2G30A

Beta appendage of ap2 complexed with arh peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Switches Involving the AP-2 beta2 Appendage Regulate Endocytic Cargo Selection and Clathrin Coat Assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords AP-2 complex subunit beta-1
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2g30A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2g30A02
2G30A 1C9BB 1KY7A 1CDWA 1QNAA 1QN8A 1W80A 3OCIA 1QNCA 1QTSA 1TBPA 3H1ZA 5IYBP 2VJ0A 2D0BA 1MP9A 1QNBA 1KY6A 2Z8UA 3EIKA 4ROEB 1PCZA 1QTPA 1QN5A 2D0AA 4WZSD 3HS9A 1E42A 1YTBA 4ROCB 1B9KA 1AISA 1YTFA 1KYUA 2IV8A 3ASMA 1QN9A 2D0CA 1QNEA 1VOKA 1R4XA 1NH2A 1QN6A 5IYDP 3HS8A 1NGMA 1RM1A 1QN7A 3OC3C 1QN3A 1VTOA 5IYCP 3VN5A 1QN4A 1KYDA 4RODB 1PZDA 4B0AA 1TGHA 1VTLE 2IV9A 1TBAB 1NVPA 1D3UA 1KYFA 4PY5A 1VOLB 2MJ7A 1JFIC
chains in the Genus database with same CATH superfamily
1A47A 1R0AL 1S9VA 4V1DE 3G5VA 2X1PA 4G6JH 4WY7L 4XAWH 1MIMH 1CLZL 5GRVK 3ZKQD 4TUOA 3KPNB 2A83B 2YXFA 2DKAA 1FC2D 4KUCD 1I4FA 5LUMA 1HYSC 3G5YA 1NEUA 2KH2B 3G6AB 3ESUF 4AL8C 4WFED 3POHA 5IGXH 3HOGA 1H6EA 1P4IL 4L3FA 5D72L 2HMIC 4LRNL 2AZAA 2VUKA 4JO3L 3DYMA 5C0IA 1U8KA 2DYSB 3T2OA 5H2BB 3KYOA 4KHTL 5GGTL 2F8IA 4PRIE 1MCDA 4X6BB 4FI6A 3KAAA 5D72H 2MQ3A 5T1MB 1T7WA 4W4NA 5KZCB 3MAWA 2HL9A 5AZUA 4X4ME 3CW7A 1YMMD 2FQFA 1A1OA 5JMRA 3BH8A 2J20A 1FV1B 4JLRB 3QI9B 1OD7A 2Y4SA 3RPJA 1NL0H 2L7JA 4A2GA 5KBPA 2C9PA 1LP9A 2X1WL 5F93C 3QZPA 3L3GA 3UTZB 1M3QA 3B2UD 3OBAA 3SDCC 4BWUA 4JFHD 5BCAA 1NGWB 2JKSA 2Y07H 2VITB 2BCKA 4OCSH 3AMLA 3C5XA 2WBJB 5FFGA 2JHNA 3ALWA 4K5OA 1RZJC 4P4KA 4B95C 4CU7A 3CVHH 3N43B 4L4VE 2DDQL 3II1A 5AW9B 5B22A 2QSVA 2VW4A 4F7PA 3CHOA 4PJBB 2BSCA 2VM9A 5JXAL 4M6OH 3WAKA 5JIHA 5D7LD 5GS1B 4DCQB 3MRKB 2SEBA 5FKPB 4FAAB 5DEZA 4H8HA 1FA4A 4OJFH 1EO5A 2QPUA 4HWZB 2FGWL 3FTGB 3G6JA 4P2QE 3SYPA 4LHUA 3VYNA 3QEUB 2FH8A 2Q6WB 4CU8A 3L6FA 5B8CB 3DV4B 1X4YA 4PY7B 2MTPA 4WI5A 3SPCA 1TZHB 2F6AA 4KQ0A 1MW2A 4KDVA 2B59B 15C8H 1K2YX 4NQXA 3MKGA 4WRLA 3R06A 3EFDH 3ZHNA 5DF0A 2ZKHH 3TF7C 2EVFA 5GPRA 3NFNB 3I3BA 4N0CC 1JF5A 1F90H 1FE8L 1H9VA 3BQUD 4G5AA 3WFDL 1B6UA 3DPTA 2OK0H 1JCVA 2EXTA 4PLJD 1A4JA 3FPYA 3JTSA 2E7DA 4OCRL 2JK5B 3IU4L 3RPIA 3G08A 3QR2A 3L3OB 3AABA 3AVEA 5CGYD 4M8VA 3QNYB 4PJFF 3QEHB 3FRPG 1U8LB 4KUCF 1UA6L 3IFLL 3S3PA 4Z7QF 2OAAA 3TC9A 1A14H 3TZVD 2WZ0A 4AK2A 5IFHH 1YY9D 3NIDF 3NIDB 1KPRA 2R9HD 2QADB 2Q9OA 4M6AA 4NKQB 1KIQA 4JDZB 3EXJA 2FCBA 4W9HC 1J87A 4PWHA 4ODHH 2DYPD 3EYSL 3MLXH 5CU5A 3WIIH 3NIDE 5CEXA 3BJ91 5F72S 3U1QA 1H6FA 5EPMA 1K5NB 4HOWA 1KELL 5KS9F 4L1DA 1XGUB 1UD8A 4ZUWA 3RJOA 5KS9B 2ZKWA 4WI0A 3PWJB 2GEEA 2VAAA 5CINL 5TE7H 1CL7I 5FUZH 4UBDC 3Q06A 1W72A 1GMIA 3DARA 4X6DA 4N2HA 1PZCA 4K8RL 3AW5A 5T1DH 4AKOA 4YQXH 1SOQA 4Y2LA 3IJYA 3MVSA 1RJZB 3FFDB 4QHNA 2X10A 5E6RB 5EOTA 2AMUA 1NH2A 1UD5A 3OKKB 4B7IA 3R7RA 3UZQA 3D87B 2N4IA 1FCGA 1RIHL 3PNWB 3CCHA 3U6XS 3VN5A 3NP3A 4JJ5A 4MKTA 3OH6A 1O9VA 1BM3H 1NEPA 3HPLA 3I2CL 1J5DA 3SQRA 3RPKA 1GC1C 3WS3B 1BDYA 4IDJH 1NCBL 3EJCA 2HFGL 3BP4A 4YXKH 5DLMH 5D7JD 1G7MA 2VMDA 5EO1B 1A7BA 2AAAA 2CSPA 2BZ7A 2G3ZA 4X9FA 5JOEA 2WBJA 4PTTB 5E6IA 2DIJA 5IFHL 4NO0B 5JIPA 1FG9C 4BZ2L 3VFTB 2W9DL 3QRLA 5DI8B 4OZHB 2VDPL 4MMZA 1AXTH 3KLAB 5L2KD 5D1XA 2OYKA 3A6OA 4B50A 1CPUA 2EDYA 1GRWA 1VGEH 3D09A 3LMJL 3VXMD 1C08B 3RWGB 3S36L 2OCFD 3CHPA 2R2BB 4F9PA 1H15A 4AJWA 3GMPA 4G43B 3VE0A 2DQHL 4YL9A 4MBRA 1I75A 3BW9B 3BVXA 2CBTA 4NQCD 3SPGA 3QQDA 1A6ZB 1RK0B 2HX8A 4XMWA 3MNZB 1E6JL 1H3UA 3DBXB 3MROB 4N8CL 1CUOA 1IAIL 2Z92A 1VKXB 4J3OH 3MREB 3WJJA 3P30H 4JFWA 1O7SA 3LEYH 2KZWA 4ZMYA 3HNVH 5AAPA 5I17B 1A7QL 1KF9B 2BNRD 2JKWA 1JDDA 3LY6A 1ZANL 3MRMA 2LLGA 4XZ4A 2Z91A 3DGCR 4TN9A 5GGQL 1BLNA 2Z3FA 5DQJB 4Z3GA 1ZT7B 4K3JH 1JERA 5E2UH 1H8SA 3FL7A 3MV9E 1ULVA 2WN2A 1OGAA 3OLIA 3I50L 3PABA 4HZAA 3DIFA 2PPDA 4KJQD 5HY9A 3GJEB 1RK1B 2AXFA 1F42A 2NX5E 5AWNH 1KXQE 3EBIA 1P4LA 3RE0A 2P8MA 4YHNB 4TUKH 4KNQA 3GMRA 2HL8A 5ABZA 1AZCA 2V2XA 3GJFH 5I1JH 5HHQA 1T7ZA 5AW4B 2CRIA 4MX7B 1W91A 3DMMC 4X7SH 5T3ZL 1A1OB 2XA3A 1WJ3A 1OSPH 3RHWK 1IBGL 4JRFA 2GI0A 4KVNL 3SE9L 2VE6A 2ZXGA 2GIYA 1LJMA 4ETQA 4HKBA 2ZYRA 3OPZL 3EKCA 4M48H 4HIXH 4JGJA 2SODB 1AZVA 4HAKA 4TOYL 1HXYA 1NUNB 3CDZA 5CWSB 5ID1B 4PJHA 4APQA 5JHDE 3MA9L 3U9PL 4DP4X 2YD0A 2WANA 1DCLA 3TNMA 2EHBD 1PDKA 1YEKL 2GJRA 1G7PB 1F6AA 3LEYL 1QLEL 1JP5A 3FDWA 3Q3GA 2AK4B 2H1PH 3VXPB 2VDMB 3LOWA 3B34A 1G6RH 3PREA 1YYLH 5I66A 4XXCA 4DP7X 2O6EA 5DK2B 3GXUB 2OZ4H 3PXJA 1OGAD 4ORGB 2XRAH 4OVUA 2YEVB 1KLGB 1WFNA 4FDWA 1MRDL 4M7KL 3DYPA 4WJ5B 4KRPB 1ZVSB 1H8LA 1VERA 2WXMA 4TTDC 4OF7A 5IBUB 3RL1A 3WFBL 1W80A 4DGVH 2NRDA 3QO0A 5C7XH 4AYMC 2NNCA 5LGHL 3EYOA 2HJLB 1BBDH 1NGZB 1RKRA 2BVQB 4S1DD 4NB7A 1CGVA 3IU3A 3NFSH 1SEBB 2FIRT 2HG5B 5T1KA 3T5WA 4ODSL 3C8KB 5IVXB 1DFXA 3KH3A 3H2QA 4YSPA 2YA1A 4TULH 4Y1AA 1AQHA 3JTTB 1F3JB 4MCNA 3VACA 4U1GB 4HBCL 3MLYH 4YXHH 1K8DA 1P7BA 2OMVA 4RGMC 2R56L 4QHLB 1TTAA 2X0VA 1AO7D 3FF7A 1T2XA 4QAMB 4UQ2B 2FJUB 4J3UA 4YSCA 1AZBA 1K3IA 1FH5H 2VT0A 1Y1UA 4JY4A 1GOFA 1VCBC 1WD9A 2BZCA 1A6WH 1UXSA 3KPOA 5HYQB 2BSTA 4XPBL 3VW3H 4NO5B 1YY8B 2IAMA 1T2QL 2VDKL 2YA2A 4M3JA 2EO7A 1PZ5B 2KQMA 2K45A 4WZ9A 5I73C 4ZS6D 4JDVA 4GO9A 4XVTL 5J6GA 2Z31D 4KY2A 4OIIL 3V52H 1NAKH 1EGJH 4Z7UB 3QUZB 4X5WB 1Z9SB 1OZTG 4DK3A 1WWBX 5KSVB 1QR1A 1Q8MA 5AL0A 3SDAB 1U8MA 4KK6D 4PREB 4HJSA 4U1IB 1Q94B 4FKHA 3EJSA 1DBJH 3ES6B 3VNYA 4GLRI 1LMKA 2ADIB 2NX5A 1CI3M 3IWUA 3GSNB 5KW9H 2NSMA 3I0XA 2KZ1B 3EHBD 2E59A 4YSTA 2CCWA 4O02H 1J9RA 1I1AD 3GNMH 1XCQB 4DGIH 2HFEA 2X4RA 3TOPA 3AWFA 3H9SB 4PJ5E 5HDBF 4OIBA 4PRPD 2W95A 4GO8A 1U8QA 2HRGA 3C2SA 3LN5B 3FKUS 1F18A 2YBRB 1OCRB 5KW9L 3QAZB 4WAFA 2IPKA 4D0BB 1Q0EA 1G9MH 3KPRA 2X4OA 3OVUB 4XNZB 3OZKA 2AXGA 1TNMA 2VZVA 5BXFB 3OKYA 3OKOA 3T8XB 1QFWL 3FQ1A 1D9KB 4Y2OB 3N41F 1VJSA 3N41B 3UAAA 1T1YA 2DLHA 2XV0A 3EYVB 5FA4B 2X6UA 3UL4A 1CFTB 1N59A 3TA3C 1TLMA 1KB5L 3GMQB 4QRPB 1RJLA 1MPGA 3SNSA 4JRXE 2CK0L 5MEND 4EXPX 1X5FA 3AXLB 2DJUA 3CX2A 4YVNA 5E5RB 1NDMA 2A38A 5A2JH 4MJHA 1ZVSA 4LB8A 2YRBA 1GGCH 4FTVA 1RZIB 2R0LH 4DVRL 1NFDE 2DQGL 4NO3B 2O26U 2EICA 3TEYA 4X7DC 4ZYKB 1KGJA 3EBHA 4PGEA 4L8CB 2BCMA 3BVWA 4ZO7A 4OZIF 4ONFL 3VFPB 4H1LG 4ZFOA 2HLFD 2CE6A 2QGEA 2RQ8A 2FGTA 4P05A 5D1QE 4HZLA 2WQAA 4JCMA 1LO3H 3CD4A 5ANME 2JKNA 2P4AB 1IFHL 1WSST 2NW2A 3SDXF 4MNQB 1UGNA 5AN4A 2IQ9L 1B0WA 1M2OA 1ZXKA 3WKYA 6PAZA 1PYWB 1AG6A 2IH1B 4LVEA 1X7SA 3EHBC 1J1PL 2BNQD 5DZJA 4AGNA 1QHPA 1MJ8L 2B4CL 3GMRB 4TQPA 3QB7C 5I18H 5HBBA 3PL6A 2IMMA 4G1MA 3FQXB 1IGFL 3FCTB 3GJEA 3NQKA 3WI9A 5FA3B 4IQHA 1A7RL 4K3EH 2J5LC 3M1BB 3CCHB 5I18L 5F71A 2G5UA 4AW7A 5HVWA 2CO6B 1M7IA 3BWZA 5FO8A 5BMFL 3M88A 4G3YL 2OOYA 3NT0A 2XX1A 2YPLE 1HU0A 3WS3A 4JFDB 4E9RA 1LGVA 4FG6C 1H3PH 2EO9A 5AAMA 2XIDA 4AYDC 3ARDA 3I85A 4WK0B 3ZT7A 1ZIAA 2QZQA 2QGCA 4Q4IA 1NUFA 1GMEA 2VSDA 2YPLB 4JFFB 5I0DA 1Q1JH 1W15A 3DK2A 3E80A 3VD0A 1NOAA 3L2NA 5ESQA 5DJZA 1FORL 1UT7A 4HIIB 4M48L 3UCRA 1ZK9A 2FATL 2NY4D 4H8WC 4F57H 4QYOB 4LE8A 4J3XA 1R0AH 4U7SA 3U2JA 1H3XA 4IM8A 1HJBC 4M5TA 1P5UA 3ARUA 3O6LH 1KEML 4LOUD 1VLXA 4OW6A 5ID0A 1OOAA 1BAFH 1OAQH 1CICC 4ZSOA 3FO2B 3NVQA 4YDIL 1E2VA 2NX5B 3ATAA 5D1QB 3H55A 3T6WA 5J9PA 1TTGA 4IBLT 5KOMC 1SDYA 3NABL 2VB5A 2C3GA 3VRLE 3CSPA 1QBLL 4AM0B 4FZ8H 3GO1H 4P49A 4GRWF 4MJIA 1G9NL 4RGNB 1SF5A 4KTDL 2VIRB 4CAGA 4QRRB 5C0DA 1YCSA 3ATEA 2I5YH 1ID5I 1CR9L 3RRQA 1RXLA 1IM3D 2OTWA 4OLXL 4XC1H 4F15B 5C0FA 1E30A 2HT3C 4DW2H 1OGAE 4FJ6A 1J0JA 1WICA 2IALA 1L7IL 2X2IA 2HXAA 2PW1A 5I24A 1KFAL 3VTMA 4FI7A 3BZEB 4L05A 1MHCB 2I32A 4C8XA 4DUXA 3ESPA 4LPCA 2AZUA 2X9WA 1J9QA 5DCCA 9CGTA 3IJ9A 2E6JA 2E8YA 1TU2A 1RIHH 4FFTA 1RUPH 5LVEA 3BWAA 4FQLL 2BOBB 2IGFH 1K8DB 2OMVB 3MRFA 4N6QA 1OTUD 3QDME 2CR0A 5J3HC 1EAQA 1QKZH 5EZIL 5AVRB 3RI5K 3QVAA 4W9DC 3HI6H 3QI9C 2IVFC 3G6AA 5JW4N 1L9RA 2XQBH 2DWSA 5DLLA 4YIQB 3NCYS 5L88L 2X1QA 3LH2H 4OZFA 2EEAA 2IGFL 1JN6A 2R4SL 4PS4H 1WISA 4OJFL 4DKDC 3UTTB 1JD9A 1RUKL 2C1PA 2HYMA 1BG9A 4GB9A 5H37A 1KIQB 4JDZA 1AKJD 4NZ8A 1NCOA 2Z64C 1CS6A 5CMAA 2DKDA 4JFDA 1HEJC 1B0GB 1AMYA 3Q6FB 3KYKH 1CT8A 5IMOB 3V4UH 1SVZA 3MV01 3RWHA 4LIQH 3M1BA 1CLYH 1SBBA 2QQLH 3RVWD 2OMZA 4FTVD 3PDGA 5IVXE 4G70B 1ANUA 4HT1L 4TSAH 1D7CA 2AQSA 4HIIA 4KVNH 4QI3A 4P5MB 5DJXB 3WLWD 5HYEA 1HHHA 2H3KA 2ZUWA 4NFBA 4AOFA 1JGLL 2X4RB 5D2LB 5J56B 2IH3B 2WMPA 2YPLA 5I30L 3U0WH 1YEEH 3ULVC 1IIIA 1UOKA 1M56B 2J6WA 4PIBA 4ERSH 3V6OE 5JQ6L 3OKMB 3L4XA 1IFRA 1YUKB 3KDMA 4IRZH 4ZMVA 4LEBA 4PTUA 1JG9A 4LCVA 3QHZH 4Z9KB 1TKWB 2E7HA 1UM6L 1WFUA 2FEDC 2R7EB 4MJIB 5IHWA 1WQAA 3UYRH 4GMSL 4D0DB 1PG7X 1JZ4A 5SWQB 4IOFD 4OJCA 4LASH 1HJCA 1ES0B 5ADOL 1UB5A 1O0VA 4JMXA 3FUMA 3IJ8A 3K6IA 4Y9BA 4GUQA 2VWEC 1I1CA 1NBZA 2IG2L 2Z7UA 2J6EA 4PS7A 2NZ9C 1ZXQA 5DC2A 1QWHA 2AJVH 2WXKA 4IOSA 1J5IA 1T2JA 2CDGB 2Q2LA 1X7TA 3NA4A 4TLSA 4WWNA 3ARFA 1GYWA 3ATBA 4DVRH 5LG6A 5GS2D 4KZDL 3FTWA 1MXGA 2NDFA 3BUQA 5FW6A 3IDYB 5DD6A 1RULH 1N67A 3GSVA 4NQDB 3UP1A 1KTRL 1T7VA 3D2UB 1PSKH 3GSUB 5FGBC 5D71L 5KSAB 2G60L 3UROR 4NJAH 1EZVX 4ZDHA 4O58L 4P2RA 4PJ6A 2LVCA 4M7LL 1Q9KA 4LIQE 1WWCA 2EACA 4JPKH 5CZXD 4BRVA 1G5GA 2OKMA 1YSOA 4YIQA 1TU2B 2CAKA 1YECL 3QUGA 1LO2H 2QRDA 2NNRA 2ZF9A 1EPFA 1ETZB 3V6BR 4ALAL 4AYFA 3QJTB 3PUUA 4ODXB 5D6CA 5KBLA 5E00A 4H0GA 4NZRL 3ZN6A 2PW1B 4H2CA 2BVUA 3IFPA 3FCTA 4ZUVB 1ZRUA 2GTWB 3RG1C 1G6VK 1JWMA 3SO3B 2P5PA 1NCCH 3MLRH 4FABL 1KYDA 4P4RA 4GYBA 3T3PE 1QNCA 1MJ7L 1ODUA 4QRUB 4RBPK 1D3CA 4NPYA 5B1BB 4ZFZA 1L0PA 5KAQG 2EH8L 2VN6A 4OBSA 4HIEA 4FOMA 1KIUB 4WENB 4N8CH 4OGXH 2KUTA 2LOEA 1U92A 5F3HB 5FCUH 1R5IB 1OY3B 2EAEA 1EEYB 4NLHA 3UGXA 4OVVA 4MZRA 3BQUC 1TJHL 3R8BB 1YUHA 3ZDWA 3EDDA 4Y0GA 4X6FB 3TM6A 4AUYA 1IBYA 3ESVF 3GXIA 1CXFA 4UTAL 1OOWA 1FO0B 2A4EA 4HUWA 3LRMA 5E08H 1GPOL 5E2UL 2WCGA 2Y8QA 1VFOA 1XCTB 1YYCA 3INOA 1BJMA 1E0OB 4PJXB 2E0PA 5DDHA 4D3CH 3ULVH 4KI5D 1O6VA 1DQJA 3LNFA 2APBA 5EC2B 2FSEB 4Q2ZA 1XF5A 2J73A 2Z6FA 4OU3A 2DWEB 5IJVB 4OUOA 2DD8H 3QIWB 3MRDB 3MR9A 5K39A 2ZOWA 3NFSL 2YPVL 3GSQB 5F1SA 5C0BD 2B4CC 1DE4A 5GGVL 4OIFA 5JUEL 5LO7A 1DHKA 4EIZC 4K94C 4N2MA 4JO2L 4RQQB 2ADYA 4IBWA 1YJDH 3OKOB 4WHYH 1R9FA 2ZKHL 2PN5A 1ONQB 4N8UA 5DT1L 3ARXA 4OSUL 1Q4NX 1JRHL 3O2WL 3O4LA 1OO2A 5GGVH 3ARTA 2MKLC 4M62H 3GSOB 3WDHA 3VW3L 2R2HB 4Q58C 3V7MA 4AZUA 2FYYA 2IV9A 1MHPH 1KGWA 3HW7A 3L08A 1K8IA 3UBXG 2ZG1A 3ISRA 4UDTB 5LCVL 5HHOB 2V7NB 1OF2B 2FEEI 3IFOB 1ML0A 2LR4A 4RESB 5G55A 1JK8B 4XTRC 2R29H 4PM1A 4TLKA 2BFVL 1WJWA 3SBWA 4KH2A 3D4GA 3GRWL 3JTBA 3U4AA 1ZS2A 3BAYA 3CVHL 2D73A 2IAMD 2YQ3A 3MUGA 4CC1A 3ULUD 2FTAA 5BZWB 5DJXA 2BVOB 2R29L 2D4DA 4AIZA 3VXOB 1XR9A 3HN8A 4Z7UA 5ETUB 3UABA 5K9KB 1Q0YH 1X6LA 4ZPTB 3SOBL 5IBLD 2O3OA 3GNML 4KY1L 2AITA 5HI4D 5LDUA 4NCC1 4E2OA 5F7BA 4LSTL 1PZ5A 3SKUD 4BZ2A 3OKLB 5B3SB 4R4BA 1TETL 3AADB 3IU4H 1D6EA 5FWQA 1EHXA 3RNKA 1T6VN 4RH4A 5JDJA 3UO1L 1IEAA 1FFOB 2VXSL 4ZAKC 5DS8B 4R0LA 4TUUA 1M6UA 2CDEB 3O2WH 4H1LB 3PWLA 2LT9A 3QDMB 5C6WH 1F58L 1TIUA 2EIZB 5KYWA 1J8SA 3EJUA 3HAEH 1EHLH 1X5JA 1A7PL 4S1SL 2AHIA 2AERT 3INUL 2RACA 3KGUA 3TT3H 1J11A 3VD3A 3WIIL 2AXGB 1UUSA 4ORZC 1QUNA 1NCIA 5T33H 1G9EA 1A6WL 1F6LL 1A6AA 4HJ0D 1TQWA 4HUMB 3DTXB 2ITCB 4F37F 1PLGH 3IXAB 4X80L 2QEJA 1JWUA 3X13B 1GJIA 4J4PD 1PFOA 1MI5E 4MMXB 3IFLH 2BOCB 1WFOA 1XT5A 3TZVC 2IGLA 2R4RL 1N64L 3VFMB 4K7PY 3CV5A 4KXBA 5HDWA 4R26L 4NNYA 1GZPB 5BV7H 2UUDK 3V4PB 4CL7A 3OLPA 3BIKA 1GYUA 4F7TA 4YZFF 1RI8A 3FSOA 3FONB 4A7SA 2DQMA 3AUVA 4JHAH 2XPGA 3EJZC 5LLIC 1LEKB 2BSED 1CGUA 2NY4C 3B7SA 2ESVB 4HKXB 2GIMA 1JZIA 2C4FU 3II3A 3N89A 3ZTDC 2KPNA 4FQQB 1NL0L 2D7TL 1VIWA 2EIDA 3SE8L 5J6GB 3ILPA 3WEBA 1U33A 2X42A 1MJJA 3WN6A 1C16B 1HQ4A 1KIRB 2LVEA 4DKAA 4Y88A 4HZLB 2BW5A 4WEEA 1N3NB 5JORA 1XF4A 1HILB 4AQEA 2EDBA 3QHTC 1X9QA 4XP5L 1I1FA 2GUYA 1EANA 2TSAA 1NUGA 4L4TD 3H3PH 1TQTA 1ETZA 4AYFB 2XTJC 3WLBA 3BKCH 3ZDYB 2XXFA 3DHPA 1FYHB 1UD2A 5C08E 2BRRH 1OARL 1AXIB 3EDKA 4N28A 4P23B 4QGYA 2FR4A 3U46B 5A16A 3QJRB 3DMMA 2CKNA 4DPCX 3T0ED 5SX5H 1URIA 3CSGA 3H9SA 2Q76A 2YEZA 1QSFA 2F53E 4Z7WA 2DB8A 2EDTA 2OR7A 1S7RA 2CO2A 5EO9A 4P9ML 4B0AA 5F1IA 3DETC 2WPGA 4NN5C 3NCFB 1KTLA 1XH2A 4UZUA 2PR9A 1WZKA 4LEEA 1U4EA 3C6LB 3QUMB 4LBAA 2ZWNA 5T5NG 4LPTA 1WF5A 3ARED 5C0EB 4NUGL 3E7JA 4XWOC 4Y19D 2NDGA 1E9PA 3CDFA 3DOSA 3W57A 4JRYA 1ZGLB 3BKMH 3OKLA 1DDHA 5D7IF 1UT1A 3ZDXF 3S96B 1BREA 4Z8FL 3VU1A 5DFAA 1BF8A 1J86A 4HCFA 2X6CA 4X2UA 2OMTA 1HOCB 1HIMH 5AAWA 2L7EA 4L8BA 2A99A 1A21A 1XR9B 1M7UA 4ZW8A 1TTBA 2ITDB 3HZVA 3I50H 1W0WB 3BX7C 4WKZA 2PWHA 1L3WA 2EINB 1I9IL 1J0IA 1EQWA 2CUMA 4ZAKA 2JB6B 3B7RL 3FO0L 1P5UC 4XPFL 4JFZL 3V79C 1LXTA 3QFDB 5AD0A 1G0DA 1MHPL 3A5VA 3CFQA 4NC1C 5IR1A 1DBKL 3ENEA 2WWNA 3AS1A 4WWID 2BLFA 4FQ2H 1FGNL 2FQDA 1C08A 2IH3A 2WK2A 5F70A 5KSBA 3B37A 5HGDB 2PXYB 2G0LA 4HKJB 4MDRA 4OM0L 4NAJA 5C0DB 4PY7A 4OZGA 1NBYB 4OFYD 4AMXA 1SHSA 1DVFC 4GBXD 1FN4B 3CTTA 4FQ1H 3V6OC 2ED7A 1CFQB 3RGVB 4XNQB 4BFEA 4DP6X 4FP8H 3QJUB 4M43L 1AG0A 3CH1A 2ED9A 4FXKA 4JFPB 4Z95H 4YWGL 3SE3C 3W81A 2CQVA 1T6WA 1DFBL 1KC5H 1PQZA 3LXAA 1QSVA 4FS0A 4G8FB 1L7IH 2OW6A 2KYIA 2CGRL 3MNVA 5GRJL 1LDSA 3GS7A 4P5TB 5CIPA 4ATWA 2BNQB 2IPTL 1C7TA 3Q8BA 5TD4A 3K4ZA 1TYRA 4RAVB 3T77B 3S5LA 1VKXA 5E1QA 2BVOA 3N0AA 3BUIA 1NFIA 1U8JA 4X80H 1YVLA 4X6CF 1J0ZA 4GIAA 1K5NA 2DM3A 2IDFA 4MD0A 1KTBA 5DLML 5E0QA 3EOAA 4U1LA 4JFFA 1FL6A 1NCBH 3WXVL 3LKNA 3K3QA 1S7WA 4L8DB 1FV1A 4JLRA 4XPGL 3ULAB 1S46A 3B8SA 3HHMA 3G5ZA 2BOBA 3QGVA 1BGXH 3EO0A 3S4SG 1YNKH 1NC4D 2OQJB 3GZQA 5LGHH 2EYSB 2B2XH 1GHFH 1D5BA 4M61A 3D50A 4Z76A 3M45A 2OX5A 5EPMB 1XMEB 5C08A 4AH2B 3NBNA 4CJ0A 4RISH 5DHYB 2K4AA 3V0DA 3WEXB 4AGMA 3BWSA 2VTFA 1CG9B 2IO5A 1IKNA 3KCPA 2VXQL 4U3SB 3HMXL 2HTKD 2I26N 3QDGD 4WU7A 5ICXA 1A66A 1I1AC 4HUNB 5E9NA 5FB8A 4PJ7F 3U36B 5ALBL 1YTBA 1CZ8H 2OLDA 4KJYB 4G80B 4JCWA 4BQ6A 3W11C 4KK8C 1JZ2A 3TNMB 1NTDA 4L0PB 2DH3A 2XVBA 3LH8A 4UTAA 1XEUA 1YEKH 2ERJB 2HWZL 2NTFA 1H8NA 4M6NH 5TF1L 4Z0BH 2NY0D 2ZSVA 2YKKA 5I75C 3N0PB 4FQJH 4MNGE 3NPSB 2XWXA 3ULVF 5EC1A 2XFGB 3QXVA 1A6AB 4MXQD 4TTDD 1VRSA 4YPGB 2HVKB 1EJOH 1I1AB 1ZV9A 3DGGA 4RIRB 5SV4A 1SDAB 1WA1X 5SX5K 5GS0D 4CVZA 1QUPA 5JR1L 2WQRA 1ZGLA 1QRNB 3DBSA 5AAWC 2WTPA 4QKTA 4ELKB 1BXAA 1NMCB 2PCPB 1TJIL 3HC4L 4JVWA 4TVUA 2P80D 1PIFA 4Y4FD 2VQ4A 1OZUA 3TDHA 3ATFA 1AR1D 3DVNA 1HU8A 3BLPX 5LQBH 3GSRA 4U6VH 1PQZB 1C5CH 4TVSa 2VDPB 2EXYD 2AEIT 2WXGA 4BH8A 5HHME 4FQXC 1KCUL 1L3NA 1Q9LA 4NIKB 4FLRA 3AC0A 4OZGE 4GMTH 4XH2B 5C6PB 2YD1A 3ZTNL 3FSAA 5C8JB 3TPKA 1VGKB 3MREA 3ALPA 4HS8H 1SJXA 2CJUL 3X14A 3TO2A 2QR0B 2Y7QA 1EZUA 5IEHB 2OR8A 3X1FA 3P4NB 1MCQA 5GGRA 2OULB 4R2GD 3P3RA 3VI3F 1NWPA 2EEXA 2CDFA 1R1CA 5GGUB 2EUVA 3GKWH 2J8OA 3N6YA 3OQRA 3PGFL 3BGMA 3F65A 4AENA 1AS6A 2EYTA 3BZFB 1B4LA 2IBZX 5KVFE 2PW2A 3ARDC 4PLKC 4JG0H 4QO1A 1LNUA 2F1BA 2WXPA 3VFUB 2W0FB 3L5WA 3ETTA 2NR6A 5EEXA 2J72A 3PF2A 3SYAA 1QR1B 2C9AA 3HPJB 4N1EA 3E38A 1B9ZA 4G7YL 1IBGH 3S3DB 3TYFB 5I1KL 4MNGB 1KMGA 5F7LB 1LWJA 4GP5B 4GAAA 4GS7C 4U1NB 1V8HA 3DVIA 4NWUH 4EE2A 1PX8A 2HT2C 3PAUA 2BSDA 4AQAB 2H3NA 3K72B 3DSFL 3ZBMA 3GHBH 2ZUXA 3KD4A 2J56A 4IOFC 1BPLB 3L5XH 4NHCH 3MJ7B 3CZGA 4PWGA 4U6YB 4UZGA 3GC3A 3ZGIA 1ZVHA 5E4AA 1H3WM 2CRYA 1GY1A 4F20A 3ML8A 5KBNC 4CU6A 5EOCH 5MHSD 2E75C 1BF5A 4F8PA 2BDNL 3PJNA 3RTQA 4ELME 4IRJA 2D7QA 4Z76B 1MY5A 3C5ZC 4J3OC 3WJLC 2H9GB 4C56B 1HKFA 3KL0A 4JRXD 5I16A 4Z78A 3B7TA 4ZFGL 3MGTA 3HMWL 4I0KA 3ZRSA 1T1ZA 1JK9A 2VQ1B 4N0YL 4R8WH 3QNXA 1C9SA 4NZTL 5E2WH 1P1ZA 3ILEA 3KM1A 2BMKA 4PJ8B 3GMMA 2OJEA 5IMKA 4ZMAT 3V0VB 3ASMA 1I7ZB 1QOKA 3W0WB 3DBXA 1U21A 3BKQX 2CDEA 4H1LA 3ZTJH 4AK1A 1MWOA 4W6YB 3WD5L 1XX9C 2HFEB 1LD9B 2K4WA 1EZSA 2B15A 3BWUF 3A23A 2VMEA 4UF7C 3R1GH 1O6TA 5T3ZD 4HAFA 4KKAD 3SOBH 4NNPL 4HT1H 2WNKA 5EBWB 1N7MH 1DANT 1RFDH 3RGVD 4PJ5A 4CKVX 3CZUB 4PBDA 3S36H 5C0JA 5IW6B 4Y4KB 2I07A 1AYRA 5LAXB 4ALAC 4CMMA 2YOAA 1XEDA 3FU9A 4WLCA 4DVBA 1I3RB 5FECA 1AHWA 3KPRE 2XA8H 4X6EA 4A7VA 1ZSDB 1IC4H 4XXWA 4TVPD 3QXWA 2EE6A 1HFUA 5E1IA 4NPJA 4HJUA 1FAIH 4WFGE 5C0GB 2APWA 5JHMA 3RVTD 4RMVA 3NCYP 3UBGA 4PGDA 3CHQA 3IE4A 4ZFOB 1R3LA 5CP7B 4C4UA 1MVYA 3P4OA 4ICXA 4NOFA 4N8VB 2Q8BH 4D7RA 2VLJD 4UDTA 4JRXA 5F7FA 2CIIA 1S2EA 1H0DB 3PY9A 4M8QB 2F8VA 1GGYA 2VLRB 4O2FA 2XRAL 3IJHB 5GSVB 2AKRB 2RR3A 5FGSA 3PQYD 3QCVL 3QXAA 1A6UL 5EEUA 2RFXA 3GTVA 5EU6E 4BCZA 5CBAB 1EZVY 3PGDA 1UYWL 4F91B 4AC2A 3IJ7A 3UZVA 3T3MF 2E9GA 1F3RB 4UU9A 1MW0A 4XP9H 1TETH 2BNUB 4BRJA 3F64A 3K71A 1S7UB 3ZL1A 2H1LM 4YDKL 4TQEL 1HQRB 1U95A 5JHBA 2VAAB 5I8KH 5L2KB 1M7IB 2ZUSA 3T6VA 1CIDA 4YHYC 1A1MB 1QTPA 5A2BA 3VH8G 1SQMA 3RNKB 5CEXB 4GSQA 3LQZA 1A6VH 1ADQA 3OMAB 3OZ9L 3ZE0E 2AK1L 1ACZA 2B5IC 2O6DA 4IOSD 4MMYA 3T0EB 4N87A 1L9OA 2OR9L 5AQ0A 4YC2B 2AJXL 1IFGA 3H6AA 1X9RA 4RBPH 1NGQL 4TSCL 3F83A 5I1GH 3LRSA 1PEWA 1PS3A 2JFCA 4KQ3L 4U1NA 4XNQA 1SJEA 2D0BA 1X5ZA 1ZLUH 4NJAL 5DUJA 2J55A 3A6CL 4RFNB 5HDQH 5KG9A 4WEMB 2L0DA 3S3SA 5HSHA 3FO9A 4K3DL 1JZ7A 4YFEA 4ZSOB 3KJ6H 1W6LA 5LWYL 4Y1AB 4HGKC 3DX8B 4PJDF 1PMYA 1MJ7H 2NNAA 1UACL 2FYYB 4ZSOE 4P59L 2CR3A 2XZCH 5DZLA 1MCOL 5G4OA 4OV5B 4HS3A 1EXUA 1T7YA 1NANI 1MWAB 2AJVL 5CGMA 4X6EB 1IBZA 5DJYA 2XC8A 4FXLA 3CXDL 1UACH 3DV4A 3HLKA 2P28B 3L4UA 3L3DB 1RY7B 3B9AA 4ONHA 1Z1WA 2RALA 4L8CA 3I6KA 4AYGA 4GLRH 3ELAT 4BM7A 4Y5VB 4NUPA 1J9CT 4RAUB 3EUUA 4NQDD 1D5ZB 4MXWL 4BQ9A 4I1PA 3OV6A 4YK4B 2A9NH 4MCZA 1QA9B 1OSPL 3WMPA 3GMNA 2G2RA 1KJ2B 3PV6B 3W2DL 5JO5A 5F7EL 5IMLB 1CDGA 1Y6KR 3TBCA 3MGOB 3HJEA 1FFQA 3DXAD 1F4YL 4Q9RL 3GSWB 3TURA 2ZX6A 4HYTB 2K78A 2HJLA 2Y36H 3K1DA 4E41A 3OF6D 5SX4I 3V6FA 1UQSA 5KJRL 1A1NB 4FFZL 5IVZB 2K7PA 3PPEA 3OR6B 5F7HA 2DV6A 4CC0A 3C5ZD 4K0OA 4LEOA 4V2BA 5ACZA 3OC5A 3U0PB 3QZWG 4RAHA 4WW1A 1HNFA 1XF1A 4PYGA 5F1NA 1A0QL 1RPKA 2J6EH 3HNSH 3OGCA 5CHNA 1QN3A 4NKOA 3BWAB 3I3EA 4BSWA 2NY1B 2NY2C 2J7LA 5BPPA 3ZX1A 3R18A 4XMKH 2XN0A 2QQLL 1FORH 2WO4A 2YLHA 5I1AA 3UO8B 4YSAA 3P2BA 4I4WB 3SGEH 4YDZA 1ZJBA 5C09B 4PW4A 4MYPA 5EU6A 1TEGA 2UZYA 1BXXA 1CGYA 2JVUA 2X89A 1TJXA 2AS5M 1U3NA 2CJSA 4M7JH 1AKPA 3LHPH 4LLVA 3TBYB 4P46C 2WGNB 1WFJA 3BPCA 3L4WA 4ZOBA 4FZEH 5FPIA 3WOVA 4WUKH 1O9WA 4XRCB 3MA7B 4PD4J 3T0EC 5E6UB 4PJAE 1RLBA 3VU2A 3D3VA 2FO4B 4ZPVA 4MAYC 2LLLA 5D1QD 4ZW5A 5KYNA 3OTTA 5DHYA 4DKTA 5E2TL 1R3KA 4D2NA 1G9ML 5KBDA 4O02A 5HJDA 1UATA 1JHLH 3N43F 3KPMB 4E9SA 3D8MA 3WE1A 4F8OA 1L6ZA 3KBPA 1HHIB 1HXYB 3WTVA 1PU0A 2WN3A 1AD0B 1VFUA 2ZYSA 1T21B 1Q0YL 3QS2A 3WELA 4Z7OF 1KYOK 1LDPH 1VZGA 3MJ9L 2Z92B 5E8NA 5HHVH 5CJXA 4KNUA 1D5RA 1SJMA 2W91A 3I3DA 4MTMA 4KK6C 3X14B 2BIHA 5AVUB 4AJYV 1E4WH 2ZOOA 2PWEA 4PWJA 4GRLC 4XCFL 5DYOA 3QJHA 2KHAA 2LTQC 4P23C 4XN7A 4EALA 1HESA 3WLBB 3AJ7A 4M1DL 4LOVA 1FFRA 2B9BA 2HT4C 3WFDH 1UTDA 5CP7A 3ZDZE 4KTDH 2DQGH 1U8OB 2APXA 4HSQA 5GSRA 4I3GA 4UYQA 5DJAA 2OMUB 4BD4A 4UV7L 3CDGB 3QXTA 4AYID 4XWOD 3CXHK 3ARFB 3W39B 3FHAA 1K4DB 3PV6A 4AMWA 1JN6B 3GUTB 1UD6A 3A21A 3ARYA 4GG8A 3QK0A 1UGKA 4RVBA 3UAEA 3MNZA 1YYML 4AC4A 2IFFL 4LESA 3Q9PA 4U3XA 4URKA 3LPFA 5IWLC 1DBAH 4LGRB 2HT4D 1M6OB 2X4UB 2K8MA 2GTWA 2C7UB 4OCYL 3MXVL 1LEGA 2B3IA 1A9EB 1UZ8A 3DVGB 1GZHA 3HBZA 4P2RE 5JXAH 3HFFA 3QIUA 4KQ4H 1AAJA 1ITBB 3FQTB 1RZGB 2VDRL 4MA3B 3UBFA 3ALXA 1S6NA 2FJFA 5I19L 1SDDA 1NDGB 4LHJB 1A14L 4N85A 2YOCA 5ADPL 2ZX8A 3HS0A 4DP9X 4A39A 4CGUB 4L4VB 4ZNEA 1KCLA 2YAOA 3JVFC 4I1RA 4WW1B 1L9MA 1JGDA 2W0KA 3QO1A 2H41A 4LEXL 5BQ7A 5BMPA 1JD7A 4OLEA 5GGRB 1B4RA 5KVFL 4YBQC 1CJYA 4KAQL 1H5BA 3B6SB 1KLFA 5I8CB 2GK0B 1KACB 25C8H 3DGDA 4R90H 4ESKA 3BH9A 3T0DA 2ZXBA 1YQMA 2E6QA 4PG9A 4EMZA 5IZ7A 3BAXA 3OM3B 3FCBA 3O3EA 1UT9A 3H3KA 2ZCKH 5IHUH 4KKQA 1YZZA 2E7BA 2A6IB 3QUXB 4DEPB 5D2NE 5HVFB 3BXNA 3DX4A 1KTDB 4XNYL 3TF4A 4A2MA 2X9YA 1U41A 4GKZA 3NIGE 4LLWB 4R9HA 1BCIA 2FJGB 2KQNA 5AW8B 3TO4C 5IREA 2EDKA 4BIKA 4BKLB 4XBMA 1J8HB 5DMIH 4DKFL 3A24A 2P26A 5IY5B 5E8OA 3BCFA 3LIUA 1E2ZA 3WTTA 3IPFA 2F19L 2HH0L 3N5AA 1L9PA 1XF2A 3MUY1 4KKNA 4HUXB 5DQ9A 1GAFH 5DQDL 1H8OA 3FQWB 3GBML 4QRTA 3T4AC 3T65A 4DQOL 4AITA 4OZHE 4YR6A 3BZ5A 4XB3A 4F1SA 5GISL 1BYOA 2OFQA 1NC4B 4XP6H 1M05A 1EUTA 1UJ3A 4NZUH 1YN7B 4G9FE 2YARA 1FNEA 3GK8L 2XACC 2X44D 4S1QL 1P6FA 3QDGA 4JFDE 2YXWA 3RGVA 3CK0H 3O41A 3RUGF 2VJ8A 5D7SL 3LMJH 4HD5A 4K5PA 1Q9WA 2IWEA 5L6YL 3T4NA 1BBJB 4S1QH 1P5DX 1KFIA 4X5WA 1ONQA 3TJEH 1ZHNB 4K3JL 1NQBA 3OR6A 4IBTA 4XO3A 3UJTL 1KDJA 4H26A 4M93C 4ELMF 3GUTA 5F7AA 3H9HA 1DE4B 4YXKL 3G08B 4R26H 4IDJL 4XH2A 1WP6A 1JSYA 5JW4Q 3CFKB 1NGQH 3EYQC 3Q9QA 1MAML 4FX5A 4HXAH 4TSCH 3HS9A 5SWZB 1P5VA 5FDWA 5DJAB 3I6SA 2P3YA 1YDPB 3T6QC 5IGXL 2JNZA 3QORA 1LEGB 4PSRA 2JI1A 3OAZK 4JKPL 4X99A 5JNYA 1H3GA 4DN3L 3CFCH 3QARA 4WFFD 4HK0A 1KXVA 5FYJU 4QHKI 1YMHA 2GCYB 3QAQA 2IQAA 1H3PL 1TVDA 4RGNC 5K69A 2WZAA 4PVMA 3EGDB 4DESA 4AV4A 35C8L 5IHHA 1SBSH 3ZRFC 1XGRA 2YSSB 2WUBL 3QJFB 4PJEA 3RKPA 2CJTA 3FT4A 4M8QA 1EX0A 3GEFA 3V4PH 5FHBH 1KJ2H 2JIXD 5CBEA 1AKJB 3NN8B 5FM8A 3V5DB 5K9QI 4E42A 1DSFL 3D4YA 2NLJA 2WUCL 1N18A 1MSPA 3WS6C 3J27A 1Q9OB 1X5XA 4AYBA 3S35L 2LV4A 2QV4A 1A65A 5I6PA 1KWGA 4UYPA 5IB2A 4AQ1B 2VITA 1ED3A 3C6LD 4JS7A 2CDGA 4KWUA 3VMNA 1DBBL 1KB5B 1C5BL 2CBPA 1FNGB 1JPTL 3QORD 2NY2D 1K5WA 3WBDA 3BVUA 1J05B 4N2FA 3CZSA 4K23L 4ZAKD 1IGML 4UQ3B 3VSQA 2O30A 4PRAA 4X7EC 5D2NA 1XGQB 2XWZA 4HHGA 1KFQA 1DJZA 2E74C 2ZXWB 5E99L 2W60B 5I6LA 5D7HA 2EQDA 1P7HL 3ROOA 5B3JF 4C54A 4E41E 1OLZA 2CZNA 1XB3A 2B59A 4N86A 2HLAA 2O61A 4G8AC 5ICYB 2F74A 3CU1A 3P4MA 3V0VA 4FNUA 1IILE 2VLKD 3QA3A 2HB0A 3ULUH 2CGZA 3FO1A 1TZAA 1B3IA 4X6DF 4AIEA 5HYFA 3T71A 5KVMC 1EHNA 2QR1A 2WSKA 4OT1L 4X5LA 1JHLL 1MFDH 3LHAA 5EU5B 1KPUA 2Y23A 4LCUA 2EXSA 5F7MC 1OT4A 3BD3A 5JPMC 1N12A 1R5WA 4N3TA 4PJ9C 4UDUA 3CFKA 4P2AA 3L7FB 4PJBE 2G75A 3UCQA 4EOWH 3IH7A 2BVPB 1R19A 4ZFGH 3QFJA 4PVLA 1D7DA 5KANI 3RGVC 4BWWA 3P0YL 4X4ZA 3NDZE 4R5TA 3ZU8A 1IL1B 3MLSL 1PJWA 1PZUB 1RZKC 1IAOB 1OIOA 4IOIB 2WLMA 2F7QA 3NUKA 3UZVB 3W56A 2I9TB 2CXGA 3QDJA 5F6IB 1AS8A 3NABH 3LDBB 3LZPA 4QMEA 5CN2A 1BJ8A 4GJTB 1G87A 3IGAB 3MCYA 1SLWA 2ENYA 2VZ1A 3MBXH 1G7LA 3E0GA 2PR4L 5IEKB 5DRNA 1BECA 4K9EC 3R4RA 5FKAA 1D6EB 3H9YA 3MJWA 4UAOC 4HVBA 4QNPE 3OKDA 3TTSA 1XH1A 3P0VH 2VR3A 2OMTB 5IBLC 3SQBB 2YR3A 3CPLB 4FEMA 2XWBA 3V4VB 1AOHA 2UXGA 1DJHA 3CVIH 5D2LA 4JANA 3HVDA 2R27A 1P2CB 1NLBL 3MV9A 3S98A 3UERA 3RWCA 3CZLA 3O9WD 4BFIB 2FX8H 4PJEE 4Y9CA 1KB3A 2ADJA 2UXTA 3H9SE 1FH5L 2DQTH 3MRCA 1NAMH 2WVTA 5IUSA 5KVEE 4OZFH 1FHGA 1F8TH 2R0WL 3X2QB 2GJPA 3M07A 4KX7A 5I76A 4YHOH 5I16B 3MDJA 4N5UA 1LK2A 3T1FB 1ZOXA 1FFPA 2UV3A 3CFCL 3CSTA 3IPBA 4Z7NF 3OHXA 1BOYA 2FEDD 5CP3A 1PNCA 2NY6D 1MWAL 2NOZA 2NSQA 2AXWA 4OFKA 2F54A 1LO5B 3GSOA 3O3BA 2XKNB 3PAZA 4AQ8C 1NCUA 4XN5A 2DWDB 1MAMH 4ZUSB 2D03H 1JGVL 1E4XL 3SB3A 4OZ4A 5F7DA 1YEGH 5AVWB 5LQBL 3BAIA 5JHDA 4LBEB 1PVHA 2RGSA 4WO4C 2A9NL 4P07A 4EDWH 4HOZA 3GRGA 2UZXB 3HZYA 3ULSB 5A2CA 1QN5A 2V2TA 1CB4A 1VACA 2LU5A 2WYHA 4PJIA 1WIOA 3D07A 3ZSSA 4OFYA 2H2SC 5EN3A 3WNNA 1MAJA 2X1XR 2D7OA 3NESA 1MHCA 3SQOL 4Z7VA 2P8PA 2IXQA 4CVXA 3UX9B 1MHEA 5I1GL 2CM5A 3CFDA 1CQYA 1HILA 4AQEB 1HQRA 3MNVB 4NJ9L 2YD9A 1I53A 4KKLD 2M8XA 1F8TL 5I17A 1TFPA 3P9WB 5M7QA 4R0LC 2CUIA 5LNDA 1MFAL 2B20A 3JV6B 4GUCA 5C3IA 3MMEA 1YEWA 3GBMH 2W65A 3F7VB 3DJZA 3MA9H 3IFNL 3ME0A 3AITA 4FXKB 3U6XA 2XJLA 4OD1L 1DL7L 2HG0A 4RNRB 1YTFA 4PR5B 4KMLB 1QSEA 3BSZL 4OZHF 4H0LC 1C12B 1UM6H 1S9VB 1FYTE 3KE0A 3ZYZA 4XNUL 4YDJB 1NM4A 5JR1H 1WCQA 4APQC 5FUZL 3W82A 1S4IA 2YIHA 4I87A 4IRJC 2YRZA 3CDZB 4QOKE 4WSKA 5CWSA 1KFGA 5DTFA 5FDYA 1MCBA 4B9CA 4XNAA 4POYA 5IUCA 2V7NA 3JV4B 3WE6A 1TMQA 4G59C 3VWJA 1RZJL 5HPOA 3KPSE 3SBWC 1SYSA 4Y8AA 4J6RH 5CUSH 1UH3A 2Z4QA 1R46A 4FMKA 1E40A 2C9QA 4OJEH 4JGNA 3IXAA 4JL1A 4QHMA 5EUKA 2OMYA 3RVVD 4N9OB 2ZKMX 3F7YB 2QKIA 4R7LA 4JFFE 2Z35A 3HG0A 3SGJC 3R4DA 5HHXL 3LPGA 1PCSA 4HD9A 1N5YH 1N4XL 1D5IH 2EXWD 2HJKB 1QSFD 1K4CB 2EUXA 3ZQ9A 4LCCA 4TL5A 5F96L 5H94A 2Y06H 1MCSA 3FYIB 3T0EA 1IKFH 3QDGE 1CLCA 2E47A 2H4EA 2XV6B 4YPGA 4FMVA 4KO6A 5SWZE 2MCPL 4LF3A 4NRYB 3D9AL 2OTPA 1JF1A 4LCWB 1R3KB 4EO5A 1WFIA 5LXVA 1FAIL 1UHVA 3CUPA 2HPOA 3KYNA 4G9DB 4P5KA 1W16A 5EIQA 1OP3K 4ROEB 4YBHA 3EO9H 2XG5A 1DUZB 2EDOA 2HJFA 3K8KA 4JRLA 1E4JA 2KPWA 5ANMB 2R1YA 1NFDF 3D3VB 1BFOA 1GTFA 3GXMA 5D7LE 2J5LB 3VB8A 2GY5A 2OS7A 2VDRH 1UB6A 5F3BB 4KC3B 1JTTA 4JUSA 3ARSA 4JFSA 1IEHA 4YXLL 3AMKA 3CLEH 1W6WA 3WY1A 4F27A 1U58B 4LOFA 4ONHB 4R5VA 1HC1A 4WCYH 1UC6A 3K6DA 1J1XH 4DJMA 1DQKA 1WS8A 2VO8A 3HG1D 3P4MB 5HJ3B 4BJLA 4HLEA 1OXYA 1IO4C 4IHOA 2E7MA 2DWDA 1ETA1 4MNQE 2N0KA 4NUJA 1B3JA 3KVPA 4YHIB 5FO7A 2F54E 2H26B 3OHXC 3L4CA 3EOYG 1BIIA 1B88A 3B2UC 3MOAL 1SUJA 3MX0A 2LHAA 3O0RL 2AJ3A 2ZUVA 4EBQL 3FB5A 4V11A 3HRPA 5F1NB 2EIKB 1XDTT 4Z1PA 1MIEL 5J1AB 1KFAH 1HAUA 4TULL 3O3UN 1PPIA 2DKMA 3A4DA 1WVZA 5DQ9B 4BZ1A 4RQQA 3N1MC 3H7BB 4J12A 2WQUA 1LWVA 3JUYA 3O4OB 1B0IA 4NQQA 4QRUA 4ABQA 3MFFB 2AK4D 2Z8RA 1E65A 3C6SB 4H0HB 4XN4A 3VVWA 1JYVA 2UZIH 3SKNA 2VXUL 5C0EA 4ZO9A 1V7MH 4WZSD 4J3WA 4G7VL 4OUUB 1QBMH 1QBLH 1NANH 5JIIA 1GJWA 3O8XD 5I6XB 1I7TB 4W9JC 2R69A 1KO9A 4F80A 2OX5B 2CLZA 5BRQA 3GZOA 4X9BA 4BHUI 4XOCA 1IIKA 4ODTH 4JO5A 5T1LA 3RIAK 2WW8A 4XC3L 2H4LX 3EJQA 1PFCA 3MBED 3OJMB 2JWYA 5HHNA 1QRND 4HV8B 4LXFA 4FNRA 3Q0HA 5BRZA 1A64A 3ML9A 4GI9A 1LO0H 4CSTA 5DJ0A 2LQRA 4HS6B 5E8DH 2NY5L 4I2XA 1V27A 3MRPB 3ZL2A 1SGKA 1TNNA 1H5BC 2NR6D 3C2AH 4A63A 3JYCA 3WTSA 1UVQA 4FQCL 3KS0H 3NAAL 2KMWA 3QQ3A 2ZAIA 1RAMA 1FNAA 2YXVA 4FZEL 3LIZH 1FFPB 1MFMA 3KPSA 3TA3A 5AOIA 3VVVA 1TYJA 1TQBB 2MQCA 5DR5H 3E8UH 1OARH 2VDNH 1LO2L 2F54B 5BO1L 4CRPA 1U8NB 3ZDXE 3FQ2A 3FQNB 4R4FH 1T6AA 2R51A 4AY0A 4ZPVB 5L4IA 4ELMA 5DA0B 1QYGH 3T1FA 1HEZA 2OXGA 4HF5L 4NRYA 3CQFA 4L37A 4DP5X 4P0DA 4TM9A 2JKJA 4BK8A 5JIMA 4Q52A 2W0PA 1BD2E 2JQMA 2WXQA 2Y2TA 3CN4A 3NCJH 5C7ZA 1IGIH 4AXWA 3CNKA 4ZOCA 1VTLE 1DVZA 1U3YA 1JVOA 1IJ9A 4P8QA 5CSZB 2G30A 3BDYH 1FG2B 3CPUA 3T08A 5KYXA 1TPXB 2VR7A 1IM9D 2YXMA 3BLBA 1M05B 5TH2A 4ZMPA 2VLKB 1SHWA 2H6OA 2Y6TE 3FB6A 4JN1L 2NSXA 1NC2A 1N0LA 1T89A 5CCHE 1EFXD 4NC0B 5HJ3A 1SEQH 2CDFB 2IV8A 5JXED 5FGCB 4NQXB 3NIFF 4P9HC 1IE5A 4IRSD 2MMXA 2I85A 5DC9B 2VN7A 2JE8A 2R0WH 3FF8A 3G5YB 2BWQA 3EFOA 2R59A 2VH5L 3CZKA 1C5CL 3BUDA 1XGUA 5KS9A 5D7JB 1M1XA 4NKDA 3C60D 3WIHL 4OJYA 3GRBA 1SPDA 2JB5L 5D1ZA 3UYOD 4WJKB 2YFOA 2GI7A 3K0WA 5DK0A 4MSWA 1P6WA 4BXSV 1OSEA 2NLVA 2ZOLB 2ZOKA 3QXUA 2TAAA 3P4OB 3QYCA 4KKBC 3VFOB 2VL5A 5EBLA 5IMMA 1K85A 1IRAY 3SE4C 4IU2B 4JQIH 1EBPA 1N3NA 3FQRB 1UT2A 3K71B 3PABB 3HG3A 1KNOA 4ICWA 4YHYB 1D2PA 1M3IA 1HNYA 1XMWA 4ISVA 3K2IA 1WAEA 3QPQC 3ZDXB 4MNGA 4DO4A 2H0JA 3FBQA 4BYHA 2XYCA 2V8QA 5BVPH 4B41A 2X4OB 3QEQA 1TTCA 5AB1A 1OAUL 2IQAB 2R5XA 3STLB 3NJLA 4YE4L 2IMNA 3EJZD 4KUZH 2O72A 1EFXA 2XQYA 5GS1C 3QNZB 1L9SA 5LKNA 3QXDA 4N1CA 5JOPD 3CH8A 4G11A 1CICA 2VR4A 4DGIL 5DJ8A 4N2LA 2CLVA 4LCYB 2YGPA 4FFYA 6FABL 1MNNA 5CJOL 1S8DB 2V2WB 2VISA 1PZBA 3HRZC 2HP4A 3ZMNA 4X4YB 5JLZB 3B3IB 3RWIB 1G1CA 1Z3GH 2FX9L 3ECQA 4QRFA 3SDCB 4JFFD 4EKJA 3VSTA 3TESA 3E6FA 3KLQA 1MQKH 5HD8C 4FL4C 4ZD3H 4PJ8D 8PAZA 3DJTA 4M3KB 4LHUB 3T0XA 1H15B 3RL2B 3VYOA 5E6IB 5IYBP 1KV7A 2AXHA 1LEKA 2CGRH 5GRJH 3SY0A 1RUPL 3NCXA 1TUPA 1AQMA 3PL6D 4WU7B 2XV2A 3ZT6A 3LZOA 4PJ5B 4R97B 4C56D 4ODTL 4P5MA 3FB8A 2M26A 4WV1A 4XOEA 4Z3HA 1UYWH 3QJXA 4RWHA 4LGSB 4D0CB 3QC5X 4QOKB 3FAWA 3SBPA 3FOLB 2IXQB 4JVPA 4DH2A 4O2EA 3SDDA 5HVHC 1T7XA 2VSKB 1IBBA 3HG5A 2X6MA 1DLHB 3HUJE 4L5FH 4QTIL 3ISYA 1CDHA 4O2CB 4P99A 5BJTB 3Q2WA 1RCYA 5CD3A 3U9UB 3TONA 4RAUA 4FXGA 5D55A 1TG8A 4G6FD 4NQUA 2Y24A 1JYNA 2HVBA 5A16B 1EMTL 4HWBL 1IGYB 3FO1B 5DVPA 2KLSA 1KBBA 3BUBA 3R0NA 2CA3A 3WY3A 4PJ8C 1CBJA 1DFBH 1P84J 2XCMC 3L5HA 1BFVH 4G6AC 3RY6C 5DZ9A 1XGYH 1QRNA 4EBQH 1CE6B 2JKTM 2ZKXA 1BMZA 2VLRA 3KWXA 3X17A 2OK0L 4Y7MA 1UXWA 2VMCA 2F5AH 3KYMA 4M3HA 3RVVC 1JL8A 4EZMA 3SGDH 1KUMA 1D2OA 3RX9A 5I5IA 1KTLB 2V5MA 3GSUA 2J8UB 5DHXB 1N68A 2NCEA 3OCIA 1TFHA 3NK3A 4FFYH 4IMKA 4N8VA 1XZWA 3Q6FA 1NGYA 4MCMA 5D7KD 3LN4A 4E5XB 4ZUWB 3O6FB 5E03A 1QSFB 5BMNA 5GS3A 4GSDH 4JPIA 4HLJA 4R7XA 3ZE2F 1NAMB 1R5WB 3LXCA 4MQXD 2ZJSL 3DRQB 3IDGA 4LLMA 4Z3JA 1L5GB 5F6IC 1SJHB 3VG0H 1PLCA 5I74C 1FVEA 1VEMA 3LKOB 4TRPL 1I85A 5ENWA 2AMGA 5MI0B 5A1AA 2HKAA 3L5JA 4PV8A 1LWHA 3GDCA 5F8RC 5GJSL 1QHQA 4MKMA 2CR6A 2OJZL 5KL0A 3KNBA 4OCMC 1CICB 1CG9A 2PO6C 1UH2A 3S34L 4PVBA 3V5DA 5A2FA 2E76C 1FRGL 4PGBA 5T5FH 1KGCE 4K5LA 2VH5H 4PRPB 1AZZC 5JLZA 1IAIM 3QQ9D 3PHQA 2NX5D 1YJDC 3EF7A 4MYWB 3QHFH 1R4XA 4HQQH 4NC1E 4QO1B 1MW1A 4FHBD 2BWDA 3HZVB 3NCWA 4RMRA 4YHKH 3DX3A 1F1DA 3OD3A 4OCXL 2VSMB 1AH1A 5FCUL 1MI5D 5C0CB 2W80C 3H42H 3TCLB 4B27A 1E4XI 4Z7QE 4N1HB 2HPTA 3KGRA 1W8OA 3THMH 1IM3B 4RWYH 4B0MB 1CDUA 1F4YH 4PRAB 4Q9RH 1ZA3A 1XSJA 4N25A 2ZSVB 4N90D 3V2AR 3DURA 5DMJB 3N40P 4JFQB 1FVCA 1YPZE 5CSGA 3H4HA 2DMHA 3DPBB 3JWNE 4PJGE 5LGJA 3H42L 4U6HB 2FYVA 3ARFC 5FWRA 4EI5C 1ODAA 1YEGL 1YEIH 3MUZ1 4Y4FB 1MFCL 4A67A 1JGVH 2D9CA 1U8HB 1XGTB 3MLSH 5C0BB 3SDAD 3KH4A 4P3CL 1BZEA 1EBMA 1NFKA 4XTRD 3FB8B 1NUDA 2XZZA 2VDKB 3OF6A 4ENEC 1MI5B 1JTOA 4JFPA 2ENPA 5KSBB 1EAPA 3FOLA 1I1AA 4RIRA 2HG5A 5T1KB 5TJWK 2HX7A 2DTSA 4I77H 2F61A 3BPNB 5DHVB 3OG6B 4NN6B 5KVGL 4GSXA 4ELKA 3L4TA 3HMXA 4MWFA 4AT6B 1NOLA 3AG3B 4CADA 4AQ1C 5E9DB 5CO1A 1NLBH 1ZTXH 4X83A 2XG4A 1JNHB 4OGAD 5DUBA 5KAQF 3BSZA 1FL6B 2C9UA 3VMPA 4P2OA 3GEWB 5IHUL 4O5LH 1S78D 3OXRB 4X6BA 3QIBD 5B7FA 4NBXB 2XTSA 2A83A 4ERSL 1L5GA 1AGCA 4KI5C 1TSRA 2YGVA 4NXKA 5F9JA 3S5ZA 3N91A 2R69L 5C08B 1ICTA 1UZ6E 3W39A 7FABL 4K3HA 2WOBA 3VUAA 3WENA 1F4AA 2DWTA 3TA3B 3VQMA 1MPAL 1UKTA 4WU5A 2WTRA 4F93B 3SJVB 2EVGA 1D9KC 4I4WA 2J8UA 3EZJB 4LAQL 2Y7LA 4B97A 1FPTH 5EMYA 2A9CA 5FGCE 2JCCB 4J3BA 3DTDA 4JRYD 3S34H 3MLUH 3QZWB 3QUXD 4LSQL 2CGYA 5I8OH 2ODIA 4ZQKA 3B6SA 1DSFH 5ESQB 3PLYA 3NEEA 4YUEL 5B1AB 3MU3A 2YAFA 4U7MA 1LK3L 3U2SA 4FERA 1IX2A 3FN3A 3HAEB 3P9MA 4Y8DC 3IMTA 1YUHB 4PB0L 2IFFH 3KL3A 4N2EA 43C9A 5KYWB 1RUAL 4WI0B 3NEXA 1I8LC 1XF5B 3H9SD 3OHXB 4HJJL 4LDEB 1B6DA 3CLEL 4P5KB 5F7YC 1JV2B 1CI5A 2W8CA 4OD1H 4PGBB 3TLRA 3DXAE 5CJ8A 3UEQA 2FNWA 2E7LA 3NA9L 3BAWA 3EYFA 3WJMB 1CK0L 1GHFL 3RDJA 1XAUA 2IDQA 3TIEA 4CUCA 4DF9A 5GQBA 4WFHD 2VW6A 4N2CA 1ROWA 1BF2A 4G1EA 3FW6A 2LFEA 3WLWC 4IS6A 3WFHB 3NA9H 1IC0A 3O41B 2BP0B 2GHWB 2C26A 2J21A 4OCRH 4HWUA 4RFEB 4YHIA 3CDGA 4WHCA 1KEGL 3M17A 2I5YL 5GSRB 3TO4B 4WFGD 4OSUH 5ACZB 3NFNA 4NYLB 4UM9A 5DT1H 3MRNA 1MFDL 5DWPA 5I28A 4U1GC 3ZMEA 1NSNH 4DZBB 2HFFA 1GOHA 4WW2F 1WZAA 5DMKA 3L1EA 2ZUYA 4BA8A 3KLAA 5F3FA 2NXZD 5BQDA 2Z0UA 1NGXA 4NUJB 1KZYA 5FO7B 1C5DB 2R2EA 4XP1H 1S9WA 4HW6A 1A4AA 4XGZA 1U8IB 1ZPLA 2IGTA 3IMBA 3KWUA 3VCLB 5IV2B 4ZFFA 3JT2A 5CJ5A 1I9RH 1VPOL 1Z9SA 5BOJA 3C08H 3R0MA 4J4PA 4M7ZB 5CEYB 3JWOC 2B5IB 3CIAA 3G6JF 4ZTPL 3N04A 2CA4A 1E27A 4LVNC 5EU3B 3MRFB 2YKLL 4ACPA 1OWWA 3I6GA 3MRLA 4HFWA 2F19H 3BN9D 5I8EB 2ICWJ 1TEFA 4Y2DD 1OCWH 2WY3B 3RX5A 4U33A 2VM4A 2ZNWA 1MLCA 4IJ3B 1QN4A 4E5XG 1QA9A 4UINL 3O3EB 3SKNB 5I1JL 4HPYL 1NGWA 5HTSA 4IRSB 3BDYL 2JCWA 1KGXA 4KKCC 1F6FB 1N0XL 1KXHA 1BW8A 5ESVB 4R2GC 2JTYA 3JV4A 3WE6B 4HK3N 4CILA 3MACL 5BXFA 4I9XA 1OWRM 1MVFA 2D31B 3QZWA 2J8UE 2ZUTA 5KN5B 1RUMH 5EUKB 3DV6A 5EZPA 2XTJB 1JWUB 1YN6A 1HWHB 4OGYL 3WMSA 3MJGX 3EFFA 1LWWA 1G7IB 4K15A 1PAZA 1RZ8A 1RZFL 1VB9A 1T0NA 4IMLA 3NSDA 1QSFE 1OGTB 1J0YA 2F53A 4PJHF 4Z7WE 3GI8L 2COVD 4EQ2A 2V2XB 2B1HH 3H3BC 3ETBF 1CDCA 2XZAH 1W8NA 3KGTA 4B53A 4QLWA 2UWEB 4JO3H 1VESA 4WO4B 3QNZA 2QLYA 2NOLA 1WH0A 3MZTA 2MJWA 3BESR 2CO4A 2G3NA 3LKSA 4OQ1A 5HHMD 2YBGA 1WQVT 3WFCL 4D0DA 1DDHB 2WWKO 3V5KA 5AKRA 1JZ8A 4OJAA 3T3PF 5E4IA 3VFMA 3MLZH 4XMZA 3BGFB 3I9GL 4AM0A 2X4PA 3BP4B 3APDA 1R24B 3NJIA 2X2JA 2VC2B 43C9B 4UIKL 4KPHH 1YY9C 4KKPA 4N68A 4U2YA 3TZVB 3FXIC 1NGPH 1G7HB 5IG7A 2G60H 4QF1A 3H8NA 3RBGA 3UJTH 3EO1B 3HC4H 4TUJB 1ESOA 1OLLA 3CH1B 5INDA 1FZMB 3NZ8B 4JL2A 3CHRA 5BZWA 5BOZG 1WA2X 1XCWA 2GSGB 4BXVA 1FP5A 4JAMB 5F0LB 2ZCKL 4RDQF 1BIHA 3WHE1 1E5YA 1O6SB 1H0DA 5FYJL 4L1SA 2P5WA 3ARRA 4LZKA 5E7FA 3AY2A 1A3QA 2F8XC 4C4KT 4AEFA 2K7QA 3IB4A 1YLBB 4Z0BL 4M8UA 4UNVA 1QYGL 3GXPA 4HZ1A 4UANA 2WLNA 3WIAA 1S9WB 1OM9A 1P5VB 4HJ1A 4RFEA 3KHOA 4PMFA 1RSFA 4GUPB 4LASL 2JELL 3QDMA 3I02B 4D9RE 1H6TA 5IJCC 3EADA 4OZFB 4BK5C 2NY2B 3D85A 1AGBB 2C3VB 1T66D 5DHVH 3RJQB 3R19A 4Y9EA 5TTRA 4P04A 3AT0A 3WNKA 2R23A 4YDKH 3VFSB 3VXMB 1MRCL 1DEEB 1OTUC 5TE6H 2W88A 4WGVB 5IQ7H 1RERA 1ZLVH 1HL4A 4WSGA 1BJ1H 2OSWA 3RY6A 2R7EA 3WCYA 1HEZB 1CFBA 3VFNA 4OZIB 2BSTB 4PTTA 3QIWD 2VUYA 4K2UH 4KDTA 2DQIL 3NJKA 5DRNB 5DVNA 1YQRA 3AREC 5CZVL 3QFJE 3FO2A 4MA1B 4MJ2A 3WNMA 1F45A 1S8DA 5AG9A 5C9KA 2AP2A 3MRLB 1R17A 3O11A 4Z7VF 4OJDH 2R1XB 1ZIBA 4MXVF 3AY4C 5L4MA 4H25B 2FECL 4XWGL 1EFXB 3WXVH 3QR0A 1YMME 2FQEA 1JZGA 3D9AH 5E5MA 4P2YA 2ARWA 2A6KB 2JJWA 2ADFH 4B5ZA 1KN2H 3NA5A 1H9DA 1EJ8A 4UTBL 1MJUL 3PHOA 1IKNC 2NY0C 2IPKB 4D0BA 1EO7A 4MNHA 1IJNA 5T3XL 2XKNA 3GB7B 5ESAB 4OI9A 2V17H 4XXDB 1DR9A 3WXWL 3DK0A 5FKPA 3ILQD 1SLXA 2YN5A 4BDVB 1IGMH 4MCZB 4D8PA 3F7QA 4YGAB 2EC9T 5IQ9B 2PYED 3OMIB 3O3BB 4MAUL 5K39B 1CFQA 1T1XB 2VL4A 2ZTBA 2GC4C 5IVNA 1JBJA 1AGCB 2IH9A 3MKKA 3AU1A 5D6DC 1A8JH 5IV2A 1M42A 3CMOH 3EFOB 4HEPG 4MAUH 4AUUA 3VJ6A 2R56H 1XWVA 2CD0A 4AEIH 2N59A 4CC4C 4IGBA 2JKXA 3BUTA 2J57A 5JMOC 3HC0B 4PWFA 2VDQH 1OAYH 1YQLA 1QMUA 3I0WA 4N0RA 4AVIA 3QIBA 2N01B 4PJCB 3KLSA 1JWSB 1VFBA 4F57L 4P2OD 4GIPD 5IEHA 3NIGB 2BOLA 2JKLA 5D5MB 4IIQB 1MCNA 4Z7VE 2WKOF 4YBLC 1KN4L 5AOZA 2OOXA 2JLPA 4P4RB 3IDXH 5D7EA 5ITFB 4GP4B 3CE1A 4N2DA 3VGBA 4F58H 1KCWA 2L7UA 3GTTA 1ADQL 5L2JB 1E4HA 4TNVF 5ENWB 4H13C 1G5AA 4J8QA 1NGPL 2QR0A 4FG6D 4DAGL 3HBGA 3VYPA 3N3EA 3MV8D 4IRSA 3IMVA 1KBGL 1I85C 1YY8A 2IAMB 4BZYA 3ILQC 3UZEA 2E56A 2HTLC 1XZ0A 2VUOA 3Q6GL 4ZX6A 2PCFA 5GIRB 3PUCA 3ZHKA 2EIBA 5A43C 1S9XB 4U1SA 4P57A 1JGEA 4XVUD 4XMPH 2V4LA 2PO6A 2JJVA 3F7LA 1IM9A 3V4PL 2BJML 2QVKA 2ZYHA 1XCTA 4PJXA 5AL8A 5TE4H 4X9IA 1HSBA 3QNFA 3KPPB 3LEXB 5BVJA 5GRUL 3X3FL 3CZFB 3QI9A 4X4MA 5IWLA 1NIDA 4X99B 4JN2B 1NBCA 4UB0L 4DP8X 4MS8C 4G6JL 1LP9F 5ACMA 5DZAA 2X0WA 1FYTA 5C3LD 5K59F 2JSFA 3AS0A 3PHQB 5L8LB 3QIUC 1WWAX 1B4TA 1XCQA 4KDTC 4N3UA 4XC3H 2DN7A 3PE9A 2Z4QB 2XYBA 1NEZG 3B5GA 1VSCA 2ZXEB 3CVDA 1I3GL 3HS0C 3F0ZA 1A6UH 3ABKB 3AY4A 3KR3H 4NN7B 1DLHA 4PJBA 3VWKB 3KTUA 1QZ1A 2R0LL 3C04A 3TIDB 1LEIB 2RHEA 2QBWA 1PD1A 3QUZD 3V0JA 4G6FB 2B3RA 4JJOA 4UT9L 1DVFB 3BP5B 3L7FA 4UOJA 3IGUA 2XNAA 4GG6B 3MBXL 2CK0H 4NO0A 3OL2A 2DLFL 5K1NA 4ADGA 1DZ0A 3NTCL 4UINH 4Z3TA 1WZ1L 2CUAA 1H3TA 4YSOA 1PD6A 5C0JB 2P1YA 3KPNA 5EIIA 4GQ9L 5IYDP 2BP5M 5CS7A 4I77L 4Z0XA 4HUVB 4WI7A 4QKXB 1I8LA 1IAIH 5E24E 2EDQA 2OR9H 2NR6C 3FSZA 2ZUQB 4HWNA 1KBPA 2P8PB 3UG4A 3NZHL 2N1TE 2G0KA 4JO8A 1FNEB 4NM4L 4FQCH 3H56A 1CE6A 1I9RL 1VPOH 4ZW3A 1ZMYA 2BC4A 2VCOA 1JNJA 5L0QC 2NNXA 4XBGA 4KHXH 4PJEF 3TT3L 3VG9C 4A68A 3BGMB 4R83A 3K8LA 3MRRB 3WFEH 5ESVA 3ZQXA 4JM2F 1FZJA 2R0ZL 4HC1L 5FUCE 1JNLL 1XL6A 5MP6H 4XNMB 3MBEC 3R1GL 1A22B 2FWSA 2GIXA 3R7QA 1AI1L 3GKZA 3TBTA 3S3JA 4AMKH 4KKZA 4GS7B 1BVKA 3VJ6B 1TCRB 1AXSA 1S9YA 3GGWB 2DQUH 4JFTA 1F1AA 1M7DA 1FNHA 4Y2DB 2WKGA 3SKJL 4DULA 3MV8E 4ZMZA 2DLIA 2C1PB 2HUHA 4JBSA 1HL8A 1SOXA 2NOHA 1M71B 2X6VA 4HJ0C 3N06B 1DQMH 2AFNA 2CLZB 3MGAA 4NN7C 3ARDB 2H0FA 2IBBA 3CFEA 3PDOB 4NC2B 1AC0A 3UTZA 4G1MB 1FVCB 2QELA 4UQ9A 5L8JB 2EILB 1LK2B 1DO6A 5IFAL 1UM5H 5E8EB 4KV5F 3UTQB 5I1LB 1KJVA 1N5YL 2R29A 3L9RB 1QFWI 1F4XH 1U91B 4AL8L 4B9JA 4K07A 4GP8B 1CFSA 1ZS8B 2CO3A 1BVNT 5AYUL 2DWYA 1FJ1B 1LILA 1SLUA 1T5WA 2A77L 4F33B 4U6XA 1E8XA 4XPAL 2F15A 3UJIL 3BJLA 4N9GB 3BVVA 3ZDZF 2V92A 2I9LA 4L9LB 1M1SA 3ATDA 4I2XE 3U4BH 3DROA 2Z1KA 2CG9X 1UJ3B 4EDXB 3KBFA 2IEPA 2ZJSH 3S48A 4PGEB 4KXAA 3C5JB 4WWKC 5C3TA 2TRYA 2CNYA 3R8QA 2A6DB 4WCYL 3BSZH 2NYYD 1ND0A 4YSQA 3M7FB 5IQ7L 2NY4B 3DHJA 5J12B 4GRLB 1RUKH 1YC7A 1P53A 3ZL4L 3TO2B 3NFPA 3UIZA 1NMCC 2QSCL 2PTTA 4H8WH 2OTUA 4PJFB 4X6CA 4KPHL 4Z6AT 1FPTL 3CDYA 3AU0A 2FIKB 5C0FB 1IAKA 1CMOA 2WIIB 5KVEL 3ZZQA 1KY6A 1MI5A 1OW0A 3I74A 3POCA 4X5XA 5EF2A 2YJQA 4MS6A 2VZUA 4NSKA 2V5SA 5IK3A 3MX0B 1KLUA 3TEWA 1TTFA 4WUKL 1DVQA 1SFDA 4IKJA 4ODSH 5D1QC 1IB5A 1NIBA 3GLEA 3MRQA 4PJBF 3VI3E 4MJJA 1RJYA 2DMKA 1SF3A 1C8QA 1D5IL 2WZ5A 4JGUA 4OIAA 5DJDA 2YH5A 4MDJB 4AG4L 4Y89A 2D0HA 1AIZA 3A3YB 3E3QC 5B7EA 4CDHA 4JE0A 3EOTL 1WBZB 4R84A 1CYWA 2H8PB 5SWZD 3FB6B 4IYKA 4J5VA 3MGOA 4I0PA 1CE1L 2X70A 3IRZA 1MVUB 2QPDB 4UIMA 1G9NH 1BQRA 2DJMA 4BEIA 1BLNB 3SJVA 4AEHL 5SWZA 4LMQI 2J1YA 3AWGA 3BVNA 3G3LA 2MSPA 4DN4H 5F1KC 4YHOL 1O5DT 3MRJA 1L6XA 3FRUB 3N2JA 3WL9A 1FVDA 4P9MH 3OKEB 2AJSL 4S2SA 3O8XB 4Q97A 3H1ZA 5FYKD 3BO8B 1Q94A 2QVIA 3NAAH 4IBSA 5KS9E 3VM5A 1JZ6A 3TN0C 2O6PA 3QEQB 2WYIA 4LT7A 5GJTL 3ME0B 3MV8A 3QUZA 3QUMA 4NLAA 4MRQA 1ZT1B 3QEQE 4KXCA 5IB2B 3GI8H 4FQPA 1EZLA 2HFTA 1TZOA 1BEXA 4JG1H 4P5TC 2FB4H 4X42A 5IQ9A 5MEQB 1CDYA 1BQHB 1PGRB 4G8GD 4N0FA 5I15L 3CIQA 2DEWX 1UURA 4ALAH 1H3VA 4JRYE 4Y5VC 4NKMA 5ICUA 5AW6B 4AZ8A 2JHJA 1PY4A 1NJ9A 4YFLF 3L16A 3NSXA 3US0A 4OD2B 2JJTA 3UG5A 4QR7A 1X9UA 1A9BB 4A2HA 5LWYH 3O0LA 2EUWA 3PWVB 1YNKL 2HFFB 4NQCE 4YGVA 5DMKB 5J3HD 1ZGLP 3GZPA 4B96A 1RJLB 2M83A 3JYBA 3BMVA 1Z0MA 5BS0E 3Q1EA 4NRXA 4NM8H 1RP9A 2BVQA 3IDNB 1JFIC 1XXDC 5DS1A 2BVPA 4QIRA 1NDMB 4RMTA 2Z93A 1BHGA 5CEYA 1K35A 2VDPH 3BPOC 3L3DA 2APTA 3MLZL 1XXFC 1GIGL 2ICCA 4QF1B 4QRPA 3SDYL 4MCYB 1ZV2A 1HHIA 4LCUB 2FJSA 2JIXB 2H0EA 3ARDD 3VXME 5EEWA 4QXTA 4U31A 2BZDA 4L3EA 4N2GA 1JPFA 1DBMH 4UU9B 3G5XA 3FJTA 4CSPA 5KBKA 4HJJH 2PYEB 4LSRL 4L29B 1MFCH 4G8EB 4JPVH 3U1PA 3BQUB 1QQDA 4IRZL 3D0LA 4C55A 3KDPB 4HXBL 3O81A 1KJMA 2WLYA 2WVVB 4Y1AE 1DJSA 4JHZA 1IC1A 3IMRA 5I1HL 3AB0C 5CGTA 4OGZA 1JFQL 3IYLW 2UZYB 1CLVA 1OD9A 3U0PA 1HCZA 4LEOB 4OCNC 3CU7A 1RUQL 4OCWH 4OD3L 1G7LB 4KI1A 1G1KA 3G5ZB 3AG1B 4LFHD 4S1RH 3G9AB 3COOA 1G7IA 4YX2L 5DMGD 3FO0H 5ERWB 5JTWA 5D1ZD 4LLMB 3VFVB 4LAQH 5ISZB 4U6XB 4E9WA 3STLA 5J12C 4U3CA 2VLRE 3S88H 1DQQA 4BSVA 4L5FL 2OL3H 1CLYL 4YX2H 5FM5M 1KV3A 2XKUA 5B38B 3FOMB 1KJVB 3VM7A 1MHHB 4XCNA 2DPKA 2FLMA 4LDLB 5B39A 5I73B 3BZ4B 3GUFA 2WO2B 4LLVB 3OSKA 3BT2L 2YA0A 4HUUB 1NMBH 2MWCA 4JHBA 2Q7YB 1IC4L 2ZFDB 3Q5OA 3UTPD 4XMTA 3HB3C 2CKBL 4OH2A 1QLRB 1KLGA 3IJSB 3LZFL 2X87A 1ZPUA 3MLPA 3G7TA 5ETUA 1AI1H 1RQ5A 4JW3A 2BFGA 2QGBA 2PPAA 4RX4D 2XZQH 2P24B 1X5GA 3L6FB 1BYNA 4MHHI 3LKSB 1OCOB 3D34A 5JW3L 2PP8A 1RL1A 2Q2EB 1VDGA 3EYSH 2EE3A 3MLXL 3RU8L 1Z3GL 2V0AA 4PRNA 1FO0A 5I8CA 3MRGB 1GVIA 1HH6B 3MRKA 1XTLA 2QQKL 3KLHD 5LN4A 4ZZFA 1OB0A 3HE6A 4JM2D 4IRSC 4A2EA 1OP4A 1TJGH 4OM0H 2BNRA 4F2EA 1NM9A 5JW5B 1Z7JA 4P4KB 1YPZA 4IJ3C 4UT6L 3K7UA 4G2AA 1WEJL 1OKEA 5IMLA 4J3OG 5DHVA 2RA1A 5LXGL 2DJ4A 1QPKA 5HDLA 4NM8L 2P44B 4L1TA 3D12B 3NTCH 4QTHA 4DW2L 2C9RA 3VFPA 3GXDA 1NCDL 1KBWA 3C87A 2C1OB 3DETD 4LVNB 2UYLA 2WNXA 3G9VA 5DFWH 2OZ4A 5SX4H 3ZTEA 2FAUA 1G7MB 3EZ8A 5EO1A 3IDMB 1B2YA 4HIJB 4QTIH 4LKXB 2R83A 1KG0B 1JWMB 5CEZD 5IW1A 4MZ3A 5DUBB 5A2IH 5AG8A 4OLUH 5DI8A 5JIQA 1UCBH 2GAZA 2WXIA 3GSQA 3NGBB 2C34A 3ERXA 1NFDA 4GAFB 5C0RH 4PVNA 3AQYA 4F37K 5E9DA 1NCHA 2YJLA 1T80A 1D5BB 4HF5H 3QE5A 2WP3O 5DFTA 1BIIB 1NGYB 1NC4A 1RURH 3NIFE 2X6AA 1JNHA 1XV8A 5FFOA 5EG6C 1WAAF 3BD5A 3C09C 4HC1A 4PHZA 3TBWA 4H2AA 3UFIA 3W11D 4YDMA 5IJBC 1IVLA 1CFNB 3SYOA 3HI1A 1JF6A 4G72B 4IGBB 3V55A 3B83A 4J3SA 1AZRA 4QYAA 4NQSA 3E8UL 4GFXA 2ZUUA 4ODWB 2Z35B 2RFXB 5CBAA 3F12B 1AY1H 3MROA 5F8QC 1ZLWH 3HZMA 3DMMB 1BZQK 1VHPA 3IJYB 4BFJA 4QXUH 1TVHB 3HAEG 2BNUA 3DJ9A 2Z7WA 4HU2A 1QFUL 1BZ7B 4CNIB 4HV8A 4EAGA 1UENA 3BPLC 1BQHA 2Z91B 1A7PH 4AI7A 3VXNB 1CZ8L 2NXYB 3K6NA 1S9XA 4PP1C 4U1SB 4Q6IC 1EHLL 4PCTA 2H3NB 3K72A 4QY8A 3QRBA 5IB5B 1S5HB 2BH0A 1AVAA 4LNVA 1FF5A 4D8OA 4X6CE 4D0CA 4PG9B 1P7QA 3QUML 1CQKA 1QEXA 3ZIYA 3OPZH 4NNXA 1KCBA 3QPXL 2FSEA 4PFEA 1WBYA 2PTTB 4Q2ZB 3UO1H 4CVWA 1M7DB 3A6CH 3JBG7 2ROYA 4Y2DA 2YD5A 5JYLA 1IVTA 3GHPA 1BP3B 2FB4L 2CKBA 5EZOH 4E0RB 4XODA 5I1EL 5D7SH 1IAKB 3ZJAA 1Y7VA 5IW6A 3OKMA 5BO1H 2JI3A 1QI5A 4GRWH 1UWXK 4FQXB 4AW4A 5EH1A 2XQYG 2XFXB 4Q74A 2WWMC 4YJZL 5BUPA 4TSBH 2GW5A 2R2BA 3BN3B 3WKNA 1KT2A 4OF3A 4PB9L 4X7CC 1PX4A 4IBUA 1P4IH 3CVHA 3IFNH 3KLKA 2AJ3B 4WFHE 3SKOA 2BOCA 4HKBB 4CBZA 3SPJA 2W07B 2R2HA 5C1MB 5IMKB 3T65B 1EO8L 4L8BB 3ARWA 4X5QA 4A7UA 4GQQA 2XVLA 4NQTA 2RMNA 3FULA 3ZKMC 4EN3D 5T1KD 2JI2A 3VXTA 4QHKJ 3O6FA 1CU4H 3LKRB 1L0YA 1KBVA 3W9EB 2OI9C 1HHJB 3KXFD 2B1OA 3MNDA 1URZA 4NZJA 1CTNA 4AVJA 4W70A 4R7NA 4YS4A 1R3JA 4B3EA 3BP5A 5AZ2H 3ARVA 4EDWL 1E6JH 1BV8A 4HKZA 4LLQA 4ZUUB 1HKLH 4L0YA 5JW4R 4DOHE 4Q9CA 1OV8A 2WC7A 3QRGL 4PCKA 5FM4A 1U95B 3K74B 3TBBA 4LHUD 3U4BL 3QYMA 4RWYL 2FIKA 4HK0B 3H85A 3A0OA 2MOVA 2Z8SA 3FB7B 3SGKC 3IWVA 4ODXA 2ATPA 2K3HA 3MRRA 2FR4B 1V3LA 3BFWA 1E42A 1QSED 3LZFH 4RX4A 1AISA 4XWGH 4UT6H 1KGCD 4JZJC 5T3ZE 3MJ9H 4I3RL 2OP4L 1PG7H 5TDNB 5ADPH 2GYSA 1FIGL 1SY6H 2CIKA 1XIWC 4UM9D 1UKSA 4BSJA 4EAKA 2HLFC 5K1JA 5D96B 4XHJD 1I3VA 3UDWC 4LOUC 4O9HL 3UP6A 1E50A 2OMBA 3ZYIA 2WWMD 2WXLA 5ID1A 2P5WD 5FEBA 3STZB 1E28B 1JRHI 3KPRD 2WKLA 2QKSA 1JCKA 1IU1A 3VFGL 1KJ2L 5AB0A 5K9JH 5H2BA 1Q72H 5IM7B