBD 1QTPA 2XHIA 1N3AA 3CWAA 3CWUA 4EAJA 5IYBP 1MPGA 2FKFA 3D7QA 5IYDP 3F0ZA 2HL9A 3DPUA 3F10A 1PCMX 1QNCA 4EJYA 4EALA 2FKMX 1MP9A 4RODB 2OOYA 1YQRA 1T6AA 1C47A 2O3OA 3RSMA 1LWVA 4EJZA 4WZSD 3RPJA 3OCIA 1QN7A 2PWWA 2NOIA 2H5AX 2D0AA 2YA3A 2NOBA 4EAGA 2JOIA 3OSMA 2NVMA 3TDHA 2V8QA 5JN5A 3IH7A 3EIKA 2JPIA 1EUVA 2FGTA 2ZFDB 1VTLE 1K2YX 3D4VA 5AN4A 1VKLA 2D0CA 3OLPA 5EPCA 2Z0FA 1KFQA 1KYDA 1PCJX 1K35A 3ENOC 1KFIA 1UT4A 5IYCP 1DIZA 4TPSA 1QN6A 5BMNA 3CVSA 3NA5A 2DKDA 2NOZA 3VN5A 3OGDA 3EAYA 3UW2A 4EAIA 1YQMA 1VOLB 1TBPA 3CWTA 1M5Q1 1KO9A 5KL0A 1QTSA 1TUOA 1AISA 3ENCA 2OOXA 1NGMA 2MZ8A 1QN3A 2QRDA 5BMPA 1QN8A 1W80A 4QG5A 3H1ZA 2Y8LA 4CFFA 1QNBA 3SNSA 3OH9A 2HZMA 3PMGA 3DPTA 1JFIC 3CW7A 1C4GA 2G30A 1R4XA 1UT7A 2DKCA 2V92A 4ROEB 5HSHA 3HS8A 5JMVD 2QR1A 1VTOA 1QN9A 1NH2A 3OH6A 1C9BB 4ROCB 1B9KA 1CDWA 1P5DX 2R5XA 1E42A 2H4LX 2JHJA 4BJUA 2VJ0A 4IL8A 1XSZA 1JDYA 3HS9A 3KTUA 2Y8QA 1FN7A 2I5WA 3OC3C 2HZSA 2DKAA 1N39A 2V9JA 1D3UA 2QREA 2NLVA 2YH5A 1N3CA 2NOLA 1LWWA 1KYUA 4C7PA 1M3QA 4MRQA 3CVTA 4D7QA 3BKQX 3I0XA
chains in the Genus database with same CATH topology
1UL7A 3TE5A 2V92A 2EHBD 2QR1A 4EAJA 4EAIA 4EALA 2QLVA 3OSEA 2ZFDB 2OOXA 2QRDA 2Y8QA 2OOYA 4EAKA 2QRCA 2V9JA 2QREA 2Y8LA 4CFFA 2YA3A 4EAGA 3TDHA 1V5SA 2V8QA 3T4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UL7 A;  3TE5 A;  2V92 A;  2EHB D;  2QR1 A;  4EAJ A;  4EAI A;  4EAL A;  2QLV A;  3OSE A;  2ZFD B;  2OOX A;  2QRD A;  2Y8Q A;  2OOY A;  4EAK A;  2QRC A;  2V9J A;  2QRE A;  2Y8L A;  4CFF A;  2YA3 A;  4EAG A;  3TDH A;  1V5S A;  2V8Q A;  3T4N A; 
#chains in the Genus database with same CATH topology
 1WJW A;  4HJH A;  5F9C A;  1YTF A;  2JHN A;  1Q9U A;  1PZD A;  1TBA B;  3ASM A;  2NOF A;  2NWV A;  2D0B A;  2LAE A;  1PVS A;  3KRM A;  3N89 A;  4Q11 A;  1QN4 A;  3PDK A;  2NOE A;  1YQL A;  1J3M A;  3C04 A;  3I3W A;  1VOK A;  2MJ7 A;  1KY6 A;  2FUV A;  2NOH A;  1RM1 A;  2IV8 A;  2QLV A;  2HKP A;  3OSE A;  1QN5 A;  2F7L A;  1LXT A;  1HU0 A;  1YQK A;  1PCZ A;  1P5G X;  1EBM A;  4EAK A;  1YTB A;  3CWS A;  2IV9 A;  2Z8U A;  4I8O A;  3I0W A;  1QNE A;  1KY7 A;  3ULX A;  4B0A A;  2QRC A;  1NVP A;  3OST A;  4WXA A;  1QNA A;  1LWY A;  1V5S A;  4WX8 A;  4PY5 A;  1KYF A;  2HL8 A;  1TGH A;  1M3H A;  3T4N A;  4DUL A;  1UL7 A;  3TE5 A;  4D7R A;  1WQA A;  2EHB D;  1QTP A;  2XHI A;  1N3A A;  3CWA A;  3CWU A;  4EAJ A;  5IYB P;  1MPG A;  2FKF A;  3D7Q A;  5IYD P;  3F0Z A;  2HL9 A;  3DPU A;  3F10 A;  1PCM X;  1QNC A;  4EJY A;  4EAL A;  2FKM X;  1MP9 A;  4ROD B;  2OOY A;  1YQR A;  1T6A A;  1C47 A;  2O3O A;  3RSM A;  1LWV A;  4EJZ A;  4WZS D;  3RPJ A;  3OCI A;  1QN7 A;  2PWW A;  2NOI A;  2H5A X;  2D0A A;  2YA3 A;  2NOB A;  4EAG A;  2JOI A;  3OSM A;  2NVM A;  3TDH A;  2V8Q A;  5JN5 A;  3IH7 A;  3EIK A;  2JPI A;  1EUV A;  2FGT A;  2ZFD B;  1VTL E;  1K2Y X;  3D4V A;  5AN4 A;  1VKL A;  2D0C A;  3OLP A;  5EPC A;  2Z0F A;  1KFQ A;  1KYD A;  1PCJ X;  1K35 A;  3ENO C;  1KFI A;  1UT4 A;  5IYC P;  1DIZ A;  4TPS A;  1QN6 A;  5BMN A;  3CVS A;  3NA5 A;  2DKD A;  2NOZ A;  3VN5 A;  3OGD A;  3EAY A;  3UW2 A;  4EAI A;  1YQM A;  1VOL B;  1TBP A;  3CWT A;  1M5Q 1;  1KO9 A;  5KL0 A;  1QTS A;  1TUO A;  1AIS A;  3ENC A;  2OOX A;  1NGM A;  2MZ8 A;  1QN3 A;  2QRD A;  5BMP A;  1QN8 A;  1W80 A;  4QG5 A;  3H1Z A;  2Y8L A;  4CFF A;  1QNB A;  3SNS A;  3OH9 A;  2HZM A;  3PMG A;  3DPT A;  1JFI C;  3CW7 A;  1C4G A;  2G30 A;  1R4X A;  1UT7 A;  2DKC A;  2V92 A;  4ROE B;  5HSH A;  3HS8 A;  5JMV D;  2QR1 A;  1VTO A;  1QN9 A;  1NH2 A;  3OH6 A;  1C9B B;  4ROC B;  1B9K A;  1CDW A;  1P5D X;  2R5X A;  1E42 A;  2H4L X;  2JHJ A;  4BJU A;  2VJ0 A;  4IL8 A;  1XSZ A;  1JDY A;  3HS9 A;  3KTU A;  2Y8Q A;  1FN7 A;  2I5W A;  3OC3 C;  2HZS A;  2DKA A;  1N39 A;  2V9J A;  1D3U A;  2QRE A;  2NLV A;  2YH5 A;  1N3C A;  2NOL A;  1LWW A;  1KYU A;  4C7P A;  1M3Q A;  4MRQ A;  3CVT A;  4D7Q A;  3BKQ X;  3I0X A; 
#chains in the Genus database with same CATH homology
 1UL7 A;  3TE5 A;  2V92 A;  2EHB D;  2QR1 A;  4EAJ A;  4EAI A;  4EAL A;  2QLV A;  3OSE A;  2ZFD B;  2OOX A;  2QRD A;  2Y8Q A;  2OOY A;  4EAK A;  2QRC A;  2V9J A;  2QRE A;  2Y8L A;  4CFF A;  2YA3 A;  4EAG A;  3TDH A;  1V5S A;  2V8Q A;  3T4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...