2G30A

Beta appendage of ap2 complexed with arh peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 complex subunit beta-1
publication title Molecular Switches Involving the AP-2 beta2 Appendage Regulate Endocytic Cargo Selection and Clathrin Coat Assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2g30A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2g30A02
2D0CA 1KY6A 3H1ZA 1QNAA 1CDWA 1PZDA 1YTFA 3ASMA 3VN5A 1C9BB 1TGHA 1QNCA 1NVPA 1QTPA 2MJ7A 1QN6A 1B9KA 1VTOA 4ROEB 3HS9A 1QN9A 1QN4A 5IYBP 4ROCB 2IV9A 1RM1A 1QN5A 4WZSD 5IYCP 4RODB 4B0AA 1YTBA 1TBAB 1NGMA 1JFIC 1QN7A 2IV8A 2Z8UA 2VJ0A 2D0AA 1E42A 1VOKA 1KYUA 1KY7A 1QN3A 1QN8A 1VOLB 3EIKA 1VTLE 4PY5A 1MP9A 1W80A 1KYFA 3OC3C 1D3UA 1R4XA 1QNBA 5IYDP 2D0BA 2G30A 1KYDA 1QTSA 1TBPA 1QNEA 1NH2A 3OCIA 1PCZA 1AISA 3HS8A
chains in the Genus database with same CATH superfamily
4HUWB 3SBWC 3SBRA 4DCQB 2C9AA 1RIVH 1SUJA 2Z4TA 3KPSB 1L7TL 5DJ2B 5DLML 3ZDZF 4H8VA 3GB7B 2BX5A 1KCUH 3SPVB 3CDGA 1QBLL 2D9CA 3QJVB 2LOEA 3SKOB 1JVLA 5CZVH 2EE6A 3MSPA 5C6PB 2CRMA 1T83A 2QVIA 3WKNA 2XN2A 2BY1A 2J43A 4MMZA 1FIGH 1T5KA 3UTQB 1VKXB 2ICES 3RL1B 3BW9B 3LRKA 2EKJA 5C0RL 4I77L 2UY7B 1SN5A 2RA1A 5DMIH 4B9IA 2APWA 2QQKH 4S2SA 1QO3A 1AMXA 2VR6A 4LSUH 3TV3H 4EN3B 3H2PA 3FO1B 3TVMB 3B5TA 3GRWA 1E43A 4KI5D 4N28A 3AY4C 4IGBC 1N6VA 3F85A 1D5MA 5A6IA 3DVGA 3HLKA 3GRWL 5GRXG 1C7SA 4LARH 1UZ6F 3MDJA 2YD6A 4Z7NE 3PDGA 3CWAA 5IVNA 2BNUB 3MKKA 5A16A 2BHZA 3M86A 3PGDA 5E99H 3TASA 5HJDA 5F44A 2EXWD 2NMSA 2YSSB 2GTQA 1X5AA 3WJJA 2PABA 3RDTC 2OJ1A 4HW6A 1EA9C 3ZE2B 4ORGB 2YJQA 1G1OA 4UAOC 3H2WA 3RWDB 1X5GA 4JX0A 2IJ0C 4X8GA 2KPNA 4GIOA 4NO2B 4HIXH 1OAQH 5J6HA 4LL9A 5DD1H 3UYRL 4MLIA 3GSUB 1AS7A 3DJRA 2BOCA 1X3DA 3AGVA 4JRYD 1TVHB 2FRGP 2C7UB 3BUTA 2WZ6A 3KXFA 4LSPH 4HISA 4C57C 2X4SA 4IIQB 1XF4B 4KKLC 4KK6C 4BUHA 1U8NB 3PUCA 4QYOB 2D0BA 1O9WA 3M7FB 3CFQA 4WGWB 3ZR6A 4DW2H 1GZHA 3G04A 5E8NA 2XWRA 3FB6B 3BVNB 3JTSA 1MELA 3P9LA 3CWSA 2FL5A 3VU2A 4D9RE 4F7PB 3BAEH 4G9FE 2VDML 4YFEA 1ZGLP 5C0DB 4MXWL 4XO4A 2HTLC 2HTKC 3SE3C 3TZVC 1BZ8A 2OMTB 3NP3A 2BP3A 2DYRB 4HFUL 5FYJU 3SE8H 2YBRA 1AC6A 5DYFA 1YPZB 1TQTA 3MREA 1UT1A 4NUJA 4CMMB 4CSZA 2YC1A 4P2QD 2DWDB 4PJ6A 1M6UA 1DHKA 4LLMA 3LHPH 1KDJA 4PLNC 4BEIA 2HLAA 2HJFB 5T3ZH 5I8KL 5EOTB 1EXGA 1ZCRA 5D1ZB 3TPUA 4NQCE 4PR5A 2E56A 1LK3L 5JHMA 3DHMA 3O11A 4Q9RL 3BPOB 4L1DA 3UBXI 3FONA 2CO6A 1G5GA 4PLOB 3SQBA 3A5VA 1HZLA 1B0GB 4B9YA 3SYQA 4S1RH 4HG4K 3T3MB 1LEKB 1X5KA 2QRCA 3Q5TA 4MJ5B 1UJTA 3D51A 1Z7JA 5EV7A 2Z31B 2ROXA 4UNUA 1T7WA 3BGFC 1F8TL 3BYTA 3RX5A 4WU5A 5SX5H 1N4XL 1BEYH 3VYPA 1SJXA 2JJWA 2YGQA 4TVPD 2N1TE 4FLRA 4DVBB 5CZXC 1A4JA 1QA9B 3ZX1A 4KUZL 1H8LA 5I2IA 5CSGA 4Q11A 4FABL 3H55A 3SBQA 5DD6B 2N7BA 5ECGA 1SBBA 3O3DA 4OLWH 3H7BA 4PRNB 4R7LA 5I82A 3PNRB 2EIDA 5I15H 2ZP0T 3DDFA 1MFNA 2XTJC 3VW3L 4XAWL 2EUZA 2P8PB 1XVSA 1OP4A 4YDJA 5AB2A 4P3WA 5AB0A 4FKKA 3V6OC 3ZKXB 3S3SA 4H25A 2A74C 1WAPA 1TO5A 1Z5LA 1A2YB 3RQ3A 3NIGB 1XGTA 4YIQA 2VLRD 3O6FA 2WBJA 3AROA 1OSPH 2Q10A 5EBLA 3CXFA 4APXA 1MF2L 3OC5A 5FK9B 3A3YB 4ZUSA 4JHWL 5BS0B 1U8MA 3FPYA 4YXHL 2F1BA 1FJ1A 4JJHA 3QT2A 1FH5H 1PLAA 1QUPA 1Q94B 3OR6A 4X7DC 5HGDA 3TF7C 4ELMA 4P5TC 4NWTL 3Q2WA 4N0UA 5T1LA 1U93B 3OM3B 1IBYA 3WY2A 1MEXL 2WUCH 3NCJL 1BM7A 2WVVA 3T2PA 1YEIL 1ZEAL 2E6QA 3HOGA 4G6MH 4WW1B 3U7YL 4CJ0A 4F2MA 1L0YA 1HS6A 1EMTL 3QDJA 3VSTA 4UI2A 2BMKA 3TA3C 5JMRA 2ED6A 1F86A 1FH2A 3D09A 3P77A 4FXKA 1T0PB 1NPUA 1CICD 4NS0A 2Y36H 1MREL 4S1SL 1JS4A 5D2LA 3UCRA 3T8MA 3FT3B 2OTWA 4XTRC 2AV1B 5EO0B 3BPLB 1BQHG 3B9DA 2PCPA 3KWVA 5C1MB 3O2WL 2WLZA 3GBNL 3SBWA 3BCDA 1KXQE 1E4WL 1Z2KA 4M4RB 1QSEB 2CGRH 3DROB 1RL1A 4H20H 5CEZD 1PX8A 2CNZA 3FFCB 3O6ML 4JE4B 5HY9B 5MI0C 1E9QA 4X99A 5D2LE 2CK0H 4FNPA 4DKEH 4LSRL 2WXIA 4LBEB 3Q8CA 1OW0C 4BCXA 5FUOL 1QR4A 1FNHA 2COVD 4OSUH 5ESQA 1BDYA 3L16A 2YEZA 4K5PA 1SNRA 2GIYA 2VLLA 3RVWD 3E38A 3GSNH 4MAUL 4I85A 3WO3B 5BZXA 3LV3A 3L5XH 3KL0A 2ZCLL 3FW6A 3WKQA 1YECH 1QRNA 2ZOKA 1ZD6A 2OTPA 2FYYA 4AGOA 2AJSH 4GW5A 1KFIA 4M62L 4P23B 1U8CB 1I9IL 3SIKA 3A6OA 1IGJB 4HQQH 4DGVL 4XCCL 3DX8B 5IQMA 1O75A 1LTXA 2FEDD 3OMIB 4YSQA 2V5MA 3G5ZB 5A40E 2YAEA 5AYUL 3FQTB 1BMWA 3WBDA 5BOJA 3RDTA 5IG7A 1RZFL 4V11A 5IGXH 2Y07L 3IFPA 5TQ0L 1FRGL 4L3CB 1QN9A 4EVNA 2XKNA 4JO2L 1UWXK 1R3LB 2BZCA 2BVQA 4FP8H 3UCQA 3RGVC 3L17A 5TE4H 4Y89A 4YE4L 2JB6B 1UB5A 3E8UL 4UM9A 2OSXA 3RBGA 2FHFA 5KSUA 4TLUA 2NCMA 1HIMH 4FEMA 3CAFA 4LLAA 2EEFA 1IEBB 4YHNA 1AG0A 5CD5C 5JXAL 4LHUB 1S7RB 3G6AA 2VDQL 4YLQT 1Y1DA 1BXVA 2PTTB 2COQA 1H8NA 4KJPD 5I71B 5IB3B 2IBBA 4U3SB 4G5ZL 1M7DA 1IFHL 3W37A 1HWHB 3DIVA 2VDLL 1XBDA 3GC3A 1I7UA 1MQKH 1N3NA 1A1OB 1CWVA 1HCFX 3FO9B 4HPYH 2QFPA 5AKSA 1T20A 4UUJB 3BZ4B 5AOKA 3MCKB 1UURA 3IXTB 3ULVH 3RY6A 4U0RC 3DPBB 3NGBC 5C0NC 4FLQA 5J6GA 3ARGC 5GRJL 1BQHA 1VCAA 3JVFC 1MFMA 3TNMB 5L2JB 4I8OA 5JORA 1JYVA 1BD2B 4JFEB 3P11H 1FE8L 4J39A 1Y07A 4U1HB 1Q9WA 5JNYA 2ZOWA 4X6CB 2I5WA 1IM9D 5FKAB 2XFXA 3MCG1 1GR7A 2EDHA 4I5BB 4PBWD 4R7DB 4XOEA 1GGBL 3NCXA 5EZIH 4OF0A 2VQ1B 5IB1B 2AXWA 1AAJA 2MJ7A 4HIEB 2ICWA 5CBEA 3Q5YA 2EDFA 5E1IA 1CFVL 4LKXA 5DK0B 1RZJH 4NKDA 4ALAC 1RK0A 3BGMA 3FRPB 3ILQC 3HRZC 1SDYA 4AEIL 4BCYA 4NNYA 5EB9A 4FD0A 1KDIA 4PJ7A 2P5WB 2EDQA 4BWTA 5JA9A 4XH2A 3HPJB 4FXGA 5F7WC 2Z1PA 3B3IA 3L6FB 1Y18A 4JQXC 5C09B 2C3WA 1CB4A 5D7HA 3T9WA 4KVNH 3TFKD 2W65A 1R5IB 3QQXA 1YMHA 3W56A 5JQ6H 4OV5B 3CIAA 5ID1B 1MJUL 4OFYA 1SOSA 4D7QA 3A6BL 1P1ZA 2WWKO 3EH3B 2F53E 4NZRL 5ANMB 4MWFB 3OSEA 1G7IA 2NZ1A 1J88A 2BY2A 3ZMNA 3LEXB 3S48A 1CLCA 5FX3A 2ARWA 5I28A 1IAIM 1UB6B 2E46A 2X6BA 5LXGL 5EBGA 4LSVH 3QUYB 4N5UA 1I9RL 3V6OA 1N5AA 4XCEA 2ZYRA 1SGKA 3N91A 2F18A 4GSRA 2H9GB 2R1WA 3H53A 3VGBA 2B2XL 4NNPL 3ZTJG 1M7IB 1ORSA 2ZKYA 2EIEA 1MCHA 3CFKB 5I5MA 1Y6KR 3FQUB 3BP4A 4WKZB 2BM3A 3BSHA 4RISL 3C5ZC 3P4NA 4M48H 1UVQB 1VZHA 2XTJE 2DQEH 3LKRB 3ARVA 3V6OE 1UD8A 3RIFF 1OGAB 3EFOA 4P5TA 4HWEH 5BUGA 4RA0C 3S37L 4ELKB 4XMKL 1I9JL 2FSEB 4BRJA 1PJWA 3E8VA 1TZOA 3LOWA 3ZQWA 1GJWA 3QCVL 4U3XA 2XVBA 3EH5B 2D7TH 5F1SA 5T8IA 4YNYB 4Z76B 5E2WH 3CPLA 3P9MB 3OKYA 2WZPA 1ZDQA 4HJ1A 3Q5OA 3KPRA 3DTDA 1GGCL 4Q9CA 1LE5A 3QRGL 3PHOB 3W0WB 3BUYB 4M56A 3KHOA 5HYIA 3RURA 3RLSA 1NCCL 5JOEA 2V2TA 2ED9A 4YQXL 2A9ML 2IGTA 3GBML 2VIRA 4W6XB 2RD0A 3LRGA 4O2EA 4AGMA 3PWNA 4N20A 1GKOA 2HPOA 2XXMB 1BLIA 3Q48A 1F13A 1Z3GH 1EFXA 2PP7A 3AADB 3KPRE 5ESAA 3ZPDA 4ZFGH 2WYIA 5ACZA 1AKJD 5FYJE 1YEKH 5DWPA 5JQHC 3QW9A 4PRAA 3LH8A 1J87A 3ZRFC 4OGQC 1JGLH 4CVZA 1R46A 4W9ZA 4JVUA 5FFOA 1NKRA 5FM8A 3UERA 1OW0A 4AYFA 4BZ1A 2CIIB 1FSKB 2P8MB 2NY6D 2DTML 3EOAB 1D9KB 4J4PC 5IVXB 3TM6A 4L18A 4BZ1L 5EUOA 4H13C 2J8UB 1LGVA 1UWGL 3BX7C 3KL3A 3MNZB 4JO4H 3ZHDA 4A6YA 3LNGA 4F7EB 4JRLA 2AJ3A 3O0RL 3O2DL 4ETYA 1ZV9A 4A6YL 4YO0B 2YARA 5AZ2H 2VB5A 5BRZA 4GG6B 4ONFH 2V3DA 3S8FB 3ARZA 5MEOB 1MFEH 1ZV2A 4YBQD 4U1NA 4LMQI 1IM3D 2QPFA 3CGTA 4IMLA 5CO1A 5AD0B 1KENL 3RIKA 2WCSA 5J1AB 4N0FB 3B6SB 1T04A 3L1FA 4G2AA 4TVPH 4JB9H 4QRPE 5ALCL 5EUOE 2QQNL 4U1GC 5E6UB 1UM6L 3I6LD 1D5XA 2VXSH 4QLWA 3DX3A 3GLZA 3JUYA 3HNVL 4NNXA 5BRZE 3HIZA 4M1GL 3R0MA 3SDDC 5C0FA 2RQEA 2ADFH 4OD3L 1F90L 4KO5A 3EGSB 3VX0A 3C8KB 1J1OH 1F6LL 1SVZA 2X9ZA 1DBKL 3IGLA 1NIDA 4KI5F 3IXAA 3VXNB 3I6GB 4PP1D 1KGJA 2Y22A 4DNLA 1UWEH 2IDSA 3RGVA 4BQ8A 2FB4H 3MRMA 1FNSL 1KB9J 3VG0L 1P4LA 1YEDB 4NJ9L 4YDMA 5F71A 1AS6A 1WBZA 5DQ9B 2BJMH 4PM1A 1INEH 4C55A 3ARBB 2XXFA 2BVTA 1G7HA 2EKSB 2R4RH 5LNGA 1SOQA 2WSKA 3H9SB 2ZYIA 4LCYB 1XZ0B 2H3XC 2IPKA 2VSDA 1CZ8L 3B2VL 5SWSB 1CD9B 1N0LB 2J4WH 4F9PA 1L9RA 1JP5A 3QFDA 4QGYA 1HILA 1WV7T 4Z7UF 4X0KA 2PXYC 5DUPL 3HHMA 5I6LA 1F4YH 5IW6A 5E1QA 2Y7QA 3ES6B 5E6IC 3ECVA 4G6AC 1HZHL 3HZVA 3EYFB 2ZP9A 3WE6B 4E9YA 5IOKA 3A23A 2DAVA 2X1XR 2IF7A 4W9LC 4Y7OC 2NOZA 1AZRA 1O9VA 1QEWA 4GMSH 2LU4A 5DD3H 1KT2A 4AITA 1YNTB 2CJSA 1RUAH 2UY6A 5AFAA 2WOYA 1JNJA 5MHSE 1ODAA 3KPOB 5EN2B 3CH8A 2YA3A 4YSRA 4Z7WA 4BFNA 4P2OB 3BKYL 3QUZC 1OWWA 1MPAH 2ZCHH 3VFUB 5ESVA 3BKCL 1H9DA 3RZWA 3O8XB 1YQVH 5AOJA 3QR1A 4G8IA 1NDGA 4UQ9A 4EI5D 1TMQA 1ZHLA 3WXWL 5I1JH 4BSWB 3BD5A 4G9DA 4TLKA 3UAFA 1CLOH 1MWAB 2DMGA 1FO0H 2W60B 5EU5A 3VSQA 4LGPB 1IT9H 3VI4F 1AISA 4GQQA 1NANH 2JJSA 3TCXA 3V0WL 4IRSB 2XN1A 4ALAL 1U33A 4HJGB 2MHAA 3U1SH 3Q8FA 4JKKA 3FQNB 2ZX7A 2DIJA 3FL7A 1HSAB 3JYBA 4PJIE 4Y1AA 2A9BA 2ZP8A 4UTCA 2C9XA 2AITA 4M8RA 4OCRH 2MQ0A 4K7FB 2EYTA 2DLIA 2OK0H 3V6FB 3F7PC 4J8RA 4Z77B 5CIPA 3KXFD 5I1DA 2MEJB 1NEZB 1ZTXH 4KRMB 5I1KH 1MLBB 4KQ3H 1PNDA 3SKNB 2RMNA 1HH9A 3L54A 3NFSL 4QJ5B 2GSMB 4MGXA 4W6WB 3ZDZB 1J11A 1I3GL 4Y1AE 3U9UB 3HE7A 1CUOA 2B77A 1G9MH 4JMXA 3V0VB 5BXFA 1HXYB 4KY1L 4NO3A 1M71A 4JFYB 2PETA 1A14H 1G9NC 3GM8A 4QTHB 1FYTE 3T4AA 4K7PY 2ZXDA 4G8EA 5DK2B 2DQFA 1IB5A 1KCVL 4XN2A 4A1RA 3L3IB 4AQ8C 1X4YA 4YGVA 5JW4M 3QEUA 5TJWK 2H1PH 4IS6A 1QSZA 3NJFA 5BO0D 5BQ7B 4LCWA 4OIIL 3UZVA 1CBJA 3KGRA 4GSXA 1MRFL 2Q2EB 3C5ZA 2R23A 1UKSA 2P48B 4QOKA 3WS6C 1UQSA 2G4GA 4POZD 1L3NA 1ZXKA 3SBPA 5F72S 5FKPA 5IJCC 3GT6A 4GNKB 1Q0XH 5L88L 1TFPA 4ILDA 4KDTC 4PTUA 1VFAB 1VOKA 4YS4A 1RSYA 2WWKT 4CN1A 1FNGA 3DUUA 4PRBA 4OZIA 4U1MA 1H8SA 3ELAT 1XAUA 4JLRB 1H6FA 1ZT4A 3BDBA 3OPUA 1IUZA 4LIQH 5C0IB 1TJGH 3GMRB 4WW2F 4XVTH 3BPNB 2APFA 4MZ3A 3ZGHA 4XPBL 8PAZA 1D2PA 3QULA 1FWXA 3TX4A 1WUZA 2D31A 4X9FA 5L8KB 2NY1D 2ROYA 4MD4B 4L5FL 4GKLA 3UPRB 1THAA 4Q6YA 5MENA 2NY4D 5JDJA 3UROR 2HUEA 3QHZL 3VWKB 4DGIH 3TBSB 4OZIE 2F19H 3NJVA 3BQUB 4UQDA 4WKXA 1Q9KA 3WSQH 5JPNC 2EQDA 2CDFA 4N1EA 4Y5VC 2ADJA 4LSTL 2X7LB 2XZQH 1YEEH 4WGKA 4D3CH 2X4TA 1LNUA 5EORH 5T33H 3RU8H 3PE9A 3L7EB 4N4YB 4WY7L 1DJXA 4MKMA 4XBGA 2H32A 5DK3A 1FF5A 5FW6A 4UOJA 2O1AA 5HDQL 4P07A 4MZRA 3WY4A 4GO8A 4J4PA 4XMZA 5FOBB 1I7RA 3BE1H 3QISA 2PPCA 4KBPA 2ZPKH 5DQDH 4G3YH 5DUMH 2X1OA 4ZRGA 5IEHA 1MCPH 1UD3A 3MXVH 2KZBA 2OSLA 4OCXL 1QBMH 1SXSA 2JKTM 3EFFA 2QGEA 2NW3A 1GVIA 4F58L 4F92B 5E8PB 1R33A 2ZWSA 5HI4D 5FDYA 2YAHA 3HS0A 4MMXB 4WUKH 4HIIB 3V55A 1A6WL 1NC2A 3MA9H 3LD8B 2JELH 2PCFA 4OLZH 2YKKA 3DKHA 3AG1B 4WUUA 2X70B 2AW2A 1NBZB 1KJMA 4DN4L 3NA5A 4J28A 4G6JH 3X1GA 4PJAE 2HZMA 5T1LD 4HKZB 4ZXBB 2X2JA 1RHFA 3SDDA 2DQDH 3MOBL 3ML9A 3RX9A 3NFNB 3UG4A 2JCCE 3G5VB 1YDPB 4BSVB 2KH2B 3PABA 3TEYA 2CLRA 1JVKA 1NL0L 5KSAA 3MNVA 1OAYL 1SBSH 2KT6A 4WUUE 4F91B 1DBBH 1MIEL 3A6CL 4JDTH 2EXTA 1O5DT 1WWCA 3F7VB 32C2B 4YPGB 3D50A 5F6IB 1SLXA 3WKPA 3QYMA 5M94B 2Y7SA 3DIFA 3CZSA 1B6DA 2HZHA 2FBJH 2HMIC 5AOIA 2J1XA 4OFQA 3MZTA 2P43B 2XXCB 5DU7A 3VJ6B 2IDTA 1XTMA 1VEMA 4HCGA 2Y7LA 2DWXA 4W9JC 3PXJA 3RA7H 2VLJB 5L2KA 4PV1C 5CP3H 1QEXA 3LXBA 2XCMC 4JPSA 3F12B 4N25A 4LP5A 3UBXB 4X4YB 2O5YH 4AOFA 1U58B 1U8LA 5L6YL 3MCYA 1JGEB 4YHOL 1CR9H 3HG1B 3LB6C 4UV7H 3D25A 1PMYA 2UZYA 2WB1A 3IE4A 2XG4A 2R39A 2DKCA 4FQLL 4XGZA 5E6IA 2GEQA 4ANUA 1WS7A 1TZAA 4PV8A 2E6JA 3MRLB 4N2IA 1P7QB 5L2KE 3LXCA 4Z7VA 5FDWA 5CFHA 3FQRB 1ACXA 43C9A 4IGBD 2VZ3A 2BZ7A 5D71L 1JFIC 2SEBA 3J7HA 2QMKA 2V8LA 4TQEL 1UZGA 3SD2A 3T2QA 3F7LA 2MPAH 5JLZA 3GUTA 2EABA 4Y1TA 1XAKA 4QLRA 2E4FA 5IVZA 4YDIH 2OYMA 5HPOA 1OP9A 3K4ZA 3QORA 3ZR5A 1RZKH 3JV6B 3QK0A 3TESA 1GSMA 4DP9X 2GYSA 2I9LB 3H9HB 1ZHKB 2VOTA 1R3HA 5JXEC 3RDTD 3LQMA 1FBIH 1DL7L 1NIBA 2VKXA 4I0PC 1E2VA 4NQEE 3ZY7A 4AENA 3OXRA 2FGZA 4BWUA 5T3XL 4APQB 1ILSA 3VXRE 2NY3C 2VW6A 4NQUA 4JJOA 3M8OL 4Y8AA 4DIXA 4XBPB 4YDVA 4NBYB 5H35B 4DKFL 4UM9D 1DZBA 1TTAA 4HA1A 4ZFQA 3CSYA 4F37K 3K6IA 4M43L 4R26H 2DQ6A 2XHIA 1J5OL 3UC2A 4GI9A 1IV8A 3NZSA 4R5VA 3D7QA 1ZHBB 4XI5C 4LSQL 4UBDC 1JD7A 4GRMA 5FFGA 1TUPA 1U36A 4FS0A 4ZMLA 7PAZA 3VG9B 5E5MA 2YD1A 1UENA 1CFNB 5CM1A 2R59A 4L48A 1F18A 1MWOA 4N2OA 5I1IL 4JGUA 5ID0B 2QFRA 1S9VA 3BMWA 1QSVA 2VMFA 1VACB 4B9ZA 3HPLB 4K5NA 1XF3B 1ES0A 2HTLD 2QDVA 2YGPA 2HTKD 3GHEL 4MHHI 4AQ8A 1LO5A 3LKNA 4K2UL 1W8OA 3BFQG 2J25A 2GJZA 3II3A 4GSDL 3HMXH 4ODVH 4TNWF 1BAFL 1UCBL 3FFDB 5HI3D 3GSXA 2X28A 4Z7QF 3WS6A 1SMAA 2JFCA 1NCDL 2YPVL 5LGJA 4K7PH 1JZEA 1U8JA 4WNQA 3MXWL 4OKVB 4JAMB 4FNTA 4KDTA 3BEWB 5DLMH 3IN0A 4FG0A 4BQ9A 5DUBB 5DJDB 3FQ2A 3JV5A 3X2QB 4TPSA 1QBLH 1ZWIB 4NPKA 3S3DB 2QKIB 5FWRA 3FOMB 3K1DA 3QIBB 4PRIB 43CAA 2R0WL 3GMPB 1MI5A 1U4FA 2HVJB 2Q5BA 3O3EA 5LBVA 5C0RH 2O6FA 4I77H 4PI2A 5IHLB 4JGMA 3GXUB 1WZ1L 2NY2B 1DSWA 1E27B 4XP1L 4JZNA 1HHGA 2Z7UA 5D2NA 3IJHA 3TYGH 1F3RB 1AXSB 2ZXBA 5IMLB 1JGUL 2ZAHA 3B56A 5AW5B 5D1XA 3GRWH 1K8IB 5D96C 4AZ8B 5AEAA 3QI9A 1JPGA 1MI5E 4EDXB 4Y5VA 3B9VA 1QLFA 3HJEA 5CZXD 4CADA 1NCWL 4OFYD 4U4IA 5HGAA 3ET9F 5FUZL 3CSTA 1EEZA 3EBIA 1SN0A 4JO1L 1QZ1A 2ZAIA 4MLSA 5EZOL 1K2DB 2J57A 3VE0B 2P5EB 1CL7I 1DVUA 15C8H 1IE4A 4DOHE 2D8KA 1KCRL 4RFEB 3U48A 5ICYB 4G8GB 1NFDF 2KMWA 2WLNA 1KC5L 4GAFB 2ARJB 3LVTA 1U91A 2NXYD 3A4FA 1KYUA 4YAQB 1AHMA 5L9DL 1HXKA 1PFOA 2A6DB 4H1LG 4Q56A 1T4WA 3F65A 5ICUA 4NT6B 5PCYA 1A9VA 1R3JB 2MWCA 2UV3A 3QIUC 3NEOA 2IMMA 1U8IB 2DRUA 4J3OC 1TEGA 2OX5A 1KPVB 2IAMA 5DZPA 3ZBMA 3GXFA 4MDRA 1AZBA 2X0VA 2E8ZA 3DYPA 5CJ8A 3S3CB 4I1PA 2Q0ZX 4M8VA 1OAXL 4I7ZC 1OALA 4LESA 3Q7JA 4P5TD 1QLEB 3UYPA 5D93C 1ACYH 4QO1A 5EPMA 5LO7A 5FFLA 1PLGH 4HH9B 1BQRA 3V6ZB 2EEDA 4TULH 5ACMA 5E5RB 5BVPL 1V5SA 1B2WH 2OULB 1JSYA 2R15A 2CHNA 2WZPD 4P46A 3UTSA 4AYID 1GHFH 4QYAA 1LMKA 3KPRD 3WFDL 1PQZB 3OH6A 2AEQL 3FUDA 1CCZA 1MRCL 4PWJA 1IAIL 1NGQL 2C9VA 3OHXA 5J9PA 1BZ9A 3LKPA 3QPQC 5IK3A 1A6ZA 3L3OB 3L1GA 1TT6A 4IMKC 1DQML 3PV6B 2HRLA 4K3EH 1EJOL 4UIMA 4XTRD 3KWTA 4XVSH 4RGMC 2APVA 2K9FB 1DQJB 2AAAA 3L9EA 4PJEA 4EDWH 3UTSE 5FOJA 3VFGL 5I8KH 3ILPA 1EFXD 3BOVA 3BWUF 4PVLA 4MA7L 2NZ9D 3LMJL 4NSKB 1JIBA 4KTDL 1MSPA 3H4FA 3EOTL 1LK3H 4UQCA 4Q9RH 3TBTA 3PWLA 4KX7A 4FA7B 3OAYK 2QGBA 5DJ0A 2UVEA 2GTZA 4EJYA 2WN3A 2WBKA 4WAFA 4FL4B 4N87A 1GS7A 4PJEE 3UJJH 4WU7B 1TTUA 1PVHA 3FJTA 1H9VA 1XGRA 1K4CB 3R0NA 1B0WA 1XMWA 2PYEB 4CAGA 3GKZA 3QPKA 3CVIL 3QWOA 1VFBA 3JT0A 4RNRA 2Y2TA 5BRZD 3VFRA 4CRPA 3VFWB 3REVA 3O0LA 1TZGL 4UU9B 1LHZA 5JUEL 2C7FA 4GINA 3ZTEA 3RPIA 1JNLL 3MRIA 5D7KE 4YDKL 4XZUB 1QUNA 3OKNA 3WAKA 2Q7NA 1EZLA 3D2TA 4JRXA 4UDTB 5TDNB 3SY6A 4FFVD 1A0QL 1IAOB 5DUJA 4Z7NF 1KIPB 1TZIA 4UF7C 1ZJAA 2CUHA 4M5YL 2CHZA 3CNKA 3LS5L 5JXEA 4MYWB 4RIRB 5KYXB 1O6TA 1LJMA 3O6LL 3NIFB 4I0PA 5J06A 5T1JA 2I9TB 3TJEL 1URZA 5B3JF 3EO0A 1INQA 4F7KA 4AVJA 2GAZB 3FAWA 4JRXE 2CUIA 2F9BT 5A2BA 4MCNA 1A1NB 2XV0A 4H1LA 3RGVD 1XF2B 4Y16A 3IDXH 2LE9A 4JHWH 3CFCL 4J3OG 4JFDA 4FDWA 2HFEA 4ZO7A 4YXHH 4Q14A 1PZ5B 3KNBA 1X5IA 1F42A 5SV3A 4Z5RA 2MFNA 4N2HA 1IAMA 4K5MA 3DV4B 5CD5D 3LIZH 4NWTH 5HYJE 2QVTA 1NCUA 3CQPA 3VXTB 1MEXH 4HF5H 3HZMA 1JN6A 1MAMH 3SDAB 1YEIH 1T0NB 2NDFA 2OTUA 3LZQA 2DDQL 2WLMA 4JFDE 4XXCC 3PHQB 3CX2A 2GK2A 4L1SA 4I1NB 4N24A 5C0GB 2OI9B 2GY5A 1R6VA 4KX8A 5F1NA 3N1PC 5DS8B 3QQ4A 2FR4A 4L2LA 1M3JA 2CDEA 5I1HL 5CGYD 3VXMA 5C0ND 5LNDA 5C2BL 3VXUA 5E1AA 1R0AL 3GBNH 3H0TA 4NKMB 4HU2A 3KH3A 1E4WH 3MLRL 2Y72A 5I1CH 3I2CH 1WTGT 2QPUA 1SZNA 4LP8A 2GUYA 3LHAA 4WJ5A 4H8WC 2XVLA 3S8WA 2PWFA 3H3PL 1DUYB 2VGLM 4NPJA 4GKNA 5FUOH 5TE6L 4RAUB 3VXUE 4R0LC 5FLVA 2WD0A 1CIDA 5L7XL 1SOXA 1AGFA 3HEIB 4MAUH 5F3HB 4MZIA 1F58L 4JPVL 2IANB 3S88L 2LLGA 4XODA 2BIPA 1FGVH 4OT1H 5HDWA 4A7GA 3EDEA 4ABQA 3KBPA 5EG6C 3SKJL 2Z8UA 1L9PA 2PW2A 3DX7A 4LOUC 4Y1AD 3AB0C 1LP9A 2F54A 5BMFL 4C4UA 1JZ6A 4DVRH 3CZEA 4ZTPL 4PRDA 1J5IA 3VD3A 1FYTD 4M6NL 2DQUH 5LGYA 4HJJL 4NZJA 1I9IH 2J20A 3GMNB 4L4VE 3M1CA 1H3PH 4DGVH 4XCCH 5G55A 2AAVA 2NY0D 5CF3A 1TVBB 1UYWH 3PREA 1P2CA 3QH3B 1OCRB 2V9QA 3W9EA 3DJSA 4TPRL 2Z8WC 5E4EC 1KLGA 3QJXA 4U6HA 5AYUH 4ZDHB 5JO5B 2F54E 4Z7UB 2C3XA 4MAYA 5C0BB 1MKFA 2Y07H 1MCDA 1VGKA 5FGCB 1JWSA 2FJHA 2B5IB 3GRGA 3D30A 4LNRB 3ZE0E 3MNMA 4POUB 4Q9QH 4C56E 5GSRB 2DKSA 4BK5C 2DH3A 2ZKXA 5DTFA 5HJ3B 3TJHD 1G9HA 3C12A 4YE4H 3O3AA 5CINL 4LOVA 2D0HA 4WI8A 5EU4B 1YMMA 1ET8A 1B0RA 3E8UH 4LCWD 4X4XB 3TWCL 4CU8A 5KVEL 1FCCA 1B4RA 2FX7L 5LUMA 3C5ZD 2AANA 1WIOA 4F8LA 4Z1PA 4QOKD 4HS8L 5CKGA 2J7LA 3KR3L 3KPQA 5AUMB 2VN7A 3MJ7B 3ZDYF 4NRXB 4F33B 2JK5B 1BGXH 2F68X 4XPHH 3T2OA 4BA8A 5KVEE 5KVFE 2VLKA 1UFGA 2VO8A 4WI4A 1BQ5A 1PD6A 4DSYA 1YMME 4AIZB 5I1AB 3OTTA 4G5ZH 3T04D 3VI3E 1IFHH 2GITB 2WKOA 4RH4A 3ZQXA 3C08L 3DUSA 1VADB 2EP6A 4KNUA 4YL4A 5K39A 3O4LB 5HYSB 5I19L 4ANKA 4Z95L 5KG9A 2QHRL 3VFOB 2NNRA 1GH7A 1BIIB 1HQ4A 5JPMB 5HBBA 3P73A 1FZMB 4NLAA 4IMKA 3O41A 4AXWA 4FA6A 1HAUA 4LXFA 4AG4H 2EEAA 3QJHA 5H94B 4GXUM 5GRJH 4PBVC 2PPAA 5IWLC 1MHHB 4ELMF 4WNJA 3QUKB 12E8L 1FE8H 4N2EA 2AABH 4R3SB 3K2UL 2ICEC 4RQQA 1I1YB 2X4PB 2EADA 4Z3EA 3AT8A 1JE6A 2H2PC 4J3UA 4MDJB 3BZEA 5I16A 4PAZA 1FUNA 4GO6B 4ZUWB 1I4FB 5DSCA 5AZEH 1Z9LA 2DBLH 1SYVB 5I30L 4B9CA 1GMIA 2P80A 3MUJA 4J4PD 3EO1A 2RACA 3M17B 2X6VA 2DLGA 1HKLL 2IGFH 3U79A 5D2LF 1MIML 4U1SA 1BOYA 4ZPTA 3UGEA 2IDCA 4M1CC 4PG9B 1PIGA 4B3VA 2P5PA 4WK4B 3T0EB 1AG6A 2VDPL 4TUJA 2MOGA 3FCTB 4N90E 3SO3B 3T0XA 3HN8A 2AQPA 3UTZA 1D5RA 4O02B 2MKLC 1NC2D 1MCNA 1GRWA 2CLZA 4O51A 5C71A 3DMMA 4XMLH 3Q0HA 2K6YA 2YPKA 5DQJA 2XIBA 3DI2B 4WUUD 1MJUH 3A6BH 4PHZA 3UGXA 4A7QA 4QHUA 1KB3A 3L3JB 4NZRH 3CUPB 5LGHH 4ODUB 4JR9L 3LKOA 1JD9A 1T21A 2G4EA 1RP8A 4PJXE 2N3JA 3WOVA 4GAGL 2A4EA 4WFEE 4KKCC 3SDDD 2VXTL 3X14A 1A6TA 4HIHA 2WUBL 3NJNA 1NFKA 3ZOAA 5DI8B 2YQBA 2I07B 2VLRB 2R2BB 4GB9A 2DM7A 4PGDB 5I76B 4KDVA 4ZFOB 4WW2B 2HX8A 2ITCA 1OD9A 4YZFF 5KSAD 5TK2A 4OLVL 4MBOA 2CRIA 2H4LX 2OP4H 1WISA 1DVYA 3C5SB 5L8LB 4G42A 4UB0H 2EUWA 3KYOA 4D9QD 5I8EB 4DQOL 1J1XL 1N70A 4RISH 1EVTC 4MB1A 4UAHA 1C9BB 4ODXB 1Q90A 4QXVA 3B9KC 4RGNC 2Y5TA 5EOQH 3UP1A 4PJ8C 4EZMA 3AY2A 2G2RB 2R9HD 1F4HA 5AN4A 4TSAH 3S37H 5EFIA 3QO0B 5GGQH 4XMKH 3RFRA 5L2KD 1NPJA 1ZT1A 2WVTA 2Q7YA 3QCVH 5IW1A 1AOZA 2HUHA 1MN4A 4FCAA 4WSKA 4XXCA 2PXYD 1UACH 2VQTA 4NHUA 1OV8A 4ODSH 2BIOA 2R1XB 3QRGH 5E6ID 2VZTA 5IUCA 4G6AD 1T0MA 3GS0A 1U8HA 4ZSOE 2BWQA 5FYJH 5D7EA 2A9MH 1EFQA 3I9IA 3IAGC 2C5DC 5ITFA 5JMVD 4MNQB 1MH5B 4XNUL 4AYMC 2X4QA 3G6DL 2CKNA 5CLZA 3S96B 4KZEL 1GGUA 2DTSA 3BP7A 3CVSA 2ZAGA 1KLUB 2JIXB 1TQCB 3S7GA 3UADA 3AAZB 1YNKL 2I69A 2VUOA 1XGPA 2V17L 2UZXA 3KE0A 4KKPA 5FO9A 2DKDA 4HH8A 1J48A 1NZRA 2GSIB 3N3EA 4A55A 4U49A 2XFGB 4OCNC 4BUGA 1RHHA 3US9A 2DTMH 4YXKL 5IBUG 3NJJA 2DQIL 4DF9A 4PJHA 4ECNA 3GSVA 3LNDA 2WQWA 3OMAB 5T3XD 2QKSA 3O2DH 4LL1A 4O2CA 3O9WC 3T08A 5HJGA 4BZ2A 1FV1A 1T22B 2XU9A 3EG9A 2AJUL 4ZOEA 1SY6L 2Q3AA 4BZ2L 1NGZA 2VC2L 4OGYL 1ND0A 2QQLH 4JFXA 1E65A 2YPLA 4AW4A 5BW7C 4G43B 5BRQA 1JF1A 5ENWB 3TO4C 4P2RE 5IJVB 2QQNH 4K15A 2A73A 2XN9A 2NLJA 2AXFA 2NTFB 4GUCA 4CFFA 1UM6H 3SPGA 2IO5A 4PGCB 5F7DB 3B1UA 3L3GA 2MQCA 3ZK0A 1K5NB 2AXGB 4YC2B 4HBCH 2NUPB 1F90H 1WJ3A 4LCIL 3O6KH 5IMOA 1JFQL 4LL4A 1JF6A 4PJ7F 3CZNA 3N2JA 1G94A 3MRCA 1P53A 2F74B 3RZCC 4B7LA 1NBYA 1XBRA 5EHFA 4BK5A 4OF7A 1R24A 3GFUA 2E27L 2HKFH 1WICA 4XWOC 2C1OA 3LH9A 3ULSB 1VIWA 3LY6A 1XEDA 3DA0A 4W70A 3VG0H 1VSCA 3S35X 3ZTJH 4PVBA 1YTFA 2WLKA 4NJ9H 3TIDA 1KG0B 3BC9A 2YRBA 4B9GA 3AM8C 3BIKA 5IW3A 1JXGA 3NJKA 1GCYA 4L8SA 1FZKA 4PB9L 1BP3B 1IC5L 3DJ9A 1K4DB 4RWHA 5KWYC 3MYJA 3R06A 4MD5A 1KJ3L 3NDZE 4NQSB 5GZNA 4C4KO 1DJHA 1SN2A 3NMEA 3V9EA 5GXBB 4U4BA 4ZJ9A 4NC1C 2IWFA 4P5KB 3HC0A 1RK1B 3K2KA 5FS5A 3HNTH 3ROOA 5KYWA 1MI5D 2EACA 2WLLA 5E4IA 2OV0A 4GKZB 4MXVE 4K3DL 1QTPA 4HWZB 2JKSA 4JUTA 5BZWA 4HGKC 1EHKB 4IDJL 1U30A 1EBPA 3L3DA 2X4RA 1HU0A 4Q6IA 3H3KA 5D1XD 4P9ML 3MRQA 1IM9B 1TZHA 1AO7B 1MY5A 3BAWA 2K6WA 3QI9D 3BKCH 1KB5B 1YUHA 3SKMA 4D7PA 3VFPA 2JVUA 3QNXB 2UZIL 2CJTA 4L9LC 5GSVB 1WZAA 4HULB 4K3HA 2TSAA 2LAGB 3BCFA 5GJTH 2OYPA 3MJ9A 5FHBL 2MNJB 3MJ9L 4ODWA 1S7VB 3ESVF 4ALAH 1PIFA 1JUFB 3O45B 2C4FU 4QRTA 5HHMD 2FATL 1KN2L 5KSBA 4ZUVB 2R2CA 3PWVA 3TDHA 3LEVL 1A6AB 4M7LT 2Q7AA 3B9EA 3QEQE 4E41A 4W4OC 1PTZA 3ME0B 4F8QA 5FO8B 3T1WA 4UOW0 4QRQA 3HS8A 3PWJA 2NY7H 4Z7QB 2DQTL 2H0FA 5HHNA 3HG3A 5FGBC 4GFTB 1JJUA 3VQLA 1CDYA 3QAZB 4M8QA 4GIPD 4NZFA 1FG9C 2W1NA 1DSFL 4YEEA 1RIHL 2FJFB 2VJ0A 3QRLA 2HRPL 4XN4A 2XNAA 3CHXA 3KCPB 5EUOF 2AXHA 2XTSA 2Z0FA 1L0PA 4S11A 4XO8A 1JZGA 3T6XA 3UTSD 4P46D 4NUPA 4ZFFA 1NGWA 3MLWH 2FLBT 5C7XL 3CXDL 1CXFA 1EXUA 3DSNA 3LKSA 3FQWA 3VD4A 1IO4C 1DLHA 1WHPA 4OIIH 2ZXGA 1BM3H 4AUJA 3HE6C 2BNRB 4CA4A 1SMOA 1OTUC 4I48B 3IKCA 4DEPB 3SZKC 4NQDA 4P99A 4Y4KB 1RZIB 5EZLA 1QFOA 2K8QA 4QRSA 5KUKA 5L88H 4M7LL 3APFA 3HI5L 4EAIA 3NCFB 3E1ZA 3CFIC 3KWWB 1W0WB 4LU5H 4W9KC 3MR9A 4IBWA 2AMGA 3QUXC 4N6RB 3CFDA 4RGNE 1XHHA 2Q87A 5KOMC 1SEBA 3VXSE 2LVCA 1JK8B 4NQDE 2D4DA 3THML 1NFDB 5E03A 3FBQA 4XPBH 2VDOB 1ETZA 1RPUA 5KN5B 2OMBA 2JKRM 1WITA 4ZMAT 4AKPA 2H0EA 1RU9L 1A66A 1TBAB 2XY1A 3WLBA 2XG5A 4DZBA 2IG2H 2K3TA 3OBAA 1BV8A 3PGCB 4OVVA 4HCRH 4PW3A 2ZOUA 2VCOA 1TQUA 1IZJA 5B38G 2ARJQ 1EX0A 2CUMA 1RUMH 1OTTC 1NLDH 4DP4X 4LSTH 3WNNA 4AJVA 1P4BL 3VB9A 1S7XB 1UOVA 2W94A 4JRXD 4GRLC 1FVDB 3VCLB 1H5BB 4WY7H 1DJZA 5IF0B 5IYBP 5C07E 4M7KH 2FVNA 5JXED 3IJ7A 3MFFB 4GQPH 2GBAA 5JIIA 4J2QA 3FO2B 2VDNL 4QF1B 4I0PD 2P47B 2CJUL 3BP6B 3IMUA 1PD0A 4UDUA 3DXAA 1BZEA 3HFMH 3ESMA 1SJMA 3RTQC 3O9WA 4JFFE 1RFDH 4F58H 4AUUA 4AWJC 3KS0H 2NY3D 4NFCA 4Z7WF 4FG2A 4GG8A 4Y16D 4U1KB 5CD3A 2G9HA 3EHBC 4JFDD 4CBPA 1QSFE 5BW7A 1MJ8L 1JTPA 5GS2D 3PDDA 3SD5A 4OTXH 2R29A 2AEWA 1DFBL 2AXJA 3F3HA 4UBDD 2R29L 2BVPB 3FKUS 3NA4A 2DLTA 3ULAB 4Y4FB 3MV8A 1PZ3A 3MGTA 1EK3A 1G87A 1A7NH 4G80A 3K5SA 1VPOL 4KVCH 1C4GA 3QFJA 5SWZA 1GYAA 1IGYB 1INDL 4AK2A 3WFEL 5KBLA 1OAYH 4WCYH 5IFJB 2XWJB 1BZOA 4F15C 1AD0B 1G4MA 4A2HA 1K8DB 3FDWA 5AYTA 3HHSB 3EJUA 4QXTA 4YBHA 1AZCA 4AQEB 3TEWA 4M6ML 3VXMD 1IBDA 5EIIA 3VXUD 5H4YA 3AM8A 5SWZE 3RHWF 1WFOA 2WO2B 4R90L 4PJ5A 3QXAA 3CDGB 3BHBA 3HMWH 4WRLA 4LCVA 5FYKU 1ZT7A 5I1EL 2WQ8A 4E0RA 5D5MA 3TU6A 1Z32X 3OAUL 4YHOH 5L6YH 4QWWC 2GABA 1UD5A 1WFIA 2APTA 4YR6A 4AY0A 2NOIA 2NPLX 3ESNA 4S2SB 4EN2A 2ZUQB 3RAJL 1IE5A 5GRWA 2BVYA 2J44A 1I3RA 1TEYA 5FA3A 4ISVA 2J5LC 3DVGB 3FSOA 5IB4B 4X98B 4FXTA 3PQYE 1B2YA 1T1ZA 2F54D 4PJCA 5JQIB 3U0TA 5D5ME 5D7LA 4A04A 2MCPL 4NC1E 5A16B 5I17A 1P5UA 2WB7A 4TQEH 2W59A 3PGDB 4EXPX 5FYLE 5B38A 1J3MA 1T4KA 4IJ3B 3X17A 2Y7MA 1L9NA 4KFZC 1JZ4A 4K71B 1QYGL 4OZIF 2XBDA 1PPIA 3IDJA 1WBYA 4YSEA 1I1AC 4Q4IA 2XUWA 2AQQA 2IPTH 3INUH 4MAYD 4C4KT 4LSSL 2BNQE 3C8HA 4LCCC 5CXPA 5J6HB 3CCHB 1NAKL 2LLLA 1CGUA 2VLME 4PJFA 1XCWA 3I3EA 3LRSB 5AW2B 3BN9C 2GIMA 4WWKC 2QADC 3KXFB 2N0KA 3CDFA 1MFBL 3HR5A 3L3KA 4L29A 2X4SB 3QDMA 1V7NL 1YMMD 3N40P 4ZMWA 4P49A 4YSAA 4J3OD 4OBRA 4H4NA 2CKBH 4OI9A 4A2DA 2GC7C 2V5SA 4FN0A 1HOEA 3G04B 5E8NB 1DDTA 4PJGF 3ARPA 1EO5A 5GGVY 4LRNL 5DO2C 3TNNA 4LSQH 1UCTA 5L0QB 3OKMA 4CU6A 1IKOP 4PJFE 3MRKA 3JTSB 1I7TA 5AW0B 4TF4A 3P9LB 2VDMB 2FL5B 2VLKD 4N2LA 4ZUUA 4LEOA 2EC9U 3N0AA 4NM8H 3QDME 4O00A 5I1IH 1XF5A 3WNKA 4TNEA 4DULA 3UEZA 5HHPA 2YEVB 4M5ZL 1G9NH 2W0LA 3QIWC 1VFMA 3VFVA 2CJ3A 3MLUH 1M3HA 4MJ4A 2YBRB 3MREB 3QPQD 3VQ2C 2YC1B 1QFWL 1F5WA 4LLMB 2BRQA 4NN7B 4Y4HC 1AS8A 1RUPH 5FW7A 1CE1L 2HFGL 2HLAB 3UC0L 1N6QL 4XHJC 5FO7B 3DC0A 5I8OH 3ETBJ 3HKFA 2YPVH 3TPUB 4CN4A 3KYNA 2C4FT 3MXWH 4PR5B 1AY1L 3WIAA 3O11B 2O61A 3LN5A 4IU2A 1OIOA 1RJZA 4ODTH 3UFIA 4FFZA 3X1NA 3ZKMC 4ETQA 2R0WH 4FFZL 2LTQB 2RFXA 4MKTA 2HKAA 2P80D 4TNVF 5DGQA 4NYLB 4NM4L 5D7IA 2NY1B 4X8XA 4QT5A 4M93B 1WZ1H 1A9EA 4XP1H 2OL3A 1GZPB 3NUKA 2XKUA 2NTSP 2YWYA 3GZKA 4GBXB 1IJ9A 4WI9A 1JGUH 4BSJA 1BJ8A 3WNOA 1HVXA 3G6JA 1CBVH 4PUBL 1A4JB 2ED8A 3AREB 2FUTA 2YXWA 4J3WA 3IYLW 2P8LA 5E2TL 2ICWJ 2VM3A 3DMMD 3H7BB 3O3DB 4AX3A 3IJ8A 1ZLVK 3OHMB 1NCWH 1PLCA 2DQHH 3MLXL 3ZDYB 3W1ZA 1ZA3A 3RJDA 4ZNEA 2PR4L 5EZOH 4MDIA 4YDJB 1I7ZB 3HCVA 5LDUA 3P30L 5EPCA 4H25B 3Q6FA 4KHTH 3BZFA 1HTYA 1Z5LB 4L23A 5IHUH 4DGWC 1S3RA 1P6AB 4YIQB 4JY6A 1KC5H 2WBJB 3O6FB 5EBLB 3E2HC 4Z7VF 4APXB 1RH8A 3HG4A 3M88A 5HDOA 5L9DH 4ZUSB 4OKDA 1U8MB 3TS8A 3GMLA 4PSPA 4XNYL 2D0CA 3JWOC 5K33A 5T5FA 5GJSH 4BCZA 2MTPA 3OR6B 5I9QB 5T5FL 3ORJA 1UZ8A 2CM6A 4ELMB 3MV7E 4BJUA 4N0UB 1TENA 2DLFL 3AUVA 5DMGC 1U2HA 2A2QT 5T1LB 4CGUB 5IMMA 1ILUA 1OAXH 1CN4A 4FZ8L 4EAJA 2V3EA 5IB5A 4IRJC 5GZOC 2WOBA 3SDXE 1P7KA 2DKUA 2VR5A 1U6AL 2H7WA 3N0PB 4QMEA 4F2MB 2PCYA 3VWJA 1UEYA 4PGBB 3TO2A 3QDJB 2WBWB 4LOFA 4OCYH 4AUYA 5FB8B 1MVUA 5IB2B 3DX9A 5BVPH 2BMKB 1E5ZA 1A3RL 3ENEA 2NNAB 3P77B 4X7SL 3DTUB 5CLWA 3W9DA 2O4EA 2Q8BH 4ZTOH 2OTWB 3GO1H 4Y2NA 1J9CT 1DQMH 2XYBA 2C9RA 4Z7OE 2PCPB 3QPXL 3VXQB 5KYYB 3D85A 1EJOH 3AITA 3OKDB 3E6FA 5EEWA 3MRFA 4ZPVA 2YOAA 3EJZD 3O4OB 1KFAL 1HZKA 4BZYA 3C60C 3RPJA 3OX8A 1F2QA 2V7NA 3GPEA 1DANT 3LNFA 2GEEA 4X99B 4ODHH 3MOAL 4GUPA 2PNDA 3QQDA 3F10A 4ZX6A 4R9HA 4IBLT 4R2GC 2C4XA 1OAJA 5IHZA 1Y7VA 1WS8A 2YEZB 3FTSA 3T1FB 2VLLB 3BH8A 4F5CA 3O3BA 4Y19E 2FEEI 3VFNA 3GEFA 2CO2A 2IWEA 2A83A 2BSTB 3LV3B 4AYGA 1NUDA 5IBLD 4JFOB 3GJFK 5ICZA 3WXVL 1KFQA 2DQGL 1QRNB 3N1QC 3RI5F 4W4NA 2FYYB 4Z3FA 3MBEB 2VN4A 4GW5B 4LOUD 4OM0L 4HKXB 1KBKA 5JUEH 3EIFA 1XIWA 2BXZA 2EIZA 3KLKA 1JNLH 4JM4L 3RX7A 3GDCA 2YPLD 4XN8A 5DRXB 1CO1A 5HVHC 1X7SA 4XPFL 2XN9D 2XN0A 1XT5A 5CU5A 5EWIL 3GXPA 4YHZL 5IG7B 2OYKA 3TBCA 2QL1A 4M5YH 3OQ3B 1TPXB 3LS5H 4M6AA 5E1GA 3QUMA 1I1AA 1LDPL 1K3IA 2WWMD 4EVNB 2XKNB 3QUML 2NSMA 3L4YA 3GRBA 2GBTA 4NI3A 2H0JA 4HOWA 1MHCB 1EH9A 3PWPA 4WWKA 2V9TA 1K6QH 2MRYA 5KSUB 1WRFA 3KPPA 4MQ7B 4OZGA 1WZKA 2BC4A 4H1LH 2VDQB 4A2FA 4CDGC 1UT9A 3A0OA 5IHWA 1EJFA 3L08A 4TV3A 4Q2ZA 2Y1YA 1T89C 5B7MA 2CGZA 1B3JA 3BRGC 5F8RC 2ZZUT 3R7QA 1KTDA 1D5BB 1MVFA 1JYNA 2VDLB 3ZJAA 4HUCA 1MOEA 3WLWC 1M7DB 2JV6A 2FCBA 2W95A 5G5DA 1IAII 3LZPA 4FQQA 1DEEA 2DDQH 4P5MA 5F8QC 2DMCA 5AB9A 2R69A 1FNFA 2BIHA 3CFBA 1PY9A 2R69L 4N0RA 5EC1A 3T3PF 2G2NA 5GGVH 3WTWA 2D9QB 1RD6A 4PCTA 4JREC 2O5ZH 1WBXA 1IVLA 1BQHB 1TJHL 1U42A 1C5CL 5TF1L 4D7BA 5AG8A 1R0AH 1FNEA 3TN0C 1ZLSL 3NBNA 3E3QC 2VSMB 3MLRH 2XFXB 1UM4L 5HGDB 3EJYC 1NGXB 4XNXL 5DR5L 1OZUA 4PWEA 3BXNB 3MV01 5KBMA 2H2PD 3NQIA 1XGQB 4KRPD 4L1BA 4OZHA 1GW0A 3JWNC 3EYOA 5FYKL 5CBEB 2OMYA 1CK0L 3GK8L 4NKDB 3QEQD 2OA9A 3I3DA 1RK0B 4DKDC 5K9JL 3GGWB 4QEGA 4HAGA 5HHOA 5EC2A 5IT2L 1LEIA 4FERA 4PJ7B 4PRPA 4B0MB 1A6VH 1CL7H 4WO4C 1IGMH 2J2ZA 4FXGB 4JPVH 5AW7B 2QMJA 5FYKE 1KELL 2FTAA 3EF4A 1JXDA 2NXZD 1Y18B 3TYFA 2B4CC 4XT1C 1TFHA 4ZMOA 3C09C 3HC4H 1GOHA 4PJEF 1NWOA 2BVOA 1BX2A 5IFHH 1FORH 4LPWA 3T09A 4HBQA 4E41D 1O0VA 2W65B 3OJDA 1YMHB 4JM2C 4ZTPH 2D2OA 3G9VA 4HJJH 1P1ZB 3VQMA 4M7ZC 2CO4A 4NBXB 1H3TA 1HH6A 2QSCH 3ZHNA 3NIDE 1WA2X 1M05A 2B1HL 3J07A 5EDXA 4TPRH 1EUUA 4MD0B 5FA4A 4EALA 1FN7A 3X1BA 4KKCD 4E9TA 1GL4B 2IH3A 1K5WA 2NXYB 4PHXA 3NZUA 5B1CA 3IF1A 2R1WB 1ORSB 4UOZA 1ZSDA 1BMZA 3EJCA 3BP4B 1ZGLM 1XCTA 4GW1A 3QDGA 1HQRA 1IGFH 3TWCH 3SYAA 4L8BA 4ZS6C 4U6XA 5CBAB 3BSZA 5KVFH 5KVEH 1GJIA 3Q13A 4GRWF 5I0ZA 2XWEA 1WAAF 3BSZL 4J3OH 4RGND 3P40A 4WI6A 4XCFH 4ROCB 3VXSD 3B2PA 3IJYB 4NQDD 4Y1SA 2G3NA 2NOEA 1NUGA 3KR3H 5D6DC 1HU8A 2HJLB 3ATAA 4UTBA 3L1EA 3CPLB 3BD4A 4X42A 3QXDA 4UTBL 1IRAY 4FFYA 3QDGE 5TQ2L 1KJ2H 3W11C 5F9CA 4FFYL 3C08H 3L9RA 4R5XA 3QHTC 3BUBA 4LHJB 3ABMB 5HGGS 4OZFG 4ZYKA 2V2TB 1DBML 5DVMA 3L4XA 1JDDA 2WYHA 2E0PA 2VIRB 1ESOA 1FHNA 4O2EB 3PWNB 1XH3A 4ZMYA 2WZAA 3U46A 2XACC 3VRLF 4H8HA 5KS9A 2WXLA 5BVJA 3UW2A 1RP9A 4JG1L 1EFXB 1GPOL 2YZ1A 2WZ0A 1HL5A 12E8H 1M1XB 2ENYA 1DJIA 1MCWW 3HBPA 1S5IH 4M3HA 2Q76A 3ZRSA 1J7VR 2IGLA 4JFFD 5CZKA 4CVZB 1PZAA 3JWNG 1Q0YL 9PCYA 4AYFB 2ATPA 2PWDA 3ZDWA 3SDCB 5KS9E 3GS7A 1V3LA 4OBSA 4QNPE 2D03H 4A6YB 1J8HA 5KZCB 5FHAL 2V5TA 1JHKL 5E94A 2AJ3B 5LWYH 4NRZA 2H41A 2WQSA 4HX1A 5BRZB 1X9RA 3LEYH 3VMNA 3DXAD 4NX0A 4JANA 1G0YR 5CWSB 3O9WD 3KPLA 4U1NB 1RIVL 3KEHA 4IMLB 5FM5O 5J1SC 3RNKA 1T3FA 1KPRA 1T04B 2VDPH 5F2FA 1CE6B 5GGSA 3AC0A 2WXQA 2OSYA 3LPWA 3RHWK 1AH1A 3UOAB 5CZVL 1XCQA 2P9RA 1D5XB 2HN7A 3NCMA 2CPCA 1DSYA 5H8DA 5KYUB 2ERJC 1W0VB 1OE1A 4NNXB 2CALA 1P6WA 1FVEA 2C9SA 2YO3A 4JR9H 3KYKH 2EIKB 2DMBA 3OB0H 3VVVA 3GSWA 5C0AE 2QSTA 3KS0J 4AK1A 1IMHC 2MTAA 4LSUL 3TV3L 4UZSA 3ARDB 3I75A 3IXAB 4X80L 3QFJD 5SWZD 5HPMA 4A7GF 3KLQA 4LLVA 1KIQA 5C0CA 3LPOA 4L9DA 3K6SB 1LP9F 1BZ7B 3CVHH 5E0FA 3FT0A 5J3HD 1P5GX 2X6AA 4XWOD 3L5IA 1WBZB 3MJ6A 5E99L 4HZLB 4DQOH 1A3QA 2BOBA 3T0BA 3QC6X 3FTZA 1KBGH 4FTVA 2BCKA 3ZL1A 3P0YL 5KAQG 4F57H 5DHYA 2OMZA 3PDOA 5JZ7C 2X6MA 5J11C 4M4PA 4K8RC 4AEFA 2IPKB 4KKZA 1ASQA 3TXAA 4EI0A 1QX1A 4GY4A 4E9RA 4F27A 2DOCA 2O5NA 4MVBC 4PJ5D 4A66A 1YY8A 4X6FA 1TQSA 5JW5B 1B88A 1HILB 3GHPA 4X0KB 5BUPA 1OAQL 5IW6B 2UXGA 1A8JH 3FTUA 1TXKA 4NP4H 5DD1L 3NSXA 4Z18A 4DZ8A 4FKEA 3DOSA 3S5LG 2ZCKH 3HZVB 4FTVE 1U8OA 2R8SH 3MCLL 3JZYA 1X6NA 4DUVA 1SOKA 1QEWB 1WWWX 3WO4C 4F7TA 2WW8A 1KT2B 4LSPL 5B1JC 4X8JA 3IMRA 3T65A 4HIJA 4BXVA 2WKGA 3EZ8A 1TNNA 4FNLH 4X6DA 3BH9A 1I1FB 4DW2L 4Z7WB 2OMWA 3F6JA 3IFOA 4BBWA 4XNUH 2LU3A 5ADOH 5MEPA 1PZUB 1FFRA 1WZLA 3KJ4B 3G6DH 5ESVB 2E7LC 4KKAC 5EU6E 5D7LD 2BNQD 2EE3A 4OJAA 1WDAA 1ZHLB 1ZS8A 4PCSA 3UABA 1BECA 4G9DB 5KVGL 1E6OH 4FQCL 4F80A 2V17H 4AI7A 2WKOF 1E4KC 4H8WH 1SYSB 4ONOA 2VYRE 2WV3A 4MRBA 2MHAB 1AANA 3OC8A 3SE8L 2DQIH 5KVGE 3E3QE 3BPCA 5TGBA 1C12B 4WO4A 3OGDA 2DI8A 3LHPL 1XGYH 1Z66A 4M03A 3JWNE 3VD9A 2OW6A 2RAMA 1FDLH 8FABB 1SY6H 4HMEA 1N8ZA 2CBMA 2L7EA 3BAXA 5I1DB 2EDKA 3QDMD 2WINB 4JM2A 4Q7DA 5EOCH 4PD4J 2NY0B 3P69A 5ADPL 2E9GA 3D34A 5F7EH 3GXNA 3FU8A 5F6HJ 4V1DE 3HE7B 2I32A 1IEAB 2OM5A 1TYRA 4S1RL 2W0FA 4YL9A 4IEFA 1D6EB 1SXCA 4NO3B 1M71B 5HJBA 3N40F 2J21A 3DK2A 2A4ZA 3T4AB 2A6JA 1JFQH 4G1EA 25C8L 1KTKE 3MA7A 2DQFB 3K7UA 4MRQA 5M7QA 4YGVB 3D18B 4IS6B 1EXHA 1C16A 3CWGA 1CDIA 2DM3A 4LCWB 3WNPA 3TEUA 1KEML 1N59B 4ELDA 1JYWA 4QXWA 1SJEA 3C5ZB 5CSZA 2R23B 4JO3L 4QOKB 4DQAA 4QHKI 1OTUD 4KXZI 1MCQA 5F7LB 5FKPB 4YVNA 1YYLH 4Z7IA 3W57A 5I15L 2D7QA 2CNYA 5EEVA 4ZAKB 3G5XA 4XB3A 4BIKA 5I0XA 1A7PL 3B7TA 2X9YA 4PTUB 3ECBA 1RCYA 5K9KA 3NPSC 5DHDA 5AVWB 3F58L 1IC5H 3X12A 3U9PH 1FNGB 4QI3A 3RDJA 4U1MB 1KJ3H 1DLFH 2R51A 4Y2DC 1ZT4B 5IP4A 1OSPL 1IILE 2JTYA 4TQIA 1VZGA 4PFEA 3QUXD 3UPCA 1BWWA 1Q9LA 4KGLA 2YQ3A 4XOCA 3BT0A 1MXDA 4WI0A 1E90A 1T5WA 4K3DH 5CJOL 5MENB 1IFGA 4WO0A 2IADA 2R27A 5C6TL 3PG2A 4N0YH 1DN2A 2CDFB 3L2NA 4P9MH 2Q3ZA 3UBFA 3PP3K 4GOSA 4IHOA 5DJYA 1WEJH 1IJNA 2X4TB 1LNUB 1NA8A 4PJGB 1I8KA 1IAKA 5C9JB 2UZIH 4L0ZA 2ZSVA 4XBGB 2H32B 2PR9A 5INCB 1VKLA 5EIVA 5IYCP 3HN5A 2M2DA 5KL0A 1I7RB 1SRDA 3MYZA 5JN5A 2F5BL 3UO8B 2Y36L 2CA3A 3M1BA 1ZLVH 3KWUA 2CU9A 2NX5A 3MJ9H 4I2XE 4IIZA 4KOCA 4B5ZA 5IEHB 3MV7D 4FLOA 4EN3C 2OYLA 3MRBB 2FATH 3TVMC 2V2XA 3E9TA 3EZJB 4IBSA 1SHMA 2NW3B 3FQXA 1HYRC 3OSVA 4KRLB 2K7QA 3BZDA 1NOLA 4ZFZA 3D3VA 3HS0B 4L4TB 3L4TA 4GS7B 2P24A 2HT4C 1NC2B 4HOMA 5JOPE 1XDTT 2PCFB 3ATEA 2D0FA 4KKQA 4HJ0C 1JZ8A 1M6OA 4HKBA 3D1MC 3EHBD 4N85A 3KPMB 4FGMA 1KJMB 2NX5E 2Z9TA 5TH2A 4ABUA 4DKEL 2WTRA 4YFLF 1WG3A 3NACH 1Q1PA 1CF8H 3GSNA 3U82B 5LG1A 1MCBA 2YD5A 1LO3L 2EH8H 4OSUL 1S5HB 3ZYZA 5DZAA 4U7KA 4YHYB 5IQLA 1DSFH 3MU3A 1RIHH 4JDVA 4D8OA 1RXLA 2HRPH 2LABA 3PABB 1Y1UA 4PJHF 4X4MA 3RKPA 3MNVB 4MCYA 4F1SA 5KSAB 1YECL 3D2UD 1KGWA 1HSBA 1N2RA 3FMGH 4JG0H 5E0QA 5G4MA 2WZ5A 1T2JA 4F7CA 4Y2OA 1L6XA 4MXQD 4R4NC 5F9DC 1AHWA 3IRCA 2EE9A 4PMEA 4FQXA 2JKLA 3DIFB 3BEVA 4N5EC 4IIQC 4HQQL 2WCPA 1EUTA 3WTTA 1ZOXA 3D85D 4ZQKA 1PZCA 4TTGA 4NO5A 3RY4A 3ILEA 1LD9A 3LVEA 3CLEH 4PY5A 2AEPL 3NCWA 4RFOL 1KGUA 2DKAA 3AWEA 3QXVA 5IGXL 3P3RA 3HI5H 3R8QA 3CH1A 1U8LB 4JHAH 4DKAA 1PAMA 2UZYB 3H54A 4FP8L 2XG4B 3S4SG 4XGZB 3PCYA 5E6IB 1DE4A 3HS9A 4QWWD 4N3TA 4PV8B 2RTTA 2GI0A 3T6WA 3WEXA 2X2IA 2DI9A 1HIML 2D0GA 4Z7VB 5DLLA 1Q0EA 1RU9H 1TTFA 3WS3A 43C9B 3PNWB 4CSTA 3LXUX 5K59E 1MUJB 4FI8A 1Z9SA 4CMHB 3GUTB 3T71A 5JLZB 1EHLL 3OR7A 4MXVF 4MCZA 4QAMB 3REWA 3GJFH 2ZWYA 3ARFA 5D1ZC 1BYNA 1SJHB 4FHBD 4K4KA 1YO4A 1YHPA 4EZLA 2IC2A 3RSMA 2Y6SC 1XIWD 2H6UA 3V4LA 3BPOC 3QORB 2P28B 1FC2D 2VE6A 4KKBD 4MNGA 4W9CC 5JW4N 3ISYA 4RODB 2PW1B 1E4KA 1R3HB 3FCBA 3N41F 2LAEA 1BVLA 1MCEA 3QZNA 3ARSA 4PV9B 4C8XA 4K07A 4UOW1 2G60H 3ULVL 1I1AD 2BDNL 3L7FA 4QHMA 4AENB 3OXRB 3NN8A 4MBRA 2Z31C 4AYDC 2NT1A 4FQHA 3DX6A 3GBDA 2YAPA 3MUY1 4LQFL 2BW4A 3P11L 1PKQE 4IKIA 1G5AA 3BVXA 4LT7A 4WWKD 1ZSHA 1UH2A 2QADD 5D1ZI 2B14A 2WWOA 3GXDA 4U33A 4XNQB 3TL5A 2X1PA 1CIUA 4C83A 3TURA 4G8AC 3B2UD 2ADIA 4GRMB 5LBSH 4GMTL 1JXJA 3VFMB 1GY1A 3P54A 4OGZA 2AK4E 5E5MB 1F1GA 4AVKA 1CTNA 1GSKA 1UA6H 3QBTB 3EJPA 2CE6A 3ZYIA 4H40A 3QZLA 3T77A 3SJVA 4XN5A 3ZKXC 5L4IA 1WTLA 4B60A 3D39E 5K69A 2Y2WA 2YK1L 4LO9A 3R18A 1ITCA 5ECJE 2BFVH 3I3BA 5KSBF 1IBZA 4PVMA 1ES0B 1INDH 3HUJA 3WFEH 5I6MA 2P7TA 3LKNB 1SHWA 2CO7B 5DT1L 3SOBL 4LEEA 1AACA 2X2YA 1D5IL 4QHLA 2GJZB 3NZ8B 3ISWA 5GGTH 4B6ZA 4BELD 2F0CA 2BHUA 5EDSA 1QI3A 1WFUA 3GSXB 4M8UA 3OGCB 1NCJA 3ROLB 3PL6A 3DETD 5LGJB 1MAKA 4NDMA 4WNQB 4CC4C 1LWHA 3UDWC 1HXMA 3D87B 5ABZA 5J13B 3PS6A 1T2XA 3HUJE 4R90H 4JVWA 5FYKD 2ESVB 4LSVL 3MROA 3GINA 43CAB 1LEGA 1QNCA 3W39A 3RL2A 3EBGA 3EYVA 1XF1A 5IV2B 3RGHA 5DEFB 1IX2A 4LOEA 1IKFL 4JZNB 4ZW6A 5B39B 1HHGB 4L3AA 5D2NB 5F89A 5FYLH 3RAJH 1QFUH 4KROD 5F9WB 3V0IA 1QN8A 2DQEL 3BPLC 4OFDA 4OLUH 4XMPH 1XSZA 5JHBA 2YR3A 5D1XB 4H7VA 4HWEL 3WNIA 3EYQD 3QI9B 1P69B 4B95C 1J5CA 4Y9GA 5CCKL 1TQVA 3Q1EA 2D7TL 3TIEA 5A2CA 1AYRA 1I85C 1PZSA 3LZRA 5DDHA 2DJSA 4TVSa 5HGAB 4ZZKA 1HEHC 3ZHLA 3ZU8A 4R4FH 4U2ZA 1EEZB 2Z0BA 3KDMB 3L13A 3KEDA 3UTQA 3GMQB 1DVFA 2FECL 2OLDA 2UY7A 5HHMB 5C97A 3I02B 2L4OA 1MZYA 4AQ1A 2G5BB 1TYEB 1U91B 3KPSE 3VX1A 1XD1A 1TBPA 2N01B 5KSVA 2Z65C 5CGMA 4N0CC 3AMLA 3T3PB 5AYQA 4PG2A 4Z3TA 1UWYA 2KPWA 2JKIS 4ONHB 1SFHA 2IAMB 2FH8A 4P23C 1YEKL 3QDGD 1AZZC 5DEJA 5DHVH 2X6UA 1UOLA 2IV9A 1U8PA 1NC4A 2XWDA 4GQ9L 3B2XA 1JGLL 3F64A 4KGJA 1Q8MA 1N5YL 4CL7A 2FHCA 3UYPB 2VXVL 4RSYA 3GSQA 1C8PA 3NA9H 4QO1B 1NGYA 4FMKA 3NABL 5HDRA 1KXTA 4ORGA 4JO4L 3WEMA 4XN7A 4K5OA 4HT1H 4ZT1A 2UXFA 5IFAL 3X11A 4P46B 1OGSA 5E6SB 2BVUA 3DVFA 4A2LA 5AZ2L 4NOBA 3I50H 4PJBA 1MFEL 2YQ2A 3OHXB 4RMTA 5J9PB 1BZ9B 4M5ZH 5IK3B 2GSGA 1N12A 2K8MA 3RWFA 4OVUA 2DIEA 1KXVA 4PWGA 3WD5L 1Q72L 2F7IA 3ZE2E 5DZ9A 3ZHFA 1ZGLA 3Q9PA 1MNUL 1VOLB 1CE1H 2HFGH 2IMNA 2CIKA 3ARXA 4FMFA 3KLHD 2XZCH 3NQKA 4R83A 3WFBL 1SEQH 2IPUK 3B37A 2QGCA 5CS7A 3U0PA 1DBJH 2ADFL 2MMXA 1XXFC 2HPTA 5I71C 3TBVB 3KPNA 2DMKA 2BP8A 3DX1A 3PAVA 3ILDA 3TBTB 1NIFA 4BDVB 4E9LA 1J05A 2GJRA 4HUXA 4R2GD 5HXMA 4IBUA 2YRPA 1FL3B 2E59A 2XI9A 4FFZH 2UUDH 3UPAA 3WTXA 2ICCA 4WEUD 1XGRB 4TS6A 4AV5A 2AMUA 1J8HD 2BIIA 1FGNL 4A39A 3VFRB 1FC1A 4XP6L 1VFBB 2BJML 4RNRB 5LN4A 5I8CB 2DWDA 3P2DA 3ALXA 3REVB 4JFHD 1INEL 4U31A 5KTEH 3HHRB 5AW6B 2R4RL 3FSWA 2HJFA 3IT8D 5EOTA 3Q06A 2BINA 1A7OL 3MRIB 5H37H 4PUBH 3I0WA 4GRWB 2FJSA 1QUNB 3R19A 2J4WL 3VD2A 1ACZA 2FWUA 1GY2A 3IMSA 2YZ8A 1UC6A 1F4YL 4JHZA 2NRDA 4H88H 3FRUA 1YPZE 2FIKA 4ABVA 4DERA 1TZIB 2ODHA 1B4JL 3MLXH 1FP5A 1B0GA 5D5MF 3V10A 4HK3N 2BXYA 2PR4H 2NNFA 1E0OB 3OD3A 1EDHA 3P30H 4X5XA 3FU7A 5DD3L 1JK9A 1IC7H 5GS0C 3EO0B 5BV7B 2ZYSA 5JTWA 1W8NA 3C9NB 2WK2A 3ZYJA 4HOZA 5J12B 1OM3H 3MHZA 4WHTB 1X7QB 5C0CD 2XWCA 4Y16B 1DDHA 1I1CA 1MPAL 4PJCF 2ZCHL 1KO9A 5AAWA 2HFEB 4ADIA 4QUOA 2FQDA 3AS1A 2Z93A 3T3ME 1FO0A 5I1JL 4Z5RB 4HUUA 2WWNA 1IBFA 2EH7H 4FTVD 1FO0L 1OQOA 2EICA 2DLFH 4FFWC 1IT9L 1SDDA 1BWMA 2P4AB 3HZMB 4FZ8H 1JN6B 2VN6A 4J3XA 4NOFA 2E9WA 5JIPA 2P8PA 3U1SL 3OQRA 4WK2B 2FGWH 2JKJA 3QUYC 2DI7A 4IOFC 2VDRH 3WLWD 4PY8J 1BQKA 5EF0A 1IVTA 1NM9A 2JXMA 2MZ8A 4JDZB 4X7SH 3BUDA 5F1NB 4B53A 3PJNA 1LE9A 1F4XL 2J56A 5ISZB 4A37A 4L37B 2OK0L 3QQ4B 2L8AA 4KAQL 2IFGA 2FR4B 2OR9L 2CDEB 3E80A 3RWJB 1ZTXL 1M42A 3VXMB 2EEXA 5I1KL 3OL2A 3GSOA 2NT0A 3UG5A 3QPXH 5CKAA 5E1AB 3KG5A 4BHUA 2AQ1A 3EGXA 4LHUG 1MFUA 1VF5C 5EF3A 1CLVA 1KV3A 2YRLA 2Y3AA 3FS9A 3NIGE 4KQ0A 1WCBA 4UV4L 3TN0D 4S1DC 4WJ5B 2YRZA 2FKMX 4NPYA 1A14L 3OG6B 3QR0A 4WW1A 2ATKB 4AQZA 1N19A 5BS0E 3CDZB 4ZQTA 3FUIA 5F9JA 4QAWA 1TQBC 3TBWA 5AZUA 4F9LA 1S3KH 4NQVA 4X6BB 2D3JA 2H1PL 4Y5XB 5J56B 1AGFB 2J1WA 4R5TA 4EQ3A 3N44F 3H7LA 4P4KB 3OF6A 3K4DA 4YHKH 4NBZB 2AV1A 2B7DT 3DX7B 5EO0A 4WO4D 3P3SA 3WN5B 2JLPA 2DQGH 1LP9B 2F5AH 4Q9BA 2CZNA 2BFGA 1GA2A 1ZA6B 2X9WA 3D0LB 1U3HA 3IU3A 5F70A 1ZLWK 1Q0XL 3MJ8A 2ODIA 1TTBA 4NLHA 2Q6WB 1QSEA 1HEJC 4JM2D 1IL1B 3VAEA 4FJ6A 3VTMA 2YEQA 2HJKA 2YD7A 5ELIA 1MFDH 4GUQA 3W9EB 1PLBA 3CSGA 3ZKQD 1KLGB 3Q1SL 4U6HB 4BKTC 1FSKC 4LIQL 5DMYA 5EWIH 1D9KC 3SSGA 1P9MC 4XVTL 4HALA 4MAYB 5HDBF 3ZO9A 3FRPG 4ENEC 2ZFDB 5JHDB 4H8UA 3AZUA 1JWSB 5I18L 5D7IF 3KPTA 1IKNA 2EXYC 1QSEE 3PAZA 4ZUTA 4C59B 4WFFE 2OOXA 2NY5C 2YUXA 5TD4A 1H3XA 3FFCE 3P3UA 5EOCJ 4DGIL 5DTFB 1J0YA 4RBPH 3O3AB 3WSQL 5A3IC 2H6PA 1B0RB 4QR7A 1ONQA 5GGRA 3G6JF 4DPCX 2IQAA 2XZQL 1AGEA 2EJ1A 1U8CA 1YEEL 2PMZA 3P2BA 2CBQA 4TSCL 4XR8C 4ZS6D 5GRVL 3RU8L 1DYZA 4LLUA 3GEWB 1G6RB 3KPQB 5GRUH 3MRHA 2O6EA 4AV0A 5DRZA 1NKOA 5CLTA 4Q8BA 3FQTA 5DJZB 2Y8LA 1GGIL 3VH8A 3SDYH 1L9MA 4J3VA 3FYIB 2VLKB 1CGVA 4KJYA 3U9WA 5DQDL 4G3YL 5DUML 1RERA 1MCPL 1ML0A 2KLRA 3DUSB 5K39B 1QBML 2GBUA 3VDAA 3ZN6A 3IRZA 5DFVD 3W11D 4U7SA 3C6LA 3WI9A 5KG9B 1MCLA 2GJ6A 3OLIA 4AM0A 1NMBL 4ZOBA 1HQ4B 5IBTH 3W5MA 3Q05A 1AKPA 4WUKL 1GZQB 1J8RA 2XQYK 1BW8A 3MA9L 3P2TA 1RJYB 3O41B 3GHBH 1A5FH 2H8PA 4UQ2B 3QJHB 3CHPA 1SF3A 3RIAF 3T6VA 3OSMA 1IZKA 5D72H 3ARBC 4G6JL 4LHUA 1C5CH 1O6VA 4RQQB 4FG4A 1LMIA 2O6CA 3ZZSA 2DQDL 2FO4A 1UM4H 2ZCZA 3BZEB 4XNXH 1OCOB 5IB3A 1T6BX 5DSCB 1IU1A 5FYKH 1KIRB 3QA3A 3PP3H 1A1OA 2GQHA 4LRIC 2ZWZA 5C3IA 3FTGB 2FWOB 5K9JH 4JDTL 3IXTA 1KPUB 2JQAA 4L3EA 2NX5D 3BFOA 4PWHA 3HZYB 4U1SB 3ABZA 3IFNH 4ZPTB 2X89A 2A38A 1RJCA 5TDPB 1E8YA 5L2JA 1ROCA 4TUJB 4P2OC 1BD2A 1G0XA 3D3VD 5CP3A 3UTZB 3BYYA 1HN1A 1GKEA 5E51A 5K1VA 5A2FA 2CLZB 2X10A 3RA7L 3MO1B 2ADGB 1P5VA 3DMMB 2UYLB 3O8XC 3VB8A 4BGLA 2O5YL 2C3GA 1BIHA 4QHUB 3LH2H 1Z9MA 4HIEA 3LKOB 3DX0A 4UV7L 2CRZA 4J3SA 1YUKB 4S10A 1YLBB 1A6TB 3HR6A 4HIHB 3PXLA 4IRSC 3CXHK 2J55A 1BD2E 4JFEE 3FRPA 5AVUB 2Z92B 1LO2H 4FMVA 2NUTA 4P2YA 4R96B 2GUOB 4FAAB 4X6CE 2ITCB 4HZAA 4OIAA 2QR0A 1VJSA 4HWUA 4IQHA 4OLEA 3TE5A 4JPKH 2WQRA 5FM4A 1G7LA 3MUHL 4N9GB 3QAQA 4G42B 5C09A 2EE2A 2MIZA 3KYOB 2MPAL 4D9LH 2YA0A 1NGPH 1F45A 2J88L 2ZD0A 1NGMA 3UMNA 4YDIL 1R5IA 1UGNA 2K45A 1S7UB 1QW8A 3MV9B 4M9OA 3HB3B 5FW8A 3JWOH 5EU3B 3BSZH 3EJQA 2EDYA 2P5WE 4JZJA 1R4XA 1A25A 5BNXD 5JZ7D 5GS1A 4LLWA 1ZT1B 5C7ZA 5IW1B 2Q7YB 5IREA 1FBIL 1NOFA 5C09E 4MVBD 1D6VL 3I9PA 1XCXA 4YWGL 4LF3B 5AVSB 1M3QA 1LWWA 4R7NA 4NHUB 3MUZ1 1ZLEA 3GI9H 4G6KL 3NEEA 4ODBD 3BP5B 1KYOK 3SQOH 1V7ML 1S4IA 1U8HB 3CFKA 2HAZA 2WXHA 3RWGB 3GJEA 2W07A 1I8MA 4RGOL 5B8CA 4OZGF 5AKVA 5ITFB 1OP5K 1HHIA 1UM5L 2XC8A 2X4QB 5DF0A 5HVFB 2JOIA 1QNEA 4JG1H 1GPOH 4XCNA 3BP7B 5D7JB 1T6VN 4ELKA 3ARFD 2VDKH 3S97C 1OVZA 1M53A 5FO9B 1E67A 5AL0A 1RHHB 2N0MA 4MYPA 3ULVD 3BWAA 3PHOA 3BUYA 4C47A 3WY3A 5KW9L 3BPNC 3HMXA 4WWOA 4PJHB 4I3SH 4XN9A 1OGAE 1OAUH 3IJEA 3GSVB 3BUIA 2R0KL 3K6FA 4ODVL 1P84J 4GYBA 4O2CB 1A3LH 2EYSB 3CZFA 2X2HA 1FV1B 3FYEB 4QCIA 3VWKC 3EG9B 2VC2B 1X5JA 2VMEA 4K7PL 4BFEA 1ZV5A 3BQUC 4F3FA 3N9GL 5AKRA 4JFXB 2WIMA 2YPLB 4H5SB 2PO6A 1ID2A 1JF1B 5FECB 3KH4A 3UTPE 3WEAA 4FXLA 4TRPH 2A73B 2XN9B 2NLJB 2AXFB 4LLQA 5T5NG 3MQIA 2DQJH 4OZHF 3ABKB 1U2CA 2XBTA 3PP4L 3L3GB 4EIUA 2ZUTA 4X83A 3RVTC 2CIIA 3EOAA 1D9KA 5E8DH 1F1DA 5IMOB 4LEXH 2E7DA 2XHNA 1KTLA 1PY0A 3SJVD 4BINA 4F7EA 2BIMA 3D0VB 1BLNA 3P4OA 4GXUN 2P52A 2BK8A 5JIHA 3TYGL 4Z7AA 3RWCA 3MRCB 4X80H 1NBYB 2VR9A 3ZTNH 3HLAA 1CGXA 2X09A 1GJUA 4CJ1A 1R24B 4M3KB 5MEOA 3AGWA 4UQEA 2NY5L 4P48A 2C1OB 4MMXC 3B6SA 3LD8C 1CXLA 2XA8H 3HNSH 5IVXE 3TIDB 4EI5A 1BOGA 1NEZG 4RZCA 2JTDA 2J8UE 1ADQA 3KGTA 3ELQA 3FO0H 3VFSA 2ITEA 3SPCA 5F0PB 2BZDA 3P0YH 2GK0A 3PL6D 1Q1JH 1ADQL 4XNBA 4XMVA 5DC9B 4L8SB 4ZXBC 2NSXA 2LR4A 1FLRH 1E3XA 1FZKB 4GG6E 1MW0A 1I75A 1XB8A 15C8L 2QR1A 3MMEA 4N8VA 5CJBA 3IK2A 4U2YA 2I7SA 3BDXA 4QIRA 3WCYA 4KU1A 1K72A 5AAMA 4GSQA 3HC0B 3ROOB 4Y2DD 3LX9A 4DN3L 2ZNXA 4RMSA 1SXNA 3MCLH 1E42A 1S9YA 5BZWB 3F04A 1G7JB 2R0ZL 5F6IC 1CGSL 4G9FA 1I8LC 4OZFH 3L3DB 4LEBA 2AV7A 3QE5A 4Q6IB 1JZHA 1A9BB 2FWLB 3CZGA 3MRQB 3UJIL 3ARBA 1TZHB 1MCRA 1EJ6A 1UASA 1H8OA 2EKSA 3AUWB 3OPZH 1ACYL 1I8IA 3H9SA 3PWUA 1PLGL 1PZDA 1YUHB 4GXVL 2X9XA 4NN5B 4KRPB 5DURD 2DH2A 4TULL 5SWSA 4I87A 2CBTA 1B2WL 5KVGH 2IBGA 1GHFL 1NSNH 1YEGH 3BIBX 4FQCH 3JWNH 4NQCA 4ODWB 3SGKC 1DVFD 4QRTB 4AL8C 4BFIA 5HGHA 3H9SE 4OV6F 5B4MC 5KSBB 4PREB 4K3EL 3PWVB 2NXZB 4XVSL 5I75B 3V6BR 4A7SA 3TVMD 5SWSE 4EDWL 4PRHB 4X5WB 5LCVH 5HP5A 5DFWH 5KS9F 2BSDA 2XWBB 4L4JA 5EN2A 3PV7A 4E41B 4ZMTA 1E7VA 4FYSA 1J0IA 4QRQB 2HT4D 3VFUA 2B4CH 5AVZB 4AGPA 4GP8B 5HHNB 2NQ3A 4HJ0D 1N8OE 1NC4D 1KEGL 1BSIA 3QQ9C 4BSWA 4GAJH 5ADPH 3IB4A 2MNWA 3KCWA 2W60A 4M8QB 1QN3A 1R17A 2FNBA 3UZEC 3HC3H 1QBBA 4UILH 5E6RB 3UJJL 1SMDA 4PS4L 2PWHA 4AW7A 3WJLC 3FU9A 4FQIH 3V9FA 4YHIB 3D48R 4HJGA 4NZUH 3CVCA 1JXKA 4ZFFB 1NGWB 25C8H 1QD0A 1HSAA 2HKHH 4APQC 3RWIB 2PN5A 3DSNB 3LKSB 4GPVA 2H3NB 3BUPA 4X50A 5GRVK 3FQWB 3ZIMA 4FQJH 3EADA 3S2AA 2GC4C 5BOZG 1DLHB 4ZW5A 2UWEF 1KEMH 3L4ZA 1CFMA 1QACA 4N5ED 2PWEA 3IKCB 1OO2A 2DPKA 1MLBA 4JO3H 4NKOA 3SKNA 5I6PA 5F96H 4DK3A 2Q20A 4UMGA 5EZLB 5T1DL 3MBWA 3VG9C 5AW9B 1ZPUA 3V0VA 1HK6A 1A7PH 3MODL 2WO4A 3U2SA 1IBGH 3F58H 3ATDA 1L6ZA 5ALBL 4M3JA 5ERWB 5L4MA 4KNSA 4Z0BH 1EZVY 4XP4L 5FIEA 2Y4SA 2KZWA 3DK0A 2ENSA 3IDXL 5TK4A 3ZDZE 5K1JA 4JFZL 5ILTH 1KULA 3QQ3A 4IRZH 5LJYH 3WLBB 2HRGA 3IDYB