5JMVD

Crystal structure of mjkae1-pfupcc1 complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
RVQAKIEIEFPSEDVAKVVYEAVLYEHLSVPYRRSEIDFKLEGKKIILDIKATDSSALRGTVNSYLRWIKAAIDVIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable bifunctional tRNA threonylcarbamoyladenosine biosyn
publication title Structural and functional characterization of KEOPS dimerization by Pcc1 and its role in t6A biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
total genus 24
structure length 78
sequence length 78
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2016-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09341 Pcc1 Transcription factor Pcc1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 5jmvD00
1C4GA 4QG5A 3UW2A 4HJHA 5EPCA 1K2YX 5KL0A 3PDKA 5HSHA 1P5GX 2F7LA 1KFQA 4WX8A 2Z0FA 2FUVA 4MRQA 4BJUA 3NA5A 3ENCA 3C04A 3BKQX 5BMNA 5JN5A 3ENOC 2H5AX 1K35A 4WXAA 4IL8A 1VKLA 2FKMX 1C47A 1JDYA 1LXTA 3OLPA 2JPIA 5F9CA 1KFIA 1P5DX 1WJWA 2DKDA 5BMPA 5JMVD 2DKAA 1PCMX 2H4LX 3RSMA 1WQAA 1PCJX 3PMGA 2DKCA 2FKFA 1TUOA 3I3WA
chains in the Genus database with same CATH superfamily
2V92A 1VTOA 4TPSA 2NOIA 1K2YX 1FN7A 1D3UA 5HSHA 1TBAB 1KO9A 5AN4A 4Q11A 3NA5A 2D0BA 3ENCA 1PVSA 2HL8A 3TE5A 1YQRA 5BMNA 2EHBD 1XSZA 1C47A 2LAEA 2QLVA 3OH9A 1M3QA 1JFIC 2NWVA 3H1ZA 1WQAA 1C9BB 2HZSA 3PMGA 1MPGA 3DPUA 2IV9A 3F0ZA 3IH7A 1M3HA 2Z8UA 1QN5A 4EAJA 2O3OA 3TDHA 3OCIA 3UW2A 1B9KA 2MJ7A 5EPCA 2D0AA 5KL0A 1VTLE 3PDKA 2V9JA 3OH6A 3ASMA 1MP9A 1Q9UA 4BJUA 3I0WA 3RPJA 3CW7A 1YQMA 3CVTA 1UT7A 3EIKA 3HS9A 1YTBA 2D0CA 5JN5A 2Y8QA 1QN3A 4WXAA 1J3MA 1YTFA 1VKLA 1UT4A 2FKMX 2JHNA 1QNAA 1LXTA 4B0AA 2JPIA 5IYCP 1KFIA 1WJWA 3VN5A 2DKDA 5IYBP 1RM1A 5JMVD 2H4LX 1QN7A 1QN6A 4DULA 1LWVA 1QNCA 1NGMA 2NVMA 1M5Q1 1TUOA 3I3WA 4EAKA 1PZDA 1C4GA 4EAIA 1DIZA 1PCZA 3N89A 2G30A 4HJHA 2JOIA 3KRMA 2QRCA 1P5GX 3SNSA 2F7LA 1KFQA 4C7PA 4WZSD 3CWTA 2FUVA 4EALA 2NOEA 3CVSA 1LWWA 2NLVA 1QTSA 2HZMA 3C04A 1YQKA 1T6AA 1HU0A 3DPTA 1QN8A 2VJ0A 4EJZA 2YH5A 2H5AX 2OOYA 2R5XA 3D7QA 1KY6A 1KYDA 4IL8A 3I0XA 1QNEA 2NOFA 3OGDA 3F10A 3EAYA 4CFFA 2I5WA 1P5DX 2FGTA 1VOLB 1N3AA 2V8QA 2DKAA 1TBPA 4I8OA 1VOKA 3D4VA 1R4XA 3ULXA 1YQLA 1UL7A 2PWWA 1QN4A 4QG5A 1QN9A 2HKPA 1NVPA 2YA3A 3KTUA 4WX8A 2Z0FA 2Y8LA 4MRQA 1NH2A 1KYFA 2NOHA 2JHJA 4EAGA 1EUVA 3OSEA 3BKQX 1KY7A 3ENOC 2IV8A 1K35A 3OC3C 1N39A 2MZ8A 4RODB 4ROCB 1EBMA 2QRDA 2HL9A 1KYUA 1CDWA 1E42A 1V5SA 1JDYA 3OLPA 3OSTA 4D7QA 5F9CA 1N3CA 4D7RA 2NOZA 1AISA 1TGHA 4PY5A 1QTPA 3CWUA 3CWSA 5BMPA 3HS8A 5IYDP 1PCMX 2NOBA 3RSMA 3OSMA 2QR1A 2OOXA 2ZFDB 2NOLA 1PCJX 3T4NA 1W80A 1LWYA 2DKCA 2FKFA 1QNBA 2XHIA 4EJYA 2QREA 4ROEB 3CWAA
chains in the Genus database with same CATH topology
1C4GA 4QG5A 3UW2A 4HJHA 5EPCA 1K2YX 5KL0A 3PDKA 5HSHA 1P5GX 2F7LA 1KFQA 4WX8A 2Z0FA 2FUVA 4MRQA 4BJUA 3NA5A 3ENCA 3C04A 3BKQX 5BMNA 5JN5A 3ENOC 2H5AX 1K35A 4WXAA 4IL8A 1VKLA 2FKMX 1C47A 1JDYA 1LXTA 3OLPA 2JPIA 5F9CA 1KFIA 1P5DX 1WJWA 2DKDA 5BMPA 5JMVD 2DKAA 1PCMX 2H4LX 3RSMA 1WQAA 1PCJX 3PMGA 2DKCA 2FKFA 1TUOA 3I3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C4G A;  4QG5 A;  3UW2 A;  4HJH A;  5EPC A;  1K2Y X;  5KL0 A;  3PDK A;  5HSH A;  1P5G X;  2F7L A;  1KFQ A;  4WX8 A;  2Z0F A;  2FUV A;  4MRQ A;  4BJU A;  3NA5 A;  3ENC A;  3C04 A;  3BKQ X;  5BMN A;  5JN5 A;  3ENO C;  2H5A X;  1K35 A;  4WXA A;  4IL8 A;  1VKL A;  2FKM X;  1C47 A;  1JDY A;  1LXT A;  3OLP A;  2JPI A;  5F9C A;  1KFI A;  1P5D X;  1WJW A;  2DKD A;  5BMP A;  5JMV D;  2DKA A;  1PCM X;  2H4L X;  3RSM A;  1WQA A;  1PCJ X;  3PMG A;  2DKC A;  2FKF A;  1TUO A;  3I3W A; 
#chains in the Genus database with same CATH topology
 2V92 A;  1VTO A;  4TPS A;  2NOI A;  1K2Y X;  1FN7 A;  1D3U A;  5HSH A;  1TBA B;  1KO9 A;  5AN4 A;  4Q11 A;  3NA5 A;  2D0B A;  3ENC A;  1PVS A;  2HL8 A;  3TE5 A;  1YQR A;  5BMN A;  2EHB D;  1XSZ A;  1C47 A;  2LAE A;  2QLV A;  3OH9 A;  1M3Q A;  1JFI C;  2NWV A;  3H1Z A;  1WQA A;  1C9B B;  2HZS A;  3PMG A;  1MPG A;  3DPU A;  2IV9 A;  3F0Z A;  3IH7 A;  1M3H A;  2Z8U A;  1QN5 A;  4EAJ A;  2O3O A;  3TDH A;  3OCI A;  3UW2 A;  1B9K A;  2MJ7 A;  5EPC A;  2D0A A;  5KL0 A;  1VTL E;  3PDK A;  2V9J A;  3OH6 A;  3ASM A;  1MP9 A;  1Q9U A;  4BJU A;  3I0W A;  3RPJ A;  3CW7 A;  1YQM A;  3CVT A;  1UT7 A;  3EIK A;  3HS9 A;  1YTB A;  2D0C A;  5JN5 A;  2Y8Q A;  1QN3 A;  4WXA A;  1J3M A;  1YTF A;  1VKL A;  1UT4 A;  2FKM X;  2JHN A;  1QNA A;  1LXT A;  4B0A A;  2JPI A;  5IYC P;  1KFI A;  1WJW A;  3VN5 A;  2DKD A;  5IYB P;  1RM1 A;  5JMV D;  2H4L X;  1QN7 A;  1QN6 A;  4DUL A;  1LWV A;  1QNC A;  1NGM A;  2NVM A;  1M5Q 1;  1TUO A;  3I3W A;  4EAK A;  1PZD A;  1C4G A;  4EAI A;  1DIZ A;  1PCZ A;  3N89 A;  2G30 A;  4HJH A;  2JOI A;  3KRM A;  2QRC A;  1P5G X;  3SNS A;  2F7L A;  1KFQ A;  4C7P A;  4WZS D;  3CWT A;  2FUV A;  4EAL A;  2NOE A;  3CVS A;  1LWW A;  2NLV A;  1QTS A;  2HZM A;  3C04 A;  1YQK A;  1T6A A;  1HU0 A;  3DPT A;  1QN8 A;  2VJ0 A;  4EJZ A;  2YH5 A;  2H5A X;  2OOY A;  2R5X A;  3D7Q A;  1KY6 A;  1KYD A;  4IL8 A;  3I0X A;  1QNE A;  2NOF A;  3OGD A;  3F10 A;  3EAY A;  4CFF A;  2I5W A;  1P5D X;  2FGT A;  1VOL B;  1N3A A;  2V8Q A;  2DKA A;  1TBP A;  4I8O A;  1VOK A;  3D4V A;  1R4X A;  3ULX A;  1YQL A;  1UL7 A;  2PWW A;  1QN4 A;  4QG5 A;  1QN9 A;  2HKP A;  1NVP A;  2YA3 A;  3KTU A;  4WX8 A;  2Z0F A;  2Y8L A;  4MRQ A;  1NH2 A;  1KYF A;  2NOH A;  2JHJ A;  4EAG A;  1EUV A;  3OSE A;  3BKQ X;  1KY7 A;  3ENO C;  2IV8 A;  1K35 A;  3OC3 C;  1N39 A;  2MZ8 A;  4ROD B;  4ROC B;  1EBM A;  2QRD A;  2HL9 A;  1KYU A;  1CDW A;  1E42 A;  1V5S A;  1JDY A;  3OLP A;  3OST A;  4D7Q A;  5F9C A;  1N3C A;  4D7R A;  2NOZ A;  1AIS A;  1TGH A;  4PY5 A;  1QTP A;  3CWU A;  3CWS A;  5BMP A;  3HS8 A;  5IYD P;  1PCM X;  2NOB A;  3RSM A;  3OSM A;  2QR1 A;  2OOX A;  2ZFD B;  2NOL A;  1PCJ X;  3T4N A;  1W80 A;  1LWY A;  2DKC A;  2FKF A;  1QNB A;  2XHI A;  4EJY A;  2QRE A;  4ROE B;  3CWA A; 
#chains in the Genus database with same CATH homology
 1C4G A;  4QG5 A;  3UW2 A;  4HJH A;  5EPC A;  1K2Y X;  5KL0 A;  3PDK A;  5HSH A;  1P5G X;  2F7L A;  1KFQ A;  4WX8 A;  2Z0F A;  2FUV A;  4MRQ A;  4BJU A;  3NA5 A;  3ENC A;  3C04 A;  3BKQ X;  5BMN A;  5JN5 A;  3ENO C;  2H5A X;  1K35 A;  4WXA A;  4IL8 A;  1VKL A;  2FKM X;  1C47 A;  1JDY A;  1LXT A;  3OLP A;  2JPI A;  5F9C A;  1KFI A;  1P5D X;  1WJW A;  2DKD A;  5BMP A;  5JMV D;  2DKA A;  1PCM X;  2H4L X;  3RSM A;  1WQA A;  1PCJ X;  3PMG A;  2DKC A;  2FKF A;  1TUO A;  3I3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...