2G30A

Beta appendage of ap2 complexed with arh peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 complex subunit beta-1
publication title Molecular Switches Involving the AP-2 beta2 Appendage Regulate Endocytic Cargo Selection and Clathrin Coat Assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2g30A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2g30A02
1TGHA 1C9BB 5IYCP 1MP9A 4PY5A 2Z8UA 1KY6A 1TBPA 1NGMA 2IV8A 1QN3A 3ASMA 2D0AA 4ROEB 1NVPA 2MJ7A 1KY7A 1R4XA 1W80A 2G30A 2D0BA 1VTLE 1E42A 1PZDA 1QN4A 1QNEA 3HS8A 1VOKA 5IYDP 3OC3C 1VTOA 1D3UA 1QTPA 1QTSA 3OCIA 1QN6A 1QN5A 3HS9A 1B9KA 4B0AA 1CDWA 2D0CA 5IYBP 2IV9A 1QN7A 4WZSD 1RM1A 1VOLB 2VJ0A 1QNBA 1QN8A 1KYDA 1PCZA 4ROCB 3EIKA 4RODB 1QNAA 1NH2A 1AISA 1JFIC 3VN5A 1QN9A 1QNCA 3H1ZA 1YTFA 1YTBA 1KYUA 1TBAB 1KYFA
chains in the Genus database with same CATH superfamily
1I9RH 3WTTA 5H4ZA 3L3DB 3QUKA 3ULVF 3PPSA 4NC1E 5KYXA 1L9QA 1FFRA 3U83A 4WCYH 2FBJH 4LLVB 5JW4Q 3V4PA 3V0VA 3K2UL 2VXTH 3DI3B 5AW6B 4BE5A 1KULA 1GOGA 1S7TB 3VWJC 3HNTH 2PP8A 2RCSL 4GQZA 3W3BA 3PP3H 4LPUA 5HSHA 4OV5B 3WDJA 4X9HA 1YO4A 1VGEH 1CFTA 4Y19E 4JFED 1OV8A 1PX3A 2CDGB 3GBDA 1BFVH 3Q3GA 5AVQB 4PW9A 5T1KB 3IS1X 4K3HA 5K59E 2WD0A 5EU5A 2VDLL 3NTCL 3LZOA 4WXAA 4A6YB 1IAIL 2XXFA 1T4WA 2DQHH 2ZCLL 2P4AB 1FAIH 1ZT1A 4BKLA 3UCRA 5BS0D 3CU7A 3D2TA 4M00A 1I4FA 3EH3B 2BVQA 3JBG7 4LLQA 4ZX6A 3PIQA 3B7SA 1JNHA 4HXBL 1NBVL 3FQUA 1KZYA 1IBHA 3ESNA 2HUEA 3CUPB 5J7CC 5F96H 4YHIA 4XCNB 5CCGE 4MVBD 1KEGL 3QIUD 4OZIB 3NIDE 4OD3L 3RTLA 3FTVA 4HK3J 4LDEB 1FL6B 3PAZA 5G55A 3O9WA 3CN1A 3D18A 1RHFA 2P8MA 2R4RH 2J55A 1OF0A 2EIMB 3RY4A 2AK4D 2X38A 1LJMA 1J0HA 4WW2C 2B1HL 4DPAX 1A4AA 4UT7H 3RDJA 1HINH 2QPUA 4NQDA 3X3FL 3KYNB 3QEUB 4GINA 4LAQL 2NY4D 1FORH 4NCC2 3QQ9C 1UT4A 3SO5A 4Q74A 3U9WA 2H6UA 3CH1A 1NLBL 1ED3A 1ILSA 1EGJL 3DJSA 1EQWA 4NM4H 4AQOA 5B7FA 1WWBX 3DOHA 3EYOB 3IWVA 3OJDA 1YNKH 2GVYA 2P44B 2H32H 3DUHA 4PP2B 3MBED 5FYLD 3V0HA 5M94B 2YKLL 3CE1A 4YXHH 4X5WA 3UTTD 2R0KH 1N68A 4P5TB 2JE8A 4TLTA 5D7KE 5EO0B 4POYA 3PJLA 1CGXA 1T21A 4D0BB 1R47A 4ONHB 5BQ7A 3VQMA 1F4WL 3AU1A 1CF8H 1UKQA 2ZAIA 2HG5A 4LL4A 3BHBA 4UV7H 4H4NA 5DYOA 5CJ8A 3ZT5A 5AAMC 1B4TA 1RPQA 1TNMA 5DS8B 3BZFB 4IBYA 4EE2A 4FL4B 4FI7A 5K9QG 4URTB 1A7NL 4A2GA 3A4EA 4XVTL 5HHXH 1DQDL 1FYTA 3L4WA 6CGTA 4ODSL 5GGQH 5IESH 1ETB1 3ALPA 1WK0A 4KTDH 1A64A 4XMVA 2C34A 4P5KA 1AHWA 3RWFA 2IALA 4K3JH 1J9RA 1T5WA 4GSQA 2PO6A 3RWGA 5HYSG 1MCIA 4MDIB 2YUZA 1X5FA 4JJOA 3FN9A 2ED8A 4LHQB 5SX5K 1YYML 3WL9B 1QPXA 1N39A 3KH3A 4IRSD 1VGKA 1CJYA 3MRHA 1URIA 3BXNB 1FNSL 1NJ9B 1PZ5A 2N4IA 5ALBH 2K9UA 4RCAA 1E5YA 1I3VA 1P7HL 3RZCA 2C26A 5AAWC 5TE7H 3I3EA 2ZSWA 3NFNA 4KK5D 1XD0A 1CLYL 3PNWA 4GI8A 1HIMH 2J88H 3BAEL 4FA6A 4FNTA 5AVTB 3VM7A 1DDHB 2B77A 2FUTA 2HKHL 1G0DA 2IV9A 4DZBA 4PCKA 1P4BH 2EDBA 4TNGA 3DGGB 4FKHA 5HPMB 2UZIL 4HLEA 4WV1C 4QXWA 2F5AH 1KACB 5CR1A 4ERSH 3L9YA 1U8IB 3UZQB 3AU0A 4BGDA 1E2VA 1FO0L 2W1NA 4DAGH 4LVOB 5DJZA 5DVPA 1OALA 1JZ8A 4LVHB 1U91B 5GS2D 1KTDA 5HYJB 1TCRA 3BUIA 3FW6A 2FQDA 3HBGA 3CVSA 3S36H 3WFBL 4YHLH 4NZFA 4OZHA 1D3UA 2VABA 2EEFA 2LT9A 2P8PA 2VUKA 2Z31A 4OFYD 3RX7A 2WWNA 5FYKD 1FUNA 2PETA 2XPZA 4FG4A 4RGND 3CCHB 4Z7AA 4HLJA 3VMNA 2YLKA 3U7YL 5FO8A 4X5PA 3VXUA 3CX2A 3AXIA 3QCVL 3QUXA 3LKSA 3QIUC 2NOZA 2VLJD 2XWRA 3MRMB 1S7RA 4NZRL 4FFYA 3RU8L 3TN0B 1HE7A 2YAHA 1JGVH 5HHME 1N3AA 4WO0A 3SDXE 3UDWC 4CGUB 3CZFA 4AXWB 3CHSA 3EDKA 4QJ3B 3UMNA 3KDMA 3K5RA 2GCYA 2GK2A 3EKCA 3MV7A 2PWEA 2ZKYA 3ZE2F 3G5XA 3MUHL 1M53A 3CZEA 4U1LA 4ZUVA 3MMEB 2NY4C 4LCUA 3K72B 2AZUA 4MFHA 1HSBB 4U1HB 3IYLW 2MPVA 1YEFH 1EHXA 4FTVB 1JCVA 2L7EA 3OXSB 4N8CL 2BNRD 3QXUA 2AXGA 4KHXH 1DSYA 3E9UA 3ZIMA 1OF2B 2H3XC 3NPSC 5DJ8B 3IAGC 5E2WH 2IXQA 2VDQB 4L3AA 3MBEC 5I0XA 5I2IA 1DJGA 3JSSA 3M88A 5A2FA 4ZAKD 4HS6A 2HYMA 2K6WA 3VGFA 4GXUM 4XMTA 1NPUA 4FHBD 1P4IH 1K2DB 5E6ID 1JCKA 2ADGB 2NW2A 2LU7A 2V3DA 3CVDA 3VTMA 4DW2H 1TVHA 2UX6A 5IFAL 3AROA 3QEQA 5LAPA 3MLWH 1AQDB 4HLZG 1B2YA 2W59A 3NJJA 2LU4A 1W0WA 1LK2A 1TZGH 2IGLA 4IOIB 4F37F 4X4YB 1YJDL 4IRJB 3A67H 2FJGA 5J13B 1OSZB 5HYEA 1OAYL 2AI0H 2YD3A 4U0RC 4F7PB 5BRPA 3S8GB 5J6SA 4BDVA 4L0ZA 3P73B 2HX7A 2QPEB 3BJLA 3D12B 3KHQA 1JMXA 2JMRA 1RP9A 3V6BR 1A14H 1BXXA 1JGUH 3VFOA 5C2BH 3TU6A 5JMRA 3D85A 3PGFL 1OAQL 1YG9A 5GPRA 1QRNB 4TUJA 3Q06A 1WAAA 5HYSB 3SSGA 4KJYA 4XP4H 2VUYA 3SYAA 1AHMA 2YPLB 1QACA 3BCDA 1OAXL 4OVVA 4TTDD 3ZY7A 4Q4IA 2CU9A 1OGSA 4AZ8A 5B4MC 2H47C 5DHMC 4B9KC 2EUWA 2BLFA 1FHGA 1GSKA 3OHXB 4JN2A 1JOIA 4XN2A 4YHMH 4IRSC 3VFNB 4XNQB 5DT1L 3MR9B 2J43A 5E2VH 3IE4A 4BSVB 4OR1A 1CFMA 1IFHH 3D51A 4PP1D 2XZQH 5H8DA 1CIDA 4OJEH 5C0BE 3C5JB 2EIDA 3BPNC 2EP6A 2NDFA 4YSRA 4GXVH 4H20L 4YWGL 2DDQH 4P2QE 5CJXA 3RY6C 1F3JB 3T6VA 2D7NA 1E5UI 2ZWYA 1B0RA 1DBKL 1XVSA 3LPFA 4JFWA 5DK0A 5I1EH 2PP7A 2V5SA 3D39A 4LU5H 1IGIH 3EYVB 4DZ8B 3ZZSA 5D1XB 3D0AA 2WO2B 3Q5OA 1RI8A 3FB5A 4FXGC 4JO2L 4F58H 2FZ3B 4Y19B 1U2HA 5CGMA 4ORGA 4KRPB 3L3GA 2QL1A 4XC1H 4HSCX 3RIAK 2XVLA 1UJTA 2VGLM 3DSFL 4FLQA 3U30C 5EEYA 1VPOH 1B4JH 5H35B 3Q6GH 1KJ2A 4GP5B 4C56A 1CTOA 2R27A 3VXME 2BIQA 2H3NA 2XA3A 2DH3A 5C0CB 3LZRA 3RVUD 5I76A 4GEIA 4YIQB 3QZLA 4OCYH 2F7IA 3LB6D 1VKXB 4YZFE 3LS5H 3RWHB 1K5NB 3NZ8A 2EVGA 2W65A 4ZYKA 5IW1B 2QTVA 2XPGA 1KN4L 3NBNA 2VW4A 1QG3A 4S11A 4PJFE 3VXNA 4F8LA 1T7XA 5D5MA 3DX0A 1MCOH 2OMVB 2F15A 3FOMB 4YPJA 5TE4L 2OJZL 1PAMA 2NUTB 3GSVB 1JZ2A 2DQCL 2Y1VA 4E41A 4NQCE 3OR7A 3MV8B 4LKXA 1EXHA 4J3XA 3QO0A 2K78A 3DARA 3SKNB 3QH3B 3LHAA 1XSJA 4BFIB 5L0QB 2Y72A 5C86A 1JWSB 1R3IL 2BSSA 3FB7A 1FH2A 4QNPE 3ABZA 5JYMA 1PLAA 2OI9B 4HUXB 3CFCH 4O2FA 1I8AA 4WW1A 4MJID 2AK1H 3L5IA 4I3SL 4ZXBA 3U4EB 3LSOA 3T65B 1ZT4B 3DGCR 4K94H 4ZAKC 2IGFL 3BSZL 2G2RB 4HUNB 1CGVA 2ICWI 5EUOB 5E6IC 1P7BA 5LBGA 3FQWA 5IHHA 4H1LA 2RR3A 2WQXA 1YEGL 2G9KA 2WSKA 4X7EC 1KJMA 5DZVA 2A3TA 3TBSB 5C3LD 2I9LB 4PBWD 4UQBA 1J86A 3L95B 5CZVH 5C9KA 2YA3A 5BV7H 1H5BB 2JXMB 3F85A 4S0SD 4HZAA 2F53D 1C5CL 2KPWA 2Q8BL 5JORB 5LCVA 1FZOB 2CBQA 1UWGH 3HS8A 5FM8A 2V2XA 3UG4A 4CSTA 1AGFA 5LG6A 4ZUSA 1MREL 5F21B 1EDHA 4FS0A 2CKBA 2AXJA 1NDGA 4DNLA 1OCCB 1DBMH 3HZKB 5L6YH 2EIEA 1OP5K 3U2JA 5IMKB 4WHCA 4PJ7E 4HCRL 4PY7B 3AREB 4IKLA 4UQAA 3TX4A 4S0TD 4H44C 5EBLA 3GKWL 4M7JH 5EIIG 4X7FC 2V7NB 1NCCH 3K5SA 1EAJA 4MMYB 2AANA 1RFDH 2Z4QA 4L1HA 4J3TA 3W9EA 2PF6A 3BKJL 2Q8AH 3G6JE 1JN6B 1LEKB 2D9QB 4A1RA 3EBAA 2DL2A 1ZGLP 2Y25A 3EFDH 4JHWH 4N20A 2VWEC 4PRAA 1DQQA 2GQHA 4NZTL 2IQ9L 3SGDH 1G9NC 5G2NA 3L5WB 4PP1C 2GAZB 4KH9A 5F9DC 3S48A 1NMBL 1AMXA 4KI5D 2AC0A 3LEYH 4YHNA 2BFGA 2IAND 1MRDH 4FQQB 1TFPA 2DWXA 4O4YH 1QNZL 1E4XL 3L5HA 2Y36L 4N2LA 4KKNA 4TQEL 3AFLA 2VDOH 3QUMB 5AD0A 2YN5A 2OQJA 1NC4A 1W80A 1IT9L 1OGTA 4N0YH 1QA9A 4BZ1L 3OKNB 3IJ8A 1EXUB 1YC7A 3N44F 1ITBB 3DX3A 1IV8A 4OCWH 4YSSA 3QQXA 2OMYA 1L4IA 5DDHB 5SWSD 3V6OC 2NVMA 4K3EH 1SLXA 3HI5H 2I7SA 2VJ0A 3GIZH 3KM1A 4P59H 3SKOB 4NKMA 3ABMB 4AV5A 5FA4A 4ZD3L 2C9AA 2DN7A 4HX1B 3RVUC 4WGKA 3O0LA 4KUCD 4ALAC 5ITFB 2VKXA 2BSRA 3LB6C 4WNQB 5HD8D 5E4IA 3GUTB 5DD6B 2NXZD 5I1JH 3L6FA 4TS6A 2VRQA 4A2FA 3MOBH 3SDDA 4LLUB 4I0KA 1X5ZA 1HZKA 1SF3A 3TT1L 1OHQA 3KPSB 2OP4L 5EU6A 4JAMA 1T20A 5FR3A 4B0MB 3OZKA 2BSTB 3CD4A 4G6FD 4JFVA 1IM9A 4HH9B 2XVKA 4D9QE 2VQ4A 5DMKA 8PAZA 5HHPA 1S78D 4DH2A 3BVDB 4WWNA 2HZSA 2NX5A 3ESPA 3VXOB 2F1BA 1NCNA 3KBEA 4GRLB 4L5FH 1ZLUK 4ZTEA 4DO4A 4HOZA 5FKPA 3QFGA 2VZOA 2ICWB 1ETZA 4MAUL 5DJCB 3ZR6A 3D69B 3FF7A 1BZ9B 5GRWA 5CN3A 1C12A 4X6CF 4W6WB 2AJUL 1BIIB 2QKSA 4GAAA 4ELKA 2ZT9C 2D7PA 5H94A 1ZLSL 4KQ4H 4UT9L 4Z7VE 1M3IA 1EGJA 4EIGB 1EHLH 1G6RL 3CZGA 3KEDA 4GBXB 3QUZB 4TULH 2XWBB 3LN9A 2VL5B 3E6HA 3DHPA 4TV3A 3DPTA 2KYIA 1S7WA 3TT3H 1QSFE 3EGDB 1GZPB 3I02A 4PWIA 1RLWA 4CGTA 2G60L 5A6LA 3HC3L 4IBZA 5T1DH 4ZW3A 1CBVH 2DQUL 1Z32X 3BP5B 5CLZA 3VFUA 5EN2A 3UO8B 2HPTA 2VTFA 2E7LA 3HI6H 1BQKA 1QKZL 3ARGB 1D6EB 3NIGB 1H15B 4BSJA 5CFHA 3AADB 1AQHA 1DIZA 1S8DB 1W6LA 2DZEA 3Q1SH 4QTFA 1XGYH 1T3FB 4PGEB 5E03A 2OCJA 5FOJA 1J1PL 4H25B 3SGEI 2WLLA 5E8EA 1BQHA 4ICWA 1YEHL 3QO1B 2TRHA 3A5VA 2NY0D 1KGYE 4JKLA 4E9SA 2MOGA 1VAHA 4IK6A 3TLRA 1T2QH 1HT6A 1RZFH 3FO9A 2AJZB 1URLA 4YJZL 2WQAA 1D5ZA 4DP5X 2L7UA 5E8NB 4PJ6A 2X0VA 2SEBA 3Q43A 4ZUTB 4FDWA 2WB7A 4ZTOL 4S2SB 1G84A 3V4PH 4M9OA 4W9ZA 4V1DE 2J1YA 3RKPA 4N0UB 1SXSA 3C6SB 3LRLA 4DKEH 4PLNC 4KK9D 5MEOB 2F8XC 3B6SB 1FFOA 3B7RL 3HC2A 3RAJH 3H9SE 3SE9H 5F9CA 4X80L 4L8DB 1OW0C 4NN5C 5TDOB 3OAUH 5J11B 2WVTA 4KI5C 3LRHA 3RJQB 2WJ7A 1BZQK 2DRUA 2EH8H 2NNRA 4Q6IC 5CSGA 5DF0A 3IMWA 1SHMA 1U8LB 3MRRA 3DVGB 4MJHA 4DEPC 5EWIH 2WLMA 3DX6A 3O2WL 4P2QB 1OANA 3SBPA 4IM8A 2FX9L 5I9QC 3EJZD 3GM0A 3U46B 4BFRA 3KBHE 4U1JA 4TRPH 4AVJA 5EO1A 3H6AA 4P46A 3T2PA 2VITA 1FO0A 4G8GD 4M3KB 3V0DA 5I8OL 1D2OA 3ECBB 1WRFA 4BFGA 1BX2B 2QQQA 2X09A 1B6DA 2Z35A 3FCUB 2YGPA 5DLMH 1YQVH 2GBUA 5F44A 4JRLA 1TJIL 1RUMH 4WI6A 2ADJA 5DHVA 2ZOKB 1E2WA 4NKOA 1W8NA 3VXMB 3IDMB 1AGEA 4GKZA 3UJJL 5HD8C 3NA5A 2NXZC 3OJ2C 1IAKA 5EEVA 4RMVA 3UJIL 3VRJB 2BIHA 2CO7A 2F61A 3ARYA 4DCQB 4HGWB 3K6SB 3TV8A 4B9PA 5F7AA 4XN9A 3TO2A 3KJ4C 1AOHA 1XXFC 2IWGA 1ZPUA 4ZMZA 1KWKA 4YHYC 2Z7UA 1AGDA 1K8DA 3A6CL 4PJFB 5TH2B 3VG0H 3W57A 3C60D 4UOQA 3QT2A 5GSVB 5FKAB 1XH0A 3QAZC 2ADYA 3ARPA 1UT1A 4HS3A 2CCLA 2OOXA 2AEPH 4NQCB 4HP5A 4ZO9A 1YCSA 4RZCA 5GJTH 1N59B 1N7MH 1Z2KA 3IDYB 4AYSA 3FQ4A 3VI3A 4AG4L 3UABA 5E99L 4L37B 5AB2A 4BCXA 1N18A 5I1KL 1C5BH 3UAAA 1JWUA 3DGDA 2IAMA 4BRJA 3HRZB 3WFHA 3NIGF 4JM2F 5CO1A 2G3MA 4JE0A 3DVIA 1UM4L 3MLXL 4PREA 1BDYA 3BKQX 4PJ5D 4X8XA 3SIKA 4XH2A 2Y2YA 2EXWD 2D3JA 4Y5VA 3ABKB 32C2A 2WXOA 5I82A 1MWAL 3NESA 4R7DB 3TIEB 3BEWA 2AABH 4QT5B 5M7QA 3ROLB 3V0IA 4MXQD 2HT4D 1SBSH 3PHQA 1EDQA 4BFKA 5C70A 4L5FE 2APBA 5EZIH 1TQCC 3BZDA 2FK9A 3VFSB 5BXFA 2UWEA 3HUJE 5FUZL 5HJ3B 4NFCA 4WSGA 3T8VA 3WNMA 1VIWA 2NY0C 1OAJA 4LGRB 2UZXB 4TSCH 4PJBB 4H8HA 4OLYH 1L0YA 1A7PL 3WFEH 1MDAA 1AZNA 2VZSA 3MOQA 3AC0A 3GDBA 5HGDB 2X05A 1CXHA 3B2VH 4NSKB 4OCSL 4Z7WF 5IGXH 5K1NA 4ELME 5L7XL 2VH5H 3IRZA 4M6AA 4N8VG 4JZNA 1N0LB 2EO9A 3KYAA 1MJ8L 4TLSA 1MUJA 3HPLB 3VQ1C 4KK9C 4BHUI 4YXKH 4EUPA 4YVNA 4QI3A 5I74B 2YXFA 3Q8CA 1MCQA 1AP2A 3WS6A 5IB5A 1F2QA 2W0FA 4HJEA 1AXIB 1KENL 1X4XA 1MQKL 1WIPA 3OJMB 4MNGE 1DVQA 4NZUH 5E2TL 5IBTL 2A6IA 2K8QA 3VXSE 1CYWA 1KGWA 4OGZA 3N1QC 3OKOA 4XCEB 3GB7B 2ZXDA 3EJZC 5T3XL 1OGAD 3PUCA 3VD4A 4S1QH 1MY7A 4D0CB 4UYPA 4LVNB 1MCHA 4MA7L 4JRYA 3O4OC 4M7LT 3CQQA 5ES4B 4Y1AB 1AAJA 3HG5A 5T1JA 1WICA 1VOLB 1W72L 1IEBA 1WP6A 1MLBB 1F90L 1NH2A 2HFGL 5E8EB 2ITDA 3APMA 1AYOA 1N3NA 1Y0LB 1MY5A 2D4FA 1NEZB 4PWGA 2EIZA 4B3VA 3GMOA 4M6NL 3RL1A 4P23A 4NAQA 1FSKC 4LLDB 3SO3C 3EIFA 3K1DA 1G7IA 4FFYH 2WXRA 3F64A 3D5OF 4HGMA 4XWGH 5DLLA 4UTAA 4AL8H 4DVBA 2CHNA 3U9UB 2ATKB 2Z7WA 4JFUA 4B0AA 2Q3ZA 4QF1A 3RGHA 3TONA 1YYLH 3O2DL 4DGWC 1G1OA 3U36B 1ZHNB 3F12B 3CTTA 3JV6A 3QFDA 4HVBA 3WI9A 4A39A 4NNXA 1A3RL 3OG6B 2Z8UA 1I8LA 3GZKA 4AVHA 15C8H 5GZOA 1KFIA 2HJFB 3C60C 5E6RB 4LT7A 1FNAA 4U1MB 1D9KA 2DKMA 2BOLA 1NAML 3VWKD 1MELA 1JMZA 2YA1A 3L17A 1V7MH 4JFDB 5DQ9A 2XTJB 3MRGA 4JM4H 4IU3A 3IMTA 5DMIL 2XIBA 4EBQH 3DJRA 2BOBB 3GBLA 2A2QT 4XPTL 1M71B 1Z7JA 3BD5A 1OE3A 4RH4A 1VZGA 4DTGL 1E3FA 5GS0L 2P8LB 1AXTH 1V3MA 4F7MB 4FEMA 1E8WA 4BFJA 1QZ1A 2E75C 3UX9B 1DQML 3UG5A 2BINA 2GHWB 43C9A 4LIQH 1JF1A 2GITA 2YFOA 3WE6A 3BSZA 4TVPH 2M2DA 2P45B 3GINA 3VGBA 3H42L 4N0FB 3R8QA 4NQDE 1ZIAA 2EXWC 5E5LA 4AEIL 1RZGA 4KDTA 4MA8L 3L9EA 4K7PY 5E7BA 3W2DL 4QTHB 4MXQC 2HT4C 4PJBF 3F00A 5ESVB 3SPJA 5D6DA 3S7GA 5ICZA 4OGQC 4AT6A 4ZUWA 5KSAD 3LXAA 1ZA6B 2VLRA 1SUJA 4EAJA 2BWQA 1ID2A 3MRKB 1QPPA 2OXGB 5K33A 1DUYB 3MLUL 2DYSB 1YEWA 2F18A 1OTSD 2Y07L 4Z76B 4I88A 2XFXB 2J8OA 5D1QD 5C0IA 1F6LL 4RFOL 5KTEH 5C6TH 2ZCHH 4LSQL 4TM9A 1U8KA 4HCRA 2CR3A 2OSWA 3BKML 3KTUA 3GMMA 4XNYH 2I07A 3VGAB 3EH2A 5SX4I 4M6OL 3DJ9A 3LD8B 3ZHKA 3ZMEA 2Z7YA 5I6XC 4Y8AA 4LAJH 4ZFOL 5GXBB 1UD3A 1QN8A 2NQCA 4IL8A 3L3HB 3U9PL 2DMBA 2FD6H 4ODUA 1DTUA 3NMEA 1AD9B 1M6OA 1H8SA 4S1SL 1FYTE 5KANI 1NDTA 1C8QA 1QTYT 2JJVA 4K9JA 5G4OA 3SDYH 2XZCH 4P4KD 5EBWA 3OAZK 3RB5A 1R75A 3VW3H 4PJDA 1VOKA 1D5MB 4YLBA 3WYRA 4R4FH 4GI6A 4P2OD 2XWXA 1H3WM 4OZGA 4X7DC 4IBVA 4ZFQA 1JGDB 4JDEA 1JZHA 1EUTA 4I3RH 1N12A 2A9CA 3DOSB 4FF9A 1KFQA 2ZCZA 4LCWA 4A66A 1KJ2H 3CWTA 1YC8A 2XZAL 3JYCA 2UXTA 3W0WA 4I2XA 3IVKB 2XVGA 4ZO8A 3R06A 1L3NA 1NUGA 4BZ1A 5IB3B 4GP8B 1QPKA 4Q2ZA 4HWZB 3WY1A 3NCXA 5ACZA 5SWQB 4IHOA 2RFXB 3IDGA 1FN7A 4YDIH 5E5MA 1E4JA 4N2AA 2Q76B 5BS0E 3RWDA 5SV4A 3UBXA 2IC2A 2DMHA 2XWJA 4MB3A 2GC7C 2ZX6A 3CN0A 4JJ5B 4YX2L 4LEXL 4KFZC 1MAMH 4NEHB 4MZ3A 4QOKD 4EN3D 3G5YB 1IC5L 3EDEA 4X0NA 4R0LC 2EC9T 1J18A 1KCVL 1ZXQA 4PJIB 4I18A 4MMXB 3B43A 3MNWA 2C1OA 2NW3B 3DYOA 2DQEH 5ADOL 3P0VL 5MHSE 4OZHE 2P7TA 3FQ2A 2IWKA 2XN9A 4NCDA 4PVLA 5F9JA 5HVHB 3L5XL 3NUKA 2QKIA 3VWKC 4CC4A 4CN4A 4MWFB 5AVZB 1XTLA 4WY7H 5F7HA 5GIRA 4RMSA 3B9KD 1KCBA 3GS4A 3GSUB 4FD0A 1M6UA 3ZE0E 5FYLL 4GAGH 3TJEL 1Q0YL 2R56L 1LWWA 3QJOA 3VFRA 4DK5A 1MCKA 3DSNA 3NCMA 3RDTD 3VXUE 3OSMA 5I5RA 1NGYA 2F1EA 3JWOH 1QR4A 3LHPL 4YN3A 4KVCH 3AGWA 5CR8A 3FTGA 2UZPA 1NEPA 4JFQB 1CTMA 5FO9B 1HHKB 3WUWA 3PWLA 4NQUA 3RFZA 1UFGA 2WKGA 4UT9A 4FYTA 2WIIB 4RMWA 1QASA 4JPKH 1KPRA 2RA1A 1G6RA 2NZIA 4U6YA 4PGCA 4WTXA 3ZE1E 4EKXA 2K70A 1ADQH 1FLRL 1JHKH 1XWVA 3P11H 2X4PA 1HOCB 1ZV2A 5LCVH 3MV7E 4R4BB 1RUKL 3Q13A 3PL6B 3VYOA 1XCWA 3ML9A 2ZFDB 1JDYA 2FJSA 4CMMB 2X87A 2PXYB 2CKBH 1NCDL 3PUUA 2JCCA 2I9TB 1CLZL 3O2VH 4RVBA 2ARWA 4QAWA 4AJVA 2BSCA 4NXSA 3AM8C 1IQWH 1SJEB 3GFUA 1Y1DA 4BCZA 3NCWA 1FYHB 1MG3C 4M03A 4AUYA 4P4RB 5H37A 5A16A 3ET9F 5LWYH 1YMHB 1OTSC 3HUJB 1WCQA 1DJHA 1I1YA 4HDIA 3QDMD 5D1QC 3HHSA 5F9OL 3QI9A 2DM7A 4JFYB 3TBVB 4MD4A 3QEQE 1RU9H 5TF1H 4L8BA 3WO4C 4DP8X 4XMLL 2Q20A 4LIQE 1C16A 4Y2DA 4TVPE 2Z34A 3KLAA 3IFOA 4ELMB 1HHIA 4GQRA 4LSRH 3S35L 3QJFB 4BH8A 3NSDA 4BQ8A 3QXAA 4XVOA 3TF7C 5BRZA 1C08A 4MCMA 5AYUH 3QJHA 4FABL 1JGIA 3LRMA 2K7QA 2MQ0A 3O6FA 2DLHA 2VZUA 1IM3A 2PCYA 4YQXL 1WAAE 3B7TA 3O81A 1JWMB 4FQ1H 2ARJA 5KVGL 1AR2A 1IC1A 2Q7NA 3MGTA 2XI9A 4OI9A 3NJVA 4U6HB 3EAKA 2VN7A 3NTCH 4FFZL 4MNHB 2E7HA 2HN7A 4JRXE 1RXLA 1IAIH 1USQA 3K6OA 5AB0A 3NK3A 2Z0FA 3MJ9L 4RMUA 4X8CA 5MEQA 4P48A 3L1GA 3QEHB 1UKSA 4JGUA 4M02A 2X0UA 4HXBH 3QUKB 1NBVH 3NA9L 1BMGA 2AJ3A 2XWDA 4BFOA 3HZMA 4MBOA 2G2PA 4PJIF 4HC1L 1ZHLB 2GTWA 4KK8D 4KJWC 1QN6A 3P3YA 3A4AA 1KEGH 3GMLA 1IO4C 4OD3H 1G1CA 3D39E 3GPSA 2HRPL 3IJHA 1PVSA 1G0YR 5FX3A 4E9YA 3US9A 3SGKA 4EN3C 5I1IH 5I6PA 3BAKA 5TQ0L 4IBSA 5J8OA 3G6AA 2R4SL 3I6GA 2BNQB 2OCCB 3C6LA 4XT1C 5DK3A 4LO9A 2Z65C 2FJFA 1UJ3A 3B9DA 3BT2L 3X3FH 5JHLL 2NOFA 1BM3L 4LAQH 3T6ZA 4C56E 5I71B 1IARB 3HCVA 1JNLL 3B9KC 2EKSB 1NLBH 2ZXCA 1EGJH 1ZT1B 1MHCB 2XXCB 2FRGP 1EZVX 1S9XA 2EYSB 2XG4A 3VI4A 2VZTA 4KFMA 3E2HC 4LLQB 3RDTC 3WO3B 3MRLB 3FQUB 3FT0A 3OAYH 4YHIB 5JOEA 4N90E 2ZAHA 1LD9B 3VFPA 1HCYA 1NZRA 3PJSA 1F4WH 5DZJA 1VFMA 2VDKL 5D5ME 4LHUG 3AQYA 4Z7UF 1WHOA 3UGEA 2D3VA 2V3EA 3TO4D 5I6NA 1DO6A 4IYKA 2AV7A 4OD2B 4LB8A 4TNWF 5D7SL 3ULSA 4I4WA 3V0AC 4GB9A 1YSOA 4E41E 1PNCA 1UD5A 2F19L 3DDGA 5GS3A 4NFDA 2ILLA 1Z9SB 2B5IC 3DHJA 4LCYB 3WTWA 2BH0A 4NP9A 2E7BA 2OXHA 4HJ0D 1DQDH 3EZJB 3DV6A 3T0EC 4AE0A 2JSFA 4AV0A 4ODSH 1MWAA 4HJIA 2WYTA 3OWEA 3D2UA 5F7DB 1BLIA 3P9LA 3CH1B 5JQIB 3OX8B 3GK8L 4GSXA 4JVPA 4HJGB 3QBTB 3OJDB 4TSBL 2EJ1A 2O3OA 4Q7DA 4BK8A 4QRFA 1I1AD 2PYED 5K9KA 1QLEB 4KXBA 5F89A 5JZ7D 1JP5A 2VR3A 1GL4B 1T21B 3S3JA 2AGJL 4L1BA 2CM6A 2EECA 2VXVH 3AU1B 1FNSH 1OL0A 1I9IL 5DYOB 2O6PA 4GW4A 3HNSL 4UIKL 5AENA 1IVLA 1KGUA 3WIFB 3ZYJA 5CU5A 1H6FA 5IIEA 2BZDA 2HVBA 2V0AA 3ORJA 1UM5H 4JR9H 5GGSA 1CLYH 3PYCA 4QAMB 3V6ZB 1L9MA 3BAEH 5DTFA 1ML0A 1VFUA 2UYLA 4WX8A 2HKHH 12E8L 2EDHA 2YC1A 4WWKB 4AEHH 1FYTB 2VMEA 3TYGL 4BZ2L 2UZIH 3ML8A 4LCCB 3BT0A 2HX8A 1T2JA 1FO0H 1HAWA 2BIPA 3ETBF 3QNZA 4LRIC 5D9SB 5E2UL 3VXRA 4EDWL 5KVEH 1GKEA 1T5WB 3ZHFA 2BSEA 1YECH 3FSZA 2ZWNA 4G5AA 5EOTA 2RGSA 4KXCA 3BYYA 4ZDHB 3WFBH 5EEXA 3DIDA 3CFNA 4WKXA 3CWGA 1YY9D 5E8DL 3QIWC 3PCYA 2A4ZA 5F97E 4OT1L 3RL2A 3V6OE 1PZ5B 5A2IH 1TTBA 4HU2A 1MFBH 4EZMA 1AI1L 3RZCB 4PGZA 4W68A 3U7YH 2ZSWB 2NR6A 4KK8C 1JZ4A 3PNWB 3QCVH 1HOEA 4IS6A 4JQVC 2V6HA 1NFDB 3EO1B 2TSBA 3F7RA 5KJ4A 5IJVB 4QHUB 2AJSL 3BIBX 4JM2D 4NZRH 5DWPA 2FWOB 3HE6A 1MVUA 3IETA 3RU8H 5F8RC 1HK6A 4AYBA 2IF7A 1JXGA 5E9NA 4W81A 3GGWA 4XNBA 4J8RA 3LXUX 5LB1A 3ZPDA 1EJOL 3O2DA 5IVXB 5DJZB 4UNUA 1V05A 2EILB 1KTDB 1MCCA 4OLWL 3FRPB 1NPNA 1U8QA 2NLJA 3NSCA 3SDAB 2WZ5A 2B08A 5DFAA 5FF6A 4N8CH 1U3HD 4H88L 1NAMA 5I8EB 2P8PB 2Z31B 3SY6A 1H3PL 4FOMA 1A9BA 1G1KA 4KHTH 4PJCA 4NRZB 5JIMA 1WFIA 1PFCA 2Y5EA 4NO0D 4XP6L 2ICWJ 3ZE0B 2X9XA 2UXGA 3PWVA 2DQTL 1Z3RA 4JM0A 5EC1A 3GS7A 1X6NA 2ITCA 4F3FA 4HKXA 1IKNA 3JVGA 3QUXB 5EU6E 3MOAH 5B39B 5FLVA 1JIBA 1S7RB 3G08A 2X28A 2WXMA 4XO9A 5AKVA 3TO4C 1JXJA 2H1XA 4HJJH 3H3BC 4NIKB 2P43B 4JHAL 2ZUQC 4QPEA 5I26A 3WKYA 5LVEA 3QIBB 4HAKA 1OVZA 1FDLL 4OCRL 4B50A 2NX5E 4F2MB 3C08L 3A22A 1Z5HA 1FVEA 4I8DA 2GCYB 5LKNA 3KWWA 3MV7B 2FO1A 4TNVF 3JTSB 2FX7L 3G5XB 1HSAB 4G8EA 3KCWA 3CVBA 4HJ0C 4AEEA 1QO3B 1W8EA 4LCUB 2CO1A 3U4BL 4BWTA 5KJRL 1UEYA 2F54A 3JZ7A 1B90A 2NXYB 3GMRB 3QQ4B 1RIUL 1TJXA 3IN2A 2VR9A 3PGFH 4YGAB 1OAQH 2AXGB 2Z4TA 5D7IA 4ZMLA 2ORBL 4ZZKA 3E7JA 1ZLUH 3MTRA 4PRID 3LJ3A 4NO5A 2CR6A 2NQDA 2XCMC 2O61A 1AKJA 1BREA 4HS6B 2LQRA 4K2UL 3PXLA 4WFHD 5JZ7C 2DQDL 1L9NA 3L5JA 4ONGL 1FVCB 2FUQA 5DT1H 4Z7QE 3S8FB 2LFGA 1TVHB 4EUPH 4MRQA 3DURB 2B59A 1E9QA 3P30H 3SB3A 1UB5A 3TPUA 1SBBA 1A1NA 4NB7A 1KC5L 3OPZH 2FT8A 4LFHD 1R3JA 4MLSA 3S3BB 1LK2B 4ZFOA 4HAFA 4H20H 4YWGH 1U58B 1H3GA 3VQLA 1DBKH 4TTGA 4HPYL 2I24N 2EE2A 3EUUA 1AS8A 3TZVB 3VFOB 1OO2A 4E5XG 2G4EA 3D85B 2BIMA 4ZMVA 3RGVD 3BP7B 1I7ZA 1CDCA 5D2NA 4JO2H 3F05A 1NCWL 4Y2OA 3IRCA 2A9BA 2JIXB 1AFVH 2WP3T 1AZVA 3X17A 4AZ8B 1CGTA 3DSFH 3UBHA 3BP4A 4JDTL 2EXSA 5MEND 1YY9C 3LKNB 4JN2B 4YBLB 4M4RA 3LDBB 1NFDF 3NSJA 1K3IA 4XOCA 2DWEB 2ZKHL 4NQEA 5JXAL 5E1QA 5IQMA 4CKVX 4UTAH 4X9FA 3B5HA 5C71A 2NY6B 4MXWL 5ANHA 1F86A 1C9SA 4KROD 1I3RA 5IVXF 3DX7B 3ASNB 5DQDL 5CIPB 1GC1L 4KKZA 4PGDA 3X11A 1KN4H 2CNZA 4JM2C 2JQMA 1V5JA 2XBDA 4M9PA 4W9GC 5E6UB 1NCJA 3UTSD 5E23A 5AOMA 2GEEA 4Q14A 2P5WA 4WFGE 5I1LA 5IJBC 4APQD 2OJZH 4DGUA 5KVEE 1PKQA 1TYRA 2DQCH 1SF5A 4XVSL 2E56A 4M1CD 5KVFL 2E8YA 2AEOA 4ORGB 2PLTA 3N85H 4L4VD 5JA8B 1WTLA 2GIXA 4WJG3 4Z5RB 1ACYL 5LXVA 3MLVL 3RQ3A 1KYDA 4TL4A 5JLZA 1T66D 4NZ8A 4XMWA 4GSDH 2PTUA 3NFSL 2ZG2A 3TIDB 1U3HC 2NZ1A 4MAYD 4FTDA 4MSWB 1AO7B 2EDYA 2NY1D 2GIMA 2H3NB 1KBWA 3LQZA 1R3IH 3H3KA 3I9PA 3KPMB 1XF3A 3UFIA 2N56A 5E24E 3T71A 3TURA 5CBEA 4I3SH 1P7QA 3FTZA 3QZPA 4ABWA 1CFBA 4C55A 2IGFH 2WN2A 5B38G 1F2XK 3UTTA 3NZ8B 1XAKA 5HI5D 3PQYA 5IHBA 2ZNWA 5JQHC 1VZIA 2XPGB 3ULVL 4X83A 3WHXA 1A5FL 1WCBB 4PJXB 1YEGH 1KTBA 5LGHL 5D5MB 4FQPA 4AC4A 4LASL 3N89A 5IMLA 1HHJA 4G5ZH 1ZLWH 1OSYA 4AW4A 4PRPB 2PCPA 4JFPA 2Q8BH 3OR7B 5T1MA 3KLQA 1Q9LA 1WITA 1A2YB 4M8RA 5I18L 3VI3E 1MREH 1E42A 1CQYA 4K5NA 3SPVA 2D9CA 4FYRA 5BOPA 3U4AA 1HN1A 2NYZA 1DYZA 2B4CH 3FB7B 4HCRH 4U6VL 2ICEA 3A4DA 3HI1A 2KKQA 4R7NA 4L9LC 2Y9RT 5JHDB 1Q90A 2GTQA 2WBKA 1DQIA 1IBBA 1I1FA 3RTQA 2AAAA 3LSOB 3MRFA 2QMKA 3L4YA 3VFGL 3QFJD 1IILE 5FGCE 1LE9B 3BZEA 3ARBA 2CHXA 4NT6B 1DDTA 2LABA 5D4HA 3BKJH 1RK1A 3Q44A 3FQWB 1KXTB 4WQOA 5DEGA 4H1LB 2EVHA 4B97A 3ARDB 3MYZA 5E0FA 3GPEA 2KQMA 1T5KA 2F8OA 1P1ZA 4NHCL 1KJMB 1PD0A 4NZTH 5IB1B 2IQ9H 4U1GC 5IEKB 2K4WA 5CFAA 4YHOL 3SYOA 1NMBH 3ECUA 4O02L 3ARRA 1R3KA 4OZFA 4U7SA 4A68A 2UWEE 3FQNB 1HDMB 1QFWH 3GC3A 1AGFB 1QNZH 4MKTA 4ZUSB 1G7MA 2Y36H 4F80A 2IO5A 3D1MC 4TQEH 2B3IA 4Y16D 1PL3A 1E6OH 2X6BA 2NOEA 1JBJA 1RJYA 1DBJL 3IDXL 5FHAL 3RGVC 1IT9H 1BQHG 3WKQA 4L18A 3T8XA 4Y4FA 4BZ1H 1BP3B 2HT2D 3E3QE 3MCYA 5IHUL 5D7LA 1BJ1H 3LKOA 4QXTA 5HJBA 3EXLA 4M8VA 3O4LD 2WLNA 1UT2A 4FFZA 4ZD3H 4YO0A 4RDBA 5CLWA 4OFYA 3GRGA 5D96B 1HS6A 4PRAB 3GSWA 3HAEG 5FYJD 1EJFA 3WFCH 4KROC 3EJSA 2HT3D 5F1OB 3G5VB 4HC1A 4YHNB 4UTCA 4WFFD 1QSED 1TTFA 1EUUA 4IDLA 3TT1H 3US0A 5AZEL 1T1XA 2OP4H 3CXFA 1S3KL 5IJCC 3UL4A 5ABZA 3KJ6L 4JRYE 2OQJB 1NC4B 4IIZA 4APQC 1TFHA 4J3OD 1NFIA 2NSQA 1OGTB 3I75A 5C08D 4M1CC 4PEEA 4ANUA 4P2YA 3C5SA 1N3CA 1DP0A 2ISDA 4QRRA 3VM5A 3SKUD 2WPGA 2OMYB 1T66C 3L1FA 2LLLA 4Y1SA 1KELH 5JHLA 5JPMB 5E1IA 2XZZA 3QDAA 4MAUH 4E9LA 4MAYC 2VDLB 4NKMB 1RIHL 4X6EA 4XX1E 2HL8A 2NY1C 3EJCA 2AJUH 1ZLSH 2J25A 4PJXF 1SGKA 2DI7A 2BSRB 1T0MA 3K8LA 2AXFA 3K6NA 3ESUF 3SDDB 3BAIA 5HI5C 2BCKA 2G60H 1BAFL 5FUCE 3R0MA 3T4AB 3HC3H 2NY3C 1T20B 4HKBB 2GBVA 5AOKA 2FWUA 3SKJL 3ZL4L 4O51B 1A7RL 4WTWA 4CU8A 4YR6B 1JZFA 5BZWA 5DMKB 5C7XL 3OF6A 3VSUA 2YJLA 3MRQA 3QUYD 2WNGA 1AGBA 4LSDA 4L05A 4A6YL 4F8TA 5H37H 2J6WA 4O5LL 4HG4J 4K0OA 1J1PH 3AT8A 3O3DA 2WP3O 3HN3A 1P9MA 4DEWA 3MO1A 3T77A 5BMNA 1P5UC 3VU1A 2WBJD 3OR6B 4YDLC 2WYIA 4GMSL 4X98A 5H94B 1TYJA 2GSIA 4C4UA 3RPKA 1J12A 4JFFA 1HYSD 1KCWA 1DQLL 2D3LA 2FR4B 1NIAA 2MKLC 3P4LA 5PAZA 1E9PA 2WWKT 5FIEA 5T1LB 4U49A 4ZTOH 1KIRB 1YN6B 3M1BA 3GIVA 3LMJL 4KRMB 3DO4A 1UCBL 1BFSA 3SGJA 1ZK5A 5DWUL 4Z7QB 3VFUB 1UOVA 4FQLL 1HCFX 3OCIA 2AKRA 4X80H 1EZSA 1ZA3A 2E9WA 2PP9A 2PTTB 3EOBB 3GXIA 3UAFA 4P3DA 1IIIA 1QFOA 2X7LA 2VLRE 2HFFA 1T0PB 2WINA 1AS7A 4Y7OC 1X5LA 5F88B 2WXQA 4AK1A 1E4WL 4DGYL 3FCTA 2XQYA 3O2WH 4Y16C 3DXAD 5C07A 2WLLB 2GC4C 2H8PA 3QDHA 4H0LC 3BGFB 1L9PA 4NQVA 4BZ2A 3V9EA 4EJ1C 4DP6X 2HT2C 4XPBL 2NTFA 1RZ7H 1BBDL 3FU7A 4MHHG 2A74B 2Y6TE 2AV1A 2HRGA 2SEBB 2JWYA 1DJSA 2ADFL 1MHEA 3VXPB 3GBNL 4ZFFA 1TJIH 1I3UA 3IFLL 4HK0B 4PJHA 3ZL2A 5C0FA 4FJ6A 5EOCJ 4ZPVB 4L9DA 1Z3GH 3I6LD 4NKQB 4RX4A 4QXGL 4CFFA 1GMEA 3UJJH 1KBPA 1ZSDB 4XCYA 4EUPG 5A1AA 4PJDE 3UJIH 3MLSL 4OZGE 5K59F 1JAEA 2ADIA 4F9PC 5FECB 4UDTB 2EUXA 5AOLA 4IMLA 4GH7B 5J9PB 4MS8D 1F42A 1ND0B 2N0KA 3Q0HA 4EEEA 4EVNA 1F97A 5DJ2A 5BQDA 4LCWE 1ULVA 2C4XA 3W0WE 2Y5TB 3ZXAC 3ENEA 4I2XE 4J3OC 3A6CH 3HE7B 1IAOA 4U7MA 1E30A 3CLEL 1RURL 2DQFA 4N0CD 1BVZA 4U1JB 1HCZA 3BPOB 4EXKA 4OJFH 4PJ9D 5FFLA 1JPST 2VITB 3SBWC 5C6PB 1J0YA 1SDYA 4JN1L 4K7PL 43CAA 3NIDF 3WN6A 2Z35B 2AEQH 4G6KL 5GGVY 4DKDC 1K2YX 2XV0A 1WD8A 2A38A 3HBPA 2B1AL 1J8HD 3O3BA 2YWYA 5C0RL 2CE6A 4Q6YA 1IU1A 4GSUA 4HIQA 2QPFA 1MJJA 1BZ7A 1QEXA 4NPYA 4PQXA 4J4PA 5DHVB 2ENPA 4NKOB 4GKZB 5I1KH 4XX1G 2L8AA 3CZNA 3S5LB 2WQVA 3GBML 2K4AA 1SOSA 4UUJA 5DA0B 5E9DD 1RUPH 2JJUA 3QS2A 2AJYL 3RFRA 1SHXA 4GO9A 4NP4L 2CO7B 1UM4H 3MLXH 3MUGA 4HF5L 2FO8A 4ZW5A 4JO4L 4K23H 2VR6A 4AKOA 4YK4B 3W11D 2XN9E 2ERJB 3PREA 4KO5A 1JPEA 1MWAH 1K8DB 3CSPA 2CUMA 3TTYA 3ZKXB 3KNBA 2LU3A 3E1F1 3QUYC 3EHBD 2F53A 4MBRA 2E46A 4OAWA 5DRWB 4HS3B 2FSEB 4AH2B 2QPSA 1DLFL 3MRDA 5FUZH 4RZCB 1P7KA 4EAGA 5E2JA 3VI3B 3DHUA 2P24A 1TOXA 2HUHA 4PR5A 2WBJC 1DN0A 1XCQB 2AXWA 4UYQA 2GY7B 4L29B 4YNYA 3DMMA 1A7PH 2DKDA 4HKZA 5AKTA 1HYSC 1XT5A 1JWUB 1FBIL 5B7MA 2IAMB 1X4YA 2LTQC 4OCSH 3WFHB 4F2EA 5L7XH 5KSUB 1WJWA 2FGTA 2A6DA 2NT1A 4JFHE 4PREB 1MJ8H 1EFXB 4XI5D 3I74A 5JW5B 3UPAA 2JCCE 4Q4EA 2O4EA 4PRNA 3BEWB 4A7GA 1QR1A 4UAOB 4IGBA 5D6CA 1N67A 4AGOA 4OLUL 1MQKH 1ECYA 4QKTA 1Q9UA 1PCMX 5DI8A 3SYQA 5IBTH 1EZUA 3BIKA 1MCLA 4OU3A 1MCDA 4ODVH 5AVSB 4Y4KD 2UWEB 3D4VA 3OZ9H 1IJ9A 2X2UA 5DZLA 1E67A 5T3XH 5FA3A 5A3ID 3GMPA 4B27A 5GZNA 4DKFL 4GS7C 3PGDA 3KE0A 4DO5A 3MFFA 4HJSA 1Z9PA 2DWSA 4U3XA 4F20A 2HFGH 2BVPA 4M48L 5EU4A 2PPCA 4ZW8A 3SY0A 4JZNB 4M6NH 3ME0A 4PGBA 1JI1A 1ADWA 3CFDB 4MJ5A 4XXCA 1XR8A 4F93B 5BRZE 1MUJB 3BVVA 3P3SA 2JPIA 5IV2A 4GUCA 5GGTL 1AP2B 1JTPA 5IB5B 2W0FB 2C5DC 3QORC 2W91A 5PCYA 1J88A 1VESA 3MNZB 3O2DH 3HG1D 5ESAA 5A2BA 2VIRA 3F7PC 4MS8C 2A6IB 4XP9H 4F1ZA 4LLYB 2WHVA 3DHMA 1SN5A 2OMWA 3WS3A 3OKOB 3CIAA 1JVKA 5ENWA 5C0JA 3MCLH 2YAMA 5JHMA 2IH1A 1KIUA 5B1CA 1EWHA 1IQDA 1NAMH 4K7PX 2NY2B 4PJ9C 1I53A 2ZXAA 1FGNL 2WCPA 4D7RA 2X5PA 1IEBB 4G72B 4XMKL 5HI3D 3GJFH 4MQXC 3APDA 5DMIH 1E4XI 4QUOA 1N3NB 2A1WL 3KPLB 3RG1C 1UENA 1XBRA 3H53A 2ZP0T 3L3JB 3UPRB 2XXGA 2WWKO 2BFVL 1M7DB 4DTGH 1U8OA 5GS0H 3CFQA 3UBXG 1G7IB 4JZJB 5D1ZI 4NDMB 4NNYA 4DVBB 2WZ6A 4DUXA 4JFOB 4BK5C 3CFEA 1DQMH 1PQZA 4M8QA 1XQ4A 4MAZA 1NCIA 4Q0XL 7PCYA 4QF1B 1Q1PA 3JWDC 3GSXA 3H2WA 4X9BA 1MI5D 4V2CB 3H42H 4JKMA 3WIHL 2WLYA 2FEEI 3W11C 3V4VB 4AEIH 4QDGA 4QY8A 3QZWB 3CDGA 3X2QB 1A1MB 1VTLE 4MA8H 5KYYA 2JCWA 3P0YL 1G7JA 2VMJA 4L4TD 1M42A 4BQCA 4LLAA 3UAJD 5F0JB 1G9MC 3EHBC 3NCFB 2BP3A 4XCCL 1LP9F 3VI4E 4W70A 3KLKA 3T0EE 1DVTA 5DJDA 3DECA 2NOYA 4KOCA 3OXRA 3MLUH 3F10A 2W07A 3H1ZA 3QDGB 2V8QA 2Q7YA 1SVZA 2Y07H 4OKVA 3DTUB 4NPKA 5I1HL 2IV8A 5FW6A 4RFOH 1AR1B 2A6JA 4PJ8D 3VAEA 4XC3L 3FN3A 4LSQH 2GUOA 2J5LB 3BKMH 4NQQA 4XNMA 4AIXA 3WUWG 1SHSA 1XB6A 3HMXA 1I3GL 4JKWA 4M6OH 5IREA 3KLHD 5IJDC 2CK0L 3UC0H 2GITB 3WE6B 1I8IB 5EF1A 1X9UA 4XI5C 4EMZA 1YPZB 3U9PH 3FJTA 5G4NA 4GAJH 1DZBA 3EBHA 4S1SH 1T1WA 4P9HC 4F37K 3VTAA 2Y23A 2WGXA 3SOBL 1T89A 2ESVD 2V7HB 3W39A 3SCMD 5C0EB 1YY8A 3BKCH 2DAVA 4WO4A 4OY9A 5CD3A 1U3JA 3GHBH 3STZA 4O2CB 1N64L 2B39A 4O02A 1ZS8A 3NA4A 4Y4KC 1KXQE 3RA7L 2VLKB 1X5AA 5DYFA 1OAKL 4WFEE 3BQUA 2P9RA 1HI6A 5DJAA 5H37G 1HILB 5A3IC 4Z77B 1XIWB 2QJDA 2XZAH 5C0IB 2AEWA 4DOHE 1UUSA 2LGNA 2YA0A 1U8KB 1KG0B 1XGPB 4G8GA 2I25N 1WZ1H 4R5TA 3RGBA 2I07B 1GCFA 2XTSA 5AW4B 1CI3M 3DC0A 1WA0X 4EI5D 5I6MA 4YFLI 1KV7A 3ALWA 2O6FA 4MMZC 1P69B 2C7FA 2VC2L 1SQ2N 2IPTH 1CL7L 1M6OB 1YMMD 4QRQA 2FWLB 4YX2H 1IE4A 4YBQD 5K9OB 4LEXH 4U1IA 3AQXA 1I7UA 2YJQA 1U8NA 3JZYA 3QJXA 4G9FD 3W82A 4QJ4B 3VXRE 1IC5H 2Z91A 1MDTA 5SWZB 5JQ6L 2MSPA 1KCVH 1BFOA 4YEFA 3MXWH 1A1OB 2OMUA 1UQSA 2VRAA 3P0VH 1TJGL 4NBYB 4NRYA 5T3XE 3TA3D 3IN0A 3MLYL 3L5XH 2VXQL 1HL5A 4MX7A 3W0WB 4YZFF 1T1YB 4UF7C 5AW7B 1G0XA 5E1AB 1MHHA 5HI3C 5D1ZB 5INDA 4Y4HD 1QVOA 2QPDB 1RIVL 1O9VA 4HV8B 1H6UA 2R56H 4IHOB 3IDGB 2AQPA 5E5MB 3O0RL 5K93A 2ZD0A 3WG7B 3E1ZA 2CDEB 3LHPH 1YDPA 2IGTA 3S3PA 5C09D 3BSGA 2XWJB 4K73A 1E3ZA 1NCBL 2A73B 2G5BB 2ZX9A 1JXKA 3M07A 5ERWB 1YAIA 4FZ8L 4LLVA 1PZBA 3SE3A 1FPTL 1MRFL 1REIA 3D4GA 5IHWA 1GYAA 1FIEA 1FLRH 1S7TA 2HTKD 2XIDA 3QUML 1QWNA 3IGUA 4R4ND 3LVTA 4I18B 1RUKH 1LWRA 2PKDA 2C1OB 1V3JA 4N2BA 1KV3A 4NO2B 1NCDH 2V2TA 1CDJA 2XN9B 5F9JB 1CLZH 4YSCA 1LO0L 3UAJC 5T1KA 3NG5A 5I0VA 2WGNB 5KJ7E 4PJCE 1T7ZA 2RIKA 1UM6L 2CALA 1J8KA 3FU8A 3Q8AA 4A6YA 1JFQL 3DSNB 3TNMA 3TEYA 1WJ3A 2HVJA 4PRHB 5F9OH 3ZJAA 3ZO0A 2TRYA 4PJ8C 3CUPA 2N7SA 2XVBA 3ZYOA 4XCNA 2X1QA 5KAQG 1HVXA 4FCHA 2VERA 5CZRA 1KPRB 4U6YB 1G6RB 5J56B 3KLHC 4PGCB 4NZJA 1PEWA 2P46B 1FL6A 4R2GD 2WQUA 5HYJD 4OZFH 4Z7OF 3MHZA 2F1AA 3S35H 2KH2B 3CHXA 4PJ7F 3ZLQC 2F54E 2AQ2A 3SYCA 5FV1L 2JCCB 4YL9A 2PW2B 1GPOL 4QRAA 3SCMC 1JDDA 3ILEA 5DEZA 1TEYA 5BJTB 2AHIA 1EUVA 3FFCB 5FGBC 2YPKB 3C2AL 4YQXH 3KYNA 4FXKB 5D7IE 4BBWA 4DT2A 4JO3L 4WI4A 5AWNL 4F8QA 1CGSL 5KVGH 4HIEA 2QFRA 3BVXA 5I15L 3FMGL 4I48B 2X9ZA 4RFEB 2D31B 2DIEA 1B9ZA 3MV9D 4IK7A 3OB0K 5A7BA 3GJEB 1J0KA 5I75C 5ID0A 1DVSA 3BIAX 2H0EA 4NJ9L 1NLDL 4MD4B 4W9HC 4XCFL 1VFAA 4L8BB 2R15A 3TWCH 3DJZA 4KY1L 5EO0A 1S9WB 4Z95L 1NMCC 4D0BA 4M56A 4UTBL 4Y2DB 5DO8A 5GGUB 4CADB 3IFOB 2DQMA 1HHIB 1PW3A 4HC1H 2HRLA 3H9YA 4RMBA 5CJOH 4L3FA 4YBQC 3A47A 5J3HD 1UATA 2HRPH 1AACA 1C08B 1VFOA 4QHKI 3QJHB 5DS8A 3O6FB 3BZFA 1BFTA 4L3CB 4PJGF 4FQCL 2R5XA 3KXFB 3WE1A 5TQ0H 2APWA 5D2NE 4M5YH 2EC8A 3BH8A 2ARJB 3CZKA 3FUMA 2R4SH 4XXDA 3CDCA 3ZW3A 4F2FA 1O9WA 3PS6A 3BT2H 2JI1A 4P5TC 3TA3C 5JHLH 5CM1A 4HMDA 4H0GA 3MRPB 1PF3A 2C4FT 5TTRA 3L8QA 3F3HA 4NQEE 1XH3A 4KBPA 1JNLH 4HUVA 4MDIA 4LGSB 3WNIA 4B60A 4Y4HC 5E6ZA 5DQJB 3BVUA 5F1IA 3WL9A 4FG6D 3MUJA 3ZOAA 3ZTJH 3BXNA 3EOYG 4LPVA 2GTWB 4EI0A 3UZEC 3GMLB 3PHSA 5IJKC 5D72H 1CICD 2F8IA 2P5WE 2J8HA 1YA5A 1PKQE 4NOBA 5D7SH 3T8MA 1DDHA 2HTKC 3CMOL 1AQ8A 5I17A 3DGGA 4R4NC 3MNDA 5HPMA 3JUZA 4UQ2B 3QJUB 3C8DA 3G6AB 3NCJL 3I6GB 2QVTA 4CA4A 1CDYA 5KN5A 1U8IA 3X1EA 1UJ3B 3UC2A 2BVYA 3QHFL 4Z7VF 2KS0A 4ZO7A 2X88A 3JWNH 3AMKA 2DQGH 1U91A 3NJLA 4JL1A 4PS3A 5F7LB 2X4NA 4KZEL 1MJUL 3HCVB 4OCNC 4XPAL 4KMLB 3JV0A 5KSAA 2WO4A 4PY8I 2G5RA 1S9XB 2XG4B 4TSBH 5HHOB 5EOQL 4EALA 1NKGA 2FH8A 2K0RA 5F3HA 3BWZA 4OGYL 3S4SG 1J8SA 3PQYE 4DN4L 3UJTL 5HHVL 1QNEA 5L9DL 1CGYA 2RMNA 1CMOA 3U0WH 4JY6A 3VFPB 1J05B 2AGJH 4YDKL 1MH5A 3PAVA 3PJSB 3T04D 2WTOA 1U42A 3PABA 3Q5TA 1I9IH 1ORSB 3CC5B 5FDWA 4UIKH 4I4WB 4R2GC 5ICYA 1KMGA 2ZUXA 4LVHC 1XGZA 1SM3L 1ZWIB 1KYUA 4Y19D 3TN0A 1MCNA 3FYEB 2RJMA 1HNYA 12E8H 1E65A 4AXWA 4G42B 3I84A 1F02I 2OXHB 4YFLF 4P2CG 3TYGH 4P4KA 4JG5A 5CEYB 4QRUB 3KR3L 3MMEA 4ODTL 1HSBA 3F04A 2Y3AA 4P2OA 5DRZA 4JPVL 1RZKC 2P1YA 4X50A 3VO0A 3SDCA 1N5YL 4FTVA 3OXSA 2OMNA 1O75A 5ECJE 5KVMC 1MFEH 3I3DA 2P5EA 5T33H 5F89B 1I85A 2KI6A 5E8DH 1JTTA 4CVWA 4OT1H 2ZWZA 3CVIH 5JPNA 4XTRD 1AI1H 2ADGA 3DIFA 4GW4B 5CGTA 4A7TA 4WI0B 1WAEA 4R8WL 1JZ6A 2YD6A 3PXHA 5IIEB 3MACL 4DULA 1MW2A 3QYMA 3CVTA 1PS3A 2VMFA 3L9RB 2VO8A 4D8OA 6PCYA 2UYLB 3OLDA 1ZGLM 2YC1B 2AJSH 4IOIA 1QBBA 4YHKL 4X4YA 4IRJA 3VWJB 4IU2A 1MSPA 1OSZA 3CVHL 4ESKA 5GGTA 1WE5A 3II2A 3P73A 5D7LE 3I9GL 5KVGE 2CD0A 1EJOH 2V5YA 3QNZB 3KBPA 1BMZA 1TZHA 1U8MA 4M4PA 2VJXA 3BPCA 2NOHA 3GSNL 5J4MA 3I2CL 4BA0A 4R3SA 5DEFB 2D7TL 3O6LL 3PDOB 5EOTB 4Q52A 3HS0C 1AE6L 2AITA 3WIIL 3ZDXE 2Y6SD 4PUBL 5D7KD 3L1OL 2YPLA 1P4LB 5JNYB 5DUPL 1NANH 4JQXA 2B0SL 1Q9KB 3II1A 4DKTA 1H3PH 1W72B 2O5YL 3Q1EA 3VRLE 3N50A 1XSIA 1XCXA 2M8XA 4XP6H 3VFNA 2NNAA 4PTUB 4BSVA 3DO3A 2JKSA 1U8PB 4G8FA 5HYFA 2A5UA 1E3XA 5J13C 1IEHA 2XKNA 1ITCA 4IS6B 1XX9C 3SEPA 3W9DB 1KCKA 4HUWB 4ZQKA 5EN3A 1PZSA 3C5JA 2EYTA 2WXKA 1Q9WB 3R18A 4P9ML 3QP3A 1DVFA 2EDNA 1KB5L 3FO1B 4J8RB 4OCRH 5K39A 1FDLH 2YRLA 4IMKC 4K5LA 4JDVA 4QRRE 1AH1A 4DZ8A 5I8CB 5KBKA 2WQWA 1ZRUA 3WIHA 3ZSSA 1S46A 5D1XA 2F9BT 3VXQB 3DI2B 3OHXC 2FX7H 3IU3B 4TUKL 1U8QB 2WNKA 5KJRH 3U4BH 1BEXA 3M6DA 2FZ3A 1NC2D 5FF6B 3Q2CA 3N5AA 4KRLB 1NAMB 2XUWA 4FHKA 5IQNA 4D9RE 2ZF9A 5EC2B 4O58H 4M7KL 1FC1A 2ORBH 1N5AA 3KPQA 3VQ2C 1ILUA 4NC1C 3PWVB 4TSAL 3Q05A 5C0CA 2ITCB 4YIQA 4HKXB 4K2UH 3VFWB 2DQDH 4ONGH 1VKXA 5AW8B 2X6AA 1K5NA 1FVDA 3G08B 5GISH 2CUIA 2PWGA 4K55A 2OX5A 3MBXH 5AVRB 5IW1A 4F7KA 1WZKA 4B9IA 1F4HA 2L4OA 2DJSA 1QP1A 2DYPA 1NUNB 2NY7L 1SZNA 3KPOA 2B2XL 4U2YA 3FOMA 2OMVA 3FO0L 3NPZB 4AEFA 2MJ7A 2XKSA 3ZZLA 1PIFA 5GRVL 3BFQG 5E4EB 3K4DA 4WAFA 5TK2A 3GSVA 3P54A 4HPYH 2DW5A 3JWNE 1SJMA 4G8AC 5J5EA 2F54B 3MV8A 5JXED 4LFHG 4ZT1A 1EANA 5D7IB 4JFFE 1R9FA 4BFIA 1NCWH 3VVVA 3VSVA 1BYNA 3U6RA 2ALWA 1JWSA 4AK2A 4KDWA 2VR4A 1A4KB 1HH6A 4JDTH 5JHAA 4EDXB 3C2SA 2JJTA 3TS8A 4UZGA 1TR7A 3T65A 4Y9FA 2ZKHH 4IDJH 2G2RA 2H45A 3S96B 2B59B 3VYNA 1E9QB 3ZN6A 5JXAH 1CD1B 2YSTA 4XTRC 5EUOA 5FM5O 1OT1A 4XO3A 3KGUA 3TPUB 3UROR 3ENCA 1QBMH 1A1NB 5D2LB 5HHMD 3DUUB 4X6CA 5D70L 2PYFA 4C58B 4AGLA 4B9GA 1R3JB 2V3FA 1JRHI 2WN3A 5EMYA 2VAAB 5DQDH 4UZUA 3T09A 5IQ9B 2I9LA 1OK8A 2V37A 2H5AX 3L95A 1E7UA 2JXMA 2AAVA 5KUMA 5C07E 1AISA 4I5BB 4OZFG 1A6ZA 5JORA 4Z7NE 3ZDZE 4FX5A 1JG9A 2NRDA 4LQFL 1JYNA 3IJEA 2OI9C 2YMTA 2R29L 2YAOA 1BQRA 3FKUS 5EV7A 3EOAA 3HZKA 1UD8A 3FH8A 4JFEB 4XVSH 4NNPL 3CQPA 5IMKA 5KVFH 3T0VA 4RIRB 4IIQA 1ACYH 1XAUA 3AREA 4PJHE 5I1AA 1DSFL 2ZAGA 2Y6SC 2F6AA 1PDKA 5CP7A 2IBZY 3NFSH 2WXGA 2N7AA 3PGCB 4M4RB 2VXQA 1T6WA 4NWTL 3BLPX 4MMYA 1UTDA 1H5BC 3BMWA 4PJAF 2FYYA 4WI3A 1JN6A 4HT1L 4JGJA 4PRBB 1LWVA 3D33A 1SMOA 1I3RB 1HL8A 1GZHA 2NY5H 4WW2F 3FZUD 3L54A 4K8RC 4NN7B 4PGDB 4ZQTA 3QIUB 4NHUB 5J6GA 3ULVH 4YC2B 3TH3T 1A5FH 3D05A 2VSCA 3EJRA 2YMXL 1RPKA 3PE9A 5LGHH 8CGTA 1SXCA 4LASH 4OIFA 2P5WB 4FQQA 4HU8A 2H0JA 3VMOA 2FNWA 5FV2A 3LNFA 3QUMA 1MIML 1FNLA 2CR0A 1KLFA 1QABA 1XF2B 4M5ZH 3TCLB 1KO9A 3QCUL 4IEFB 5I18H 3B2MA 5EOCL 5JLZB 2DLFL 1H6EA 2BIOA 3K6DA 4WTQA 2C3HA 3NSFA 2FJHB 2WKLA 1E8ZA 3HN8A 3LQZB 1DEEA 2P80A 3ZT6A 3QUHA 1MOEA 3PAUA 1S7XA 2IPKA 4U6VH 1L7TL 3SKOA 4PRDB 1Y6KR 3A4FA 3NPSB 3HMXH 1WUNT 4M61A 4RGOL 4JE4B 1I1AA 3I6KB 5C0BD 3VFGH 5ITFA 5L88H 4UILL 3UTTB 3L48A 4WNQA 5CCJA 1ZEAH 3ZTJG 5DD6A 4P2QD 3V5HA 4X9GA 3BZ5A 2YO3A 1NMAL 3WHXB 3GMNB 5IQOA 3MKGA 4NHCH 4Y5XA 3QB7C 4LLUA 4R5VA 4UB0L 3INOA 3KPSA 3CDZB 4KNQA 4KQ3H 1WFNA 2DWDA 5ISZE 1JFHA 1JSYA 2PCPB 1H8OA 4JFPB 4O02H 2HKPA 1BXAA 4HH9A 3GSRB 4GRWB 5IFJB 3DVFA 2VDNH 2JTYA 3GZQA 5FO2A 4U0RB 4AMKH 5JIKA 1L0XA 2F7OA 4NUPA 3SPVB 5JXEC 3VXOA 1PLBA 2OMBA 4JL2A 4G1MB 5DRNA 4GRLA 4RRPM 1DBJH 3IDXH 1SDDB 2DBLL 1WSST 1S9VB 1UD4A 3JWNG 3PRZA 5FHAH 3VXMD 4R7NB 2ICWA 1BVOA 5IHUH 1BZ9A 3PAYA 1U0QA 1E7VA 3BDYH 4MTMA 1I1FB 4J2QA 4NLHA 3MRFB 3BZEB 4E9QA 5J6HB 1E8YA 3QWRA 2YBGA 2YR3A 4GBXA 1G87A 2FQEA 4LL1A 3QUZA 4TOYL 2VL5A 2PR4L 5FW8A 3IDIA 4IRSB 5GGVL 3WTYA 1YEKL 4LOUD 5TJWK 1P1ZB 1GZPA 4W4NA 5KBDA 4FLHA 4WENB 2HKFH 1JS4A 4N2OA 2XKUA 4CSZA 4UTBA 3TYFB 3G04B 1R3KB 4YXLL 4NQCD 1F56A 4DGVH 1ZKAA 5AZEH 3L4ZA 4TVUA 5AL8A 3ARGA 1D6EA 4LSSL 1H15A 1KGIA 4JFTA 1INQA 4F57L 1S8DA 1VB9A 2XQYG 3KJ6H 3B9EA 1T3FA 1RJYB 1E4KC 2H2SD 4GNKB 4K7FB 2HA1A 4PLJD 4H25A 1A8ZA 3QO1A 4FXGB 1P5VB 3EZ8A 1T83C 4OF0A 2X2YA 4QXTB 1SY6L 4M1DL 4GO6B 5JUEH 3ULUC 3LXBA 1D2PA 1CDUA 1RIHH 3C75A 2APTA 3K74B 5E8NA 3ZDXB 3SE6A 3CWUA 1GIGH 4LP8A 3ZUNC 1FCCA 4OTXL 1Y07A 3GSWB 3NJNA 3FO2A 1BAWA 2JJSA 2Q3AA 2DTSA 2X6CA 4RGNB 5L8JB 4QTIL 4N0UA 2R1YB 3C6SA 4KZCA 1C5DB 2IBGA 3TEWA 3DIVA 2R9HD 3FZUC 3BW9B 3S37L 4L8DA 5DJXA 1BAFH 1FN4B 25C8L 3CXHK 4Z7WA 5GRVK 1K8IA 3AWEA 3QS3A 1BJ8A 5TDOA 3TH2T 3VYPA 4NUMA 3VX1A 4MNQA 5AL0A 1B0GB 4HIJB 3G3LA 4YOKA 3G9VA 3ZL4H 2CIIB 3LNHA 1IFRA 1A7RH 3DVGA 4N2GA 3EYUH 4K3DH 5FB8A 5C7XH 3Q6FA 5D7JD 4JHBA 1F18A 5KVFE 3SBQA 3RWEA 1UD2A 4NIYE 1UFUA 4QRRB 1GZQA 3ZL1A 4A6YH 2OL3L 3J8F7 3CPLA 1KYAA 5E51A 5JN5A 4O5LH 5HDBF 3IDNA 4HWBL 4WWID 5ID1B 4DP0X 3M7OA 1BX2A 4X6EB 3X13A 3EBIA 4GEJA 1RCYA 3UTZB 3IRPX 5AW5B 1T0NB 2BNRB 3D06A 4GMSH 1MFUA 2LAGB 7CGTA 5J11C 1T0MB 4E2OA 3VE0B 2WO3B 3DUSB 3QWNA 1GTNA 1DQLH 2ZOKA 4J12A 3EIKA 2AXFB 3IDMA 4ZAKB 1IMHC 2QSTA 5TFSL 4HG4K 5HGBA 3MAWA 1KPVB 1X7TA 5EEWA 3ULVE 2W81C 5E6IB 3LMJH 3PV6A 3HBZA 3DVNB 1NANI 1AC0A 4G9DB 1RY7B 3BDXA 1TVBA 1UCBH 4AQ1A 2VDKB 4G7YL 5DWUH 5EF0A 1HEJC 4FQLH 4CU7A 2WYHA 2R83A 1ASPA 2Z8WC 4HGWA 4X2UA 5AUMA 4J27A 1C1EH 4DCQA 3K6SA 3V7MA 3MRQB 2RD0A 3VD7A 1AGBB 1LWYA 2Z7ZA 4OM0L 5GHWL 4Y9EA 5TH2A 5GSVA 3UBGA 1A25A 4L3EA 4F5CA 4FHJA 1NAKL 2YHGA 4OV6F 2UXFA 3OSKA 2GW5A 4PG2A 4EAEA 3US1A 4X98B 4AQAA 4XPBH 3ZTNH 2GSIB 3OQ3B 2EZ0C 1YN7A 3DYMA 1BBDH 3ZRFC 2YSSB 3WJJC 2CO4A 4JFFB 3RWCB 4F15C 5JIQA 2Y0SA 4L37A 2ADFH 2BW4A 4P05A 3GBNH 3HLAB 3IFLH 4OZ4B 5C2UB 3M1BB 2PPDA 3LPWA 3HRZA 1B0IA 4N9OB 4LOUC 4LSTL 4RA3A 3C5ZD 4QXGH 2AQ1A 1TIUA 4JY5H 1D5XB 2WLJA 4L23A 2AKRB 4D9QD 3WTVA 1LGVA 5D7HA 4X99A 3MU3A 2DTML 2WINB 2OBGA 2CAKA 3TIEA 3FCTB 5C9JA 5C8JA 1ZGLB 3S5ZA 4PM1A 4ZMNA 4LNRB 3DX8B 4IHBA 2OYLA 3MDJA 3CWAA 2H2SC 1JF5A 1KYOK 3CVHA 2J57A 4GO8A 2CO6B 3D25A 4PLJC 2ZUTA 4XBEH 3VFSA 3WKPA 1RURH 4KVNH 2X4TB 5HJ3A 1UWXH 3RYMA 2VAJA 4NYLA 4W93A 1QLEL 2NTFB 1MNUH 3D3VA 3FU7B 4LSPL 2CCVA 2EIJB 3KHOA 4JN1H 4K7PH 2DJMA 4PJBA 4PCSA 2L7JA 4P2RA 2CBMA 4G6KH 2E3VA 4QGTA 4LCIL 3OMIB 4ZFFB 1QSFD 5C0RH 5HGDA 1F3DH 4BQBA 3WBDA 5HDOA 1FGVH 1N0LA 3MVSA 2GJ6A 4KAQL 1RV6X 2YMOA 1M3QA 4XBGB 4XCYB 1XGTA 3SKMA 5TGBA 3S37X 3B1UA 3OLEA 2EIBA 4ZS6D 3I85A 2AJYH 4RSVA 3KPPA 3A21A 1VF5C 2V8MA 3EJYD 4HF5H 4IMLB 4NP4H 1OP3H 4ABUA 3BO8A 2OJEB 3OLIA 4AQEA 4EVNB 5E4AA 1COBA 2JLPA 2P48B 3WUZA 3PG2A 1O5DT 4N8PA 3ZO9A 1MIEH 3LYRA 2BMKB 1R5VA 3E6FA 5CCKH 4JREC 4W9DC 1IAOB 4XCEA 2CHZA 3GB7A 3QZBA 1KB5A 5E7FA 3QWOA 3MGOA 3T3PB 3T6QC 2VDML 1X5XA 3WD5L 4D0CA 4LPWA 5JW3L 1F6FB 1TYEB 2Y7LA 4OCMC 4JVWA 1DLFH 2HWZL 5CINH 4Y1AA 3KW7A 3UPCA 2NZ9C 2FLMA 2V33A 3O3BB 4U4BA 3HN5A 3P77A 3DO7B 4Z0XA 4LQ1A 2AZAA 4V1DD 1BZ7B 4NPYB 5I74C 1WVZA 1Y0LA 2J1WA 3HNVH 4Y2LA 4RQQB 4DETA 4GG6B 1SFHA 1TUPA 3S88L 1M57B 3JTTB 5BPPA 1S4IA 3DK0A 4HZ1A 3H9SD 3IF1B 1OGPA 2MMXA 4LLDA 5LNEA 4MJIB 4PLOB 4BA8A 2QSCH 1GOFA 2JK5B 3WEXB 1RJCA 1PJ9A 2OMXB 2LAEA 1ORQA 4ANXA 3LEVL 4TNWK 3MUGB 2ATKA 2DPKA 1R17A 2O6CA 3GXMA 5AYTA 3TVMD 3ZQWA 1G9HA 1ZHNA 4M8UA 1WGOA 1BOGA 3AG4B 2NMSA 1T6AA 4ONOA 5I1CL 1AANA 2I5YL 2F53B 4OLUH 3FUKA 3GYRA 1ZPLA 4OAWB 2W60B 2HJFA 2Y1AA 4KXZI 1KBBA 1PY4A 1ZOXA 4ZFZA 1ZCRA 3MRDB 4WHDA 4JFDA 4PMEA 3MJGX 4ODHL 3K2IA 2P24B 4HD9A 4PR5B 3N43B 1DN0B 1BOYA 5E94B 4JB9L 4L2YA 1ZHBA 2W9LA 4DKFH 4CJ0A 3V9FA 5DZOA 2FIKB 3LZQA 4OF8A 3ZHLA 2C1PA 2WIMA 4M48H 3LNGA 2JKTM 5T3ZL 1NIEA 2YAPA 1KCRL 2MFNA 1AOZA 1IGFH 5JOPE 4H0HB 1BIHA 3N40F 4HS8L 4GJTB 1JZDC 4ES9A 1CZ8L 3C5ZC 2E7MA 2Y7MA 2G2NA 4PRNB 4N0FA 2PNDA 4Q8BA 1N4XH 5GGTH 1OZTG 4J8QA 4KV5E 5I0DA 4R84A 4IGBB 1PZ2A 2FX8L 2XTJC 4NN5B 5IWLC 2ED7A 3X3GL 1K4DB 4PWHA 3WXVL 2IANB 4Q6IB 1TQBC 5ESVA 1B4LA 2PWHA 4DEPB 4KNUA 5FOBA 1ZA6A 1BAGA 4LPCA 5FA3B 3LY6A 3ZE2E 4Q9BA 5I9QB 3MRKA 1WV7T 2OXGA 4W1TA 2X3BA 1E40A 2R29A 1FGNH 3PGDB 1OD7A 4XMKH 2G4GA 4Z76A 3HHRB 4XPGL 1QN9A 2GJPA 5EU4B 3EAYA 4G7QB 5CEZL 5DXWA 1RZJC 5SWSB 3SY0B 2DLEA 4BHUA 2A1WH 4XWOD 3ARVA 3E38A 4PGBB 5F71A 4MJ5B 1XR8B 1PCJX 2BFVH 2QVKA 4MCYB 2VOTA 4TPRH 1V8HA 1WS7A 1ACCA 2J56A 5IV2B 3L3HA 1WA1X 3LKPA 4OVUA 4OGXL 1B9KA 2NXZB 3V7AE 4Q0XH 5HBBA 1AD9A 3N42F 1WAPA 3T3PF 2MKWA 5ESAB 3EJYC 3WNNA 2ZYHA 5LJYH 3WIHH 3RURA 5DVMA 4M7ZC 3WS3B 5GRUH 2OMWB 3VU2A 4A7UA 2GI7A 1GGCL 1VZHA 4OKDA 3KJ4B 2IH1B 3P0YH 4G6FB 1KIUB 4TNFA 2QZQA 2X89A 3UO1L 4YHYB 4N24A 1JGDA 1KCUL 3GF8A 5E9AA 4XCCH 5TQ2L 5AW2B 3VGAC 3BWAA 3QAZB 4PV1C 1OM3L 1C7TA 4K94C 3IVKA 3GXPA 4P5MA 1CBJA 1ZDSA 2DLIA 5IB3A 3UYOD 4F8NA 2IPUG 1IGMH 5SWQA 2DKCA 3DPBB 2IWEA 1CGWA 1U8OB 5BW7C 2BRRL 5IG7A 3OGCB 4XC3H 2Q76A 2FH6A 4UINH 5BV7C 4B9CA 1JNJA 4PV9A 3B5TA 1I3GH 3CFEB 4L8SA 1PQZB 4M8QB 3F58H 5JW4N 2V5MA 3R1GL 4JJ5A 3T2NL 2CK0H 2XX0A 3NJXA 1S3RA 2NPLX 3FYIB 3ARSA 3NIFB 2AQRA 3VXSD 3G5YA 3U7AA 1QSZA 2IFFL 3TVMC 5KYYB 3SOBH 4PJIA 2Y8LA 3AT9A 1G7JB 3N43F 3WDIA 1Y18B 4TNVK 2NW3A 4FQJL 1VEMA 2DLTA 4OFDA 4XHQA 1J5CA 5C0GB 3VN5A 4I0PD 1N64H 5DJDB 1RZKL 3OXRB 3VMPA 3BAJA 3QRGL 1OEZW 3RA7H 3CX5K 1TQCB 4AYFB 2QQLL 3GLDA 4N28A 3KWUA 3B2XA 3GSUA 3BAWA 1D7FA 1M05B 1H3UA 4X7SL 2NNFA 5KBNC 3VDBA 3GDCA 1A3LL 1JTOA 2NY0B 1PLGL 2CJTA 3SYPA 3IPBA 4UIMB 2A6JB 5HHNA 1O5PA 2GUOB 4AUUA 4XNMB 1NGQL 3MA9L 1R34A 1PNDA 3GSQB 5FWQA 1FG9C 1HHKA 2X70B 4MMXC 4WI9A 4H8UA 1NTDA 1NGZA 3SPIA 3L4CA 4U3CA 4NGHH 3NZSA 3BUDA 4Z3IA 3OWRA 5B8CA 1KYFA 1ECZA 1WT5A 5HVHC 1C9BB 1WO2A 1T1WB 1TBPA 1HOCA 2EDEA 4M7LH 5I73C 4MQTB 3F5WA 1V27A 4R4BA 2VXSL 2DB8A 3W39B 1PSKL 4LE8A 2K1MA 3QA3A 4K8RH 1D5BA 2PXYA 3RX9A 1AXSB 5CD3B 5JQ6H 4Z7UA 3STZB 2DMCA 2FQGA 3OTTA 4FTVE 4O02B 4GAFB 1ZS8B 1KXVA 2AMUA 2V17H 4LK4A 3BUPA 1UWYA 4ICXA 1OARL 1SJEA 3CFJB 1LO4L 1TJGH 2P5EE 3TBCA 1IC0A 1HI6B 2E4TA 5DJAB 4L0YA 2DMKA 3H7LA 3MLYH 4LL9A 1CPUA 1LEGA 2DM2A 2VXQH 3GHEL 5AALA 1N10A 2ZUSA 1YMHA 3O9WD 5TE6L 3OKMB 4QJ5B 3EG9B 4Z8FH 4KUCF 4ZUUA 5DSCB 5LGKA 4G8GB 5HDWA 1RIVH 4DK6A 5E1GA 2C3VB 2KHAA 3HZYA 1QHPA 1SY6A 4JFYA 3TBVA 2EKJA 3H0TB 4XWOC 3PL6C 3GXFA 4ODBD 1PG7L 3O0RH 3OV6A 1J8HA 4M43L 3L08A 2O26U 4NQDD 2YFNA 3SO3B 3F6JA 4B0MM 4QRQB 4F1SA 1YQKA 4FZ8H 2XWCA 3GNML 3RNKB 5HP5A 3QJFA 4FNQA 1MRFH 1JYXA 1ESOA 5E9DA 2O5ZL 3QUMH 1TVDA 4Q6KA 5T8IA 1BFOB 3WXWL 3V7AG 1ZAGA 5IB4B 2WY3B 1RVFL 4O9HL 1QRNE 3EDJA 1UQSB 4NRYB 1VEPA 4ZPTB 1JWMA 4JZOA 4M6ML 2YPLE 2BM3A 5ADPL 3KD4A 1LO0H 4WIQA 2UX7A 2QSVA 4PY8J 2R0ZH 3C60B 3VVWA 1J87A 1P0SE 4WEEA 2QADB 5FM4A 1MHHB 3KS0J 1UM6H 4CMHB 2GBAA 1P53A 4D2NA 1R46A 5JOFB 1JFQH 3D9AL 2OMZB 3PFUA 4HWBA 1NBZA 1YDPB 3NIFF 3QEHA 4C8XA 2APSA 1FYTD 5EPMA 5AW1B 1HWHB 3ZRCC 3IT8D 1ZHLA 4GRMA 5TK4A 3CSYB 1PY0A 3QPQD 3U48A 1U3NA 5A2AA 4OJCA 4KKPA 1ZVHA 2PO6D 5D1XE 3HS9A 3GZOA 1OLZA 2N01B 3CN4A 1A4JA 1BQ5A 4RDQF 2EDKA 5AVYB 2V2TB 1GPOH 2BNQA 1CGUA 4WLCA 4CBZA 4B3EA 5E5RB 3C2AH 2Y69B 3HB3D 3FONB 1KF9B 4I0PC 1HZLA 1XB3A 2Y7QA 2FDBP 4D8PA 1R3HB 1Y7VA 4JO3H 5AWNH 1E5BA 3RZCD 1V7NL 1U8JB 1UOWA 3LV3A 5C0CE 2E8ZA 1ICTA 4HAGA 2EKSA 2ZYSA 2Y4SA 3N3EA 3T3MB 4C83B 4WUUA 1MHCA 5FFOA 3TNMB 1RSFA 2EYSA 2HVJB 5CEXB 3LS4L 1E27B 4YDVB 3MRLA 3F6LA 5B1JA 4NJ9H 2CA3A 5ALCL 4XCFH 4PVBA 4AQ8A 3SOTA 4R9HA 1LD9A 4KY1H 5LG1A 1FNEB 3UERA 4PYGA 3ULUH 1GJWA 4UTBH 4OFKA 3DX2A 2QLVB 3B7YA 4OD2A 1TU2B 1QN3A 3V6FB 1U2YA 2MCAA 5I71C 3I50L 5MHSD 3M7FB 1J5OL 3MV8E 1E5ZA 4EKJA 4CKQA 1UCTA 3LIZL 1Z9SA 4LCYA 4O2EB 1A0QL 4FNPA 4MLIA 5J89A 3WSQL 2APXA 1EVTC 4HIEB 2D0HA 5F7DA 1QNBA 2WJ5A 1PGRB 2ZSVB 3VXUD 3OX8A 3HVNA 3KVDD 4HJGA 1SRDA 1BGXL 1OGAB 4LHUD 5FC9A 1BD2A 3O9WC 3TTSA 3ATFA 3ZE2B 2XACC 4ISVA 5ID0B 5EUOE 5FK9B 2UY6A 2DD8L 1QLRB 1VFAB 1WISA 2BJML 4X6CE 2Z0UA 3UEZA 4XAKE 2VE6B 1TQTA 1J1OL 3L2LA 2X4RA 3MV7D 4DP1X 4NI3A 3KVPA 2ZF8A 4OF5A 3WIFA 3CAFA 4UQCA 1AMYA 1Z9MA 2VJ8A 3V6ZA 2RB8A 4Q9CA 3JXAA 2ZX5A 3BP6B 1IGCL 1D7DA 3CMOH 5MI0C 4WWKA 3HBQA 2F74B 3BH8B 1PD1A 4R0LB 4YSPA 1BLNB 3GEWB 1BZ8A 4XXDB 3HKZA 4LCCA 1W6WA 3NAAL 3CC1A 5HDRA 3BRFA 3KCPB 3D87B 1GAFL 2CKNA 3QHFH 4AYEC 5D9SA 2C8NA 1XEUA 2ED9A 2H4EA 4KZEH 1XH3B 3VWKB 3C09B 4HUVB 1WPCA 4XPAH 4ZDHA 3QEQD 5B4MD 4I0CC 5CJQL 4YFEA 2F5BL 1TUOA 2XC8A 5F1IB 3IKCB 3L9BA 4IJ3C 1X7QA 5EOQH 4YHZL 1SN0A 4TVPD 4OGYH 4F24A 1XR9A 4NLAA