2Y8QA

Structure of the regulatory fragment of mammalian ampk in complex with one adp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
158
structure length
104
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKNSCTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structure of Mammalian Ampk and its Regulation by Adp
pubmed doi rcsb
source organism Rattus norvegicus
total genus 23
structure length 104
sequence length 158
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2y8qA01
2QRDA 2QRCA 4EAIA 2OOYA 4EAGA 3TE5A 2OOXA 4CFFA 1V5SA 2EHBD 2YA3A 2V9JA 4EAJA 2Y8QA 2QLVA 2QREA 3T4NA 3TDHA 2QR1A 2V8QA 2V92A 2Y8LA 4EAKA 1UL7A 3OSEA 4EALA 2ZFDB
chains in the Genus database with same CATH superfamily
2Z8UA 2QRDA 1QN4A 3OSMA 1YQKA 2FGTA 1QN5A 1QN6A 1WJWA 2D0AA 4C7PA 3ULXA 2G30A 2H5AX 5AN4A 4B0AA 1RM1A 1N39A 1VOLB 3PMGA 1QN9A 3KRMA 3CW7A 1KY7A 1PVSA 2DKAA 3HS9A 1NGMA 3CVTA 2QR1A 2V8QA 1E42A 3D4VA 5IYBP 3D7QA 2V92A 2JHJA 1B9KA 3EIKA 1PCJX 2HZMA 3ENOC 4Q11A 1JDYA 3OLPA 1KYUA 1D3UA 3CVSA 3VN5A 2F7LA 3I3WA 4DULA 1VTLE 1J3MA 1QNAA 1UT7A 2QRCA 1LWWA 1TUOA 3OGDA 2OOYA 1AISA 3TE5A 1QN3A 2MJ7A 3OCIA 1KO9A 1NH2A 1QNEA 4MRQA 1HU0A 1V5SA 1K35A 1Q9UA 2EHBD 2V9JA 3F0ZA 3I0WA 2Y8QA 1C47A 2Z0FA 4WX8A 1XSZA 4HJHA 1YQLA 2R5XA 3OSTA 1VTOA 1JFIC 1QN8A 3HS8A 5IYDP 3OH9A 1M3HA 4WZSD 5HSHA 2HKPA 2NOZA 1LXTA 2NVMA 3NA5A 3ASMA 3CWUA 2H4LX 1TBAB 1DIZA 1YTBA 3N89A 3OC3C 1QN7A 3C04A 4D7RA 1TGHA 2YH5A 2HL9A 4EAIA 1TBPA 2HZSA 2OOXA 4CFFA 1QNBA 2NOLA 2XHIA 1KY6A 2NOBA 2FKFA 1EBMA 2O3OA 3CWTA 1UT4A 2YA3A 4IL8A 5BMNA 1YQMA 1NVPA 3F10A 1KYFA 1KYDA 5JMVD 1K2YX 1YTFA 4ROCB 2DKCA 3BKQX 2QREA 4PY5A 4BJUA 2NOIA 1N3AA 2MZ8A 3TDHA 3KTUA 1LWVA 1MPGA 5BMPA 3DPUA 3UW2A 1KFQA 1WQAA 1PCZA 3OH6A 1R4XA 1VOKA 2HL8A 2VJ0A 5F9CA 3I0XA 5IYCP 1C4GA 1MP9A 3RPJA 1QNCA 1PCMX 3EAYA 1M3QA 4EALA 2I5WA 2FUVA 2JOIA 4D7QA 2D0BA 2ZFDB 1P5GX 2NOFA 2FKMX 2NLVA 4EAGA 3CWSA 3DPTA 1FN7A 1C9BB 1P5DX 1YQRA 4I8OA 1EUVA 3CWAA 2JHNA 2JPIA 4EAJA 2IV9A 2NOEA 3RSMA 2LAEA 2QLVA 1W80A 2NWVA 1PZDA 1QTPA 1VKLA 3T4NA 3IH7A 4ROEB 1KFIA 4EJZA 4WXAA 2PWWA 3ENCA 1LWYA 4QG5A 1CDWA 4TPSA 5EPCA 1N3CA 2DKDA 3SNSA 2Y8LA 4EAKA 1T6AA 2IV8A 3H1ZA 1UL7A 4RODB 2D0CA 3OSEA 1M5Q1 3PDKA 5JN5A 1QTSA 2NOHA 4EJYA 5KL0A
chains in the Genus database with same CATH topology
2QRDA 2QRCA 4EAIA 2OOYA 4EAGA 3TE5A 2OOXA 4CFFA 1V5SA 2EHBD 2YA3A 2V9JA 4EAJA 2Y8QA 2QLVA 2QREA 3T4NA 3TDHA 2QR1A 2V8QA 2V92A 2Y8LA 4EAKA 1UL7A 3OSEA 4EALA 2ZFDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRD A;  2QRC A;  4EAI A;  2OOY A;  4EAG A;  3TE5 A;  2OOX A;  4CFF A;  1V5S A;  2EHB D;  2YA3 A;  2V9J A;  4EAJ A;  2Y8Q A;  2QLV A;  2QRE A;  3T4N A;  3TDH A;  2QR1 A;  2V8Q A;  2V92 A;  2Y8L A;  4EAK A;  1UL7 A;  3OSE A;  4EAL A;  2ZFD B; 
#chains in the Genus database with same CATH topology
 2Z8U A;  2QRD A;  1QN4 A;  3OSM A;  1YQK A;  2FGT A;  1QN5 A;  1QN6 A;  1WJW A;  2D0A A;  4C7P A;  3ULX A;  2G30 A;  2H5A X;  5AN4 A;  4B0A A;  1RM1 A;  1N39 A;  1VOL B;  3PMG A;  1QN9 A;  3KRM A;  3CW7 A;  1KY7 A;  1PVS A;  2DKA A;  3HS9 A;  1NGM A;  3CVT A;  2QR1 A;  2V8Q A;  1E42 A;  3D4V A;  5IYB P;  3D7Q A;  2V92 A;  2JHJ A;  1B9K A;  3EIK A;  1PCJ X;  2HZM A;  3ENO C;  4Q11 A;  1JDY A;  3OLP A;  1KYU A;  1D3U A;  3CVS A;  3VN5 A;  2F7L A;  3I3W A;  4DUL A;  1VTL E;  1J3M A;  1QNA A;  1UT7 A;  2QRC A;  1LWW A;  1TUO A;  3OGD A;  2OOY A;  1AIS A;  3TE5 A;  1QN3 A;  2MJ7 A;  3OCI A;  1KO9 A;  1NH2 A;  1QNE A;  4MRQ A;  1HU0 A;  1V5S A;  1K35 A;  1Q9U A;  2EHB D;  2V9J A;  3F0Z A;  3I0W A;  2Y8Q A;  1C47 A;  2Z0F A;  4WX8 A;  1XSZ A;  4HJH A;  1YQL A;  2R5X A;  3OST A;  1VTO A;  1JFI C;  1QN8 A;  3HS8 A;  5IYD P;  3OH9 A;  1M3H A;  4WZS D;  5HSH A;  2HKP A;  2NOZ A;  1LXT A;  2NVM A;  3NA5 A;  3ASM A;  3CWU A;  2H4L X;  1TBA B;  1DIZ A;  1YTB A;  3N89 A;  3OC3 C;  1QN7 A;  3C04 A;  4D7R A;  1TGH A;  2YH5 A;  2HL9 A;  4EAI A;  1TBP A;  2HZS A;  2OOX A;  4CFF A;  1QNB A;  2NOL A;  2XHI A;  1KY6 A;  2NOB A;  2FKF A;  1EBM A;  2O3O A;  3CWT A;  1UT4 A;  2YA3 A;  4IL8 A;  5BMN A;  1YQM A;  1NVP A;  3F10 A;  1KYF A;  1KYD A;  5JMV D;  1K2Y X;  1YTF A;  4ROC B;  2DKC A;  3BKQ X;  2QRE A;  4PY5 A;  4BJU A;  2NOI A;  1N3A A;  2MZ8 A;  3TDH A;  3KTU A;  1LWV A;  1MPG A;  5BMP A;  3DPU A;  3UW2 A;  1KFQ A;  1WQA A;  1PCZ A;  3OH6 A;  1R4X A;  1VOK A;  2HL8 A;  2VJ0 A;  5F9C A;  3I0X A;  5IYC P;  1C4G A;  1MP9 A;  3RPJ A;  1QNC A;  1PCM X;  3EAY A;  1M3Q A;  4EAL A;  2I5W A;  2FUV A;  2JOI A;  4D7Q A;  2D0B A;  2ZFD B;  1P5G X;  2NOF A;  2FKM X;  2NLV A;  4EAG A;  3CWS A;  3DPT A;  1FN7 A;  1C9B B;  1P5D X;  1YQR A;  4I8O A;  1EUV A;  3CWA A;  2JHN A;  2JPI A;  4EAJ A;  2IV9 A;  2NOE A;  3RSM A;  2LAE A;  2QLV A;  1W80 A;  2NWV A;  1PZD A;  1QTP A;  1VKL A;  3T4N A;  3IH7 A;  4ROE B;  1KFI A;  4EJZ A;  4WXA A;  2PWW A;  3ENC A;  1LWY A;  4QG5 A;  1CDW A;  4TPS A;  5EPC A;  1N3C A;  2DKD A;  3SNS A;  2Y8L A;  4EAK A;  1T6A A;  2IV8 A;  3H1Z A;  1UL7 A;  4ROD B;  2D0C A;  3OSE A;  1M5Q 1;  3PDK A;  5JN5 A;  1QTS A;  2NOH A;  4EJY A;  5KL0 A; 
#chains in the Genus database with same CATH homology
 2QRD A;  2QRC A;  4EAI A;  2OOY A;  4EAG A;  3TE5 A;  2OOX A;  4CFF A;  1V5S A;  2EHB D;  2YA3 A;  2V9J A;  4EAJ A;  2Y8Q A;  2QLV A;  2QRE A;  3T4N A;  3TDH A;  2QR1 A;  2V8Q A;  2V92 A;  2Y8L A;  4EAK A;  1UL7 A;  3OSE A;  4EAL A;  2ZFD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...