The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
54
|
sequence length |
233
|
structure length |
233
|
Chain Sequence |
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
AP-2 complex subunit beta-1
|
publication title |
Molecular Switches Involving the AP-2 beta2 Appendage Regulate Endocytic Cargo Selection and Clathrin Coat Assembly
pubmed doi rcsb |
source organism |
Homo sapiens
|
molecule tags |
Endocytosis/exocytosis
|
total genus |
54
|
structure length |
233
|
sequence length |
233
|
ec nomenclature | |
pdb deposition date | 2006-02-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02883 | Alpha_adaptinC2 | Adaptin C-terminal domain |
A | PF09066 | B2-adapt-app_C | Beta2-adaptin appendage, C-terminal sub-domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Alpha Beta | 2-Layer Sandwich | TATA-Binding Protein | TATA-Binding Protein |