3H1ZA

Molecular basis for the association of pipkigamma -p90 with the clathrin adaptor ap-2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 complex subunit beta-1
publication title Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 51
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h1zA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3h1zA02
1D3UA 2D0BA 4RODB 1QTSA 1VOKA 1QNEA 1QNCA 3OCIA 1PCZA 1RM1A 1QN4A 2G30A 1KY6A 1B9KA 1QNAA 1QN6A 1QN7A 1KY7A 1KYFA 1QN8A 1VOLB 1YTBA 3EIKA 1C9BB 3OC3C 4WZSD 5IYBP 3ASMA 1QN5A 1TBPA 1TGHA 4ROEB 2Z8UA 1KYDA 4ROCB 4PY5A 2VJ0A 1MP9A 1R4XA 1KYUA 1NVPA 1VTLE 3H1ZA 3HS8A 1W80A 1QN3A 1VTOA 1QN9A 5IYCP 1NGMA 2MJ7A 1TBAB 2D0AA 2IV9A 1E42A 3HS9A 2D0CA 1CDWA 1AISA 1QNBA 5IYDP 2IV8A 3VN5A 1JFIC 1NH2A 1QTPA 4B0AA 1PZDA 1YTFA
chains in the Genus database with same CATH superfamily
1OTSD 4ODWA 2EQDA 5JNYB 3B4NA 1SDDB 3VD3A 3QG7H 2Q76A 1S7TB 2BP8B 3L1FA 4BWTA 3SPJA 5IV2A 3KLAB 2FT7A 4AT6B 2ATKB 2UWEA 5C08A 1EHLH 2LLNA 4B9CA 3SPIA 2WUCH 1NGPL 1CC3A 4LHUA 1XF2A 2H0JA 1E6OL 3BAYA 1LO2L 2MHAB 5SV4A 1U3NA 2W07B 2XJLA 4V1DB 3H2WA 4Y1AE 1G4MA 4UUJB 3U6XS 5J6SA 4RQQB 3CFDA 1ZA3A 1NCBH 5EO1A 1UKSA 2QGBA 2ZYHA 2WMPA 5LGJA 2NY1C 2ESVD 4HXAL 3PV7A 3KGUA 1NC2D 3QR1A 4YS4A 4BFJA 5E1GA 4KXCA 4LLAA 1QI3A 2LLLA 1J5HA 3VM5A 3UTPD 3N1PC 4PMFA 4EKJA 2R5XA 4I3SL 1JRHI 1N0LB 5JZ7C 3K72A 5CSGA 2B77A 2L7UA 1DUYB 3BSGA 4LARL 4G6AD 4FKEA 4UNTA 3D39D 1N8OE 3EYFB 2RGSA 1IKNA 5ISZD 3HMXA 3MNZA 4CDHA 2NXZD 3BVUA 2XRAL 1E5UI 2VQUA 1P9MC 2YRBA 1VCBC 1JCVA 3L6FB 3B34A 4NSKA 4PFEA 3M1CA 1RUKH 5DJYA 4AMKH 5B1JC 4HJ1A 2QGCA 3D85D 1AO7B 4XP5L 1AQMA 4I87A 2VDQH 4XBPA 3MLZH 2NW3A 1A14L 4DGWC 4IIZA 5DA0B 4AGNA 1MDAA 2G3NA 4Y5VA 1UOVA 3LY6A 2F54E 1H8LA 2CO6B 1YPZF 1QPPA 2FEJA 3U2IA 3X11A 4J12A 4PJIA 5F21B 2AGJL 1S78D 4WNQB 2AXFB 1AXTH 1QI4A 3HI1B 3MUGB 4UM8B 5A7BA 3TESA 2XQBL 3GINA 3JWNC 1OP5H 2APBA 3T5WA 3ARQA 4BFKA 1IO4C 1MWAA 4K3HA 2VRQA 1VACB 4PY7A 1E30A 1NL0H 4ZQKA 5SWZE 1LE5A 1HEZB 3ML8A 1LEGA 2N7AA 2NY6C 3L5HA 5M94B 3ZTCC 2GI0A 1HHIA 3PWNA 2HG0A 3QNFA 3K2UH 1TDQA 1NCHA 4L3CB 3O9WD 3NCJH 3TN0C 1SJEB 3GIZH 3LV3B 4X98A 4PP2B 1MVUA 2YPKB 1Y1DA 3B2VL 4K3EH 3WN5B 2X6MA 5D1ZD 1DQLL 5C8JB 3MJ8B 3V4VL 4IHOB 1LXMA 1RZKH 3H42L 4PJEE 5FKPA 1BEYH 3IFOB 3MLVH 4FKHA 1NC4D 4JPKH 3QUXD 4QTIH 3SKNA 1G7HA 4TTDC 4BH7B 2DIJA 5MP6L 1DEDA 3ABZA 1FJ1A 1NC2B 5D96B 3RKPA 3BT0A 3UJIH 5G4OA 4M48L 1EAJA 3CDZA 4Z7AA 3K4DA 1EBPA 3CFQA 3D0LB 4JFPA 2RIKA 1KB5L 2V7NB 2XV6B 2YBRB 4LASL 3VFVB 1SOSA 4M03A 2VLJE 1M2VB 2V2XA 2HKHL 3D39B 4APXB 5ISZB 3X3FH 1I7RA 5KSBB 3MBWB 4PHZA 3OR6A 4CILA 2NXZB 1AKJA 3GWJA 4OJYA 1PD1A 2LAAA 1JZ4A 1V5SA 1HVXA 2K4AA 1XH0A 3V6OE 4P3WA 4DJMA 3D85B 3GBLA 3JV6B 4JE0A 1N3NA 3BO8B 2ZKHH 3SN6N 1R0AH 2C3VB 1CL7L 4R0LC 4GMTL 5JORB 1AY1H 3QAZB 1M57B 4H8QA 4HMDA 5D1XB 2W0FA 1JD9A 1PCMX 1X5AA 1DJXA 4UT7H 5DS2A 3QHFH 1LYQA 1D9KA 5I15L 2QKIC 5C09E 5A16B 5IBTH 2EVIA 4JLRA 2F74B 3QUMB 1JGDB 2WK2A 3FRPG 4A68A 5FO8B 1DVSA 4XGZB 3JSSA 4RIRB 5E8EA 4N0YL 4IKIA 4AV4A 3FFOA 4PMEA 3T4NA 3WFDH 5DEGA 1AYOA 3VXME 2H45A 1NZRA 4O4YL 5IMLA 4YDJB 2O4EA 2CBTA 2R69A 2A74C 2ZAGA 1M7DB 2CSPA 2DQJH 1HAWA 4C57C 3O8XD 3O9WB 5I0ZA 1FL5B 3WU1A 2EUXA 3ULSA 3EGXA 2X41A 3D25B 2X4NA 4KZ0A 4I2XA 4LEXL 5IB4A 4JN1H 3DXAE 4LCCB 3NQKA 3TWYA 4Z0BH 5D1ZB 3WKYA 4PIBA 3RHWK 3ZXAC 5AOKA 1ZGLA 3LEVH 4FQIL 1A6WL 3AM8C 3U9PH 1MJ7H 1W9XA 2PWFA 1Y6KR 2OL3H 3ZYJA 2PO6D 3H9HB 3EJPA 4GAAA 4W6YB 1NC4B 4XH2A 4M6MH 3QUXB 4G7YH 3NP4A 1U30A 2FR4A 3OC8A 3GNMH 4KMTH 5DJ2A 5G5DA 3IJYB 3GT6A 4PYGA 5FYLL 4GT0A 1Q9WB 1BZEA 2OMXA 4CBZA 2Q10A 1BGXL 5CCJA 3UJJH 1KFAL 1PX8A 5TK2A 6FABL 3N40P 3V0WL 4ZJ9A 1MELA 3DK0A 2LTQC 1U8CB 1MIMH 4JFEE 4NN7C 4HS3A 4H0GA 1Q0YL 2XX0A 4N85A 5A3IC 2ZX5A 5JHLA 3SE6A 1E40A 2AK1L 1FNFA 1L0PA 2X3CA 3WI9A 2EH7L 3ARTA 3OZKA 4QRQB 1IBZA 3A4EA 2WCPA 3AU0A 5M95B 4JG5A 3UACA 3OMIB 2FGZA 2OCJA 3RWGB 5J13B 1IVTA 2ZX6A 2DQDL 2YK1L 4BHUI 3FB6A 1UKTA 2WLLA 1ZHNB 4H0IA 1RZJH 2C1OB 1JHTB 1NCUA 1ACXA 1NGQH 1QLEH 4C4KO 1H8NA 1J05B 1SLUA 3F7QA 2O5YH 2R9HC 3DVGB 3E9UA 3IGFA 4GINA 2R2HB 4PW4A 4WEMB 5DS1A 4WWPA 3P54A 2RD0A 1LDPL 3ETTA 2DEYX 2X7LA 1Y7VA 3CSYB 2B9BA 5D2NC 4OV6F 1RFDL 2APSA 4PB9L 4G8FB 3I84A 4QT5B 1CXHA 4LBEA 3VXMA 5B1CA 1G87A 2P8MB 1MCFA 3HIZA 3Q01A 4PS7A 4JZJB 5CCGE 3RB5A 4YHZL 2IOOA 5DJZA 3UBFA 3CX5J 4PBVC 3O8XB 4LKCA 5CD3B 4B9KC 4NJAL 5CJ8A 3PWUB 4WWKC 2O61A 3CZEA 4XNYH 4AYBA 2EXYD 2FWOA 4R8WH 5CCHE 4M7JH 4A6YA 5E4EB 4AVKA 4G7VL 2OMUB 3SGKC 4JO3H 1B9KA 2O26U 3TJEH 4YSRA 5F3FA 2VN5A 5IQNA 2BVOB 4IJ3C 3EOAB 3KXFA 2PO6B 3ALWA 3RL2A 4L9LB 3HCVB 4B97A 6TAAA 2Z7ZA 2ALWA 4ODTH 5IG7B 5AKVA 5HGAB 4DN4L 5I1GH 5C6TH 2DQHH 3IFNL 3PAYA 1CI3M 3FTZA 4JPIB 5EZOH 3F85A 1A7OH 1OIOA 3BVXA 1EDQA 3WIHA 1AE6H 1GC1H 4TPRH 2AV1A 2JJTA 3QPQD 1FLTX 3R4DA 4NQDA 1YMHB 5HYSB 1PZCA 5F9OH 1N59A 3DHJA 4YMPA 3BAKA 5T3XE 3NJJA 1CFSB 4PJ8A 3ULUC 3EOTH 2VERA 4EZKA 3DV4B 4UYPA 2XWJB 1YPZE 1UOWA 2I60H 1JVKA 5EFIA 1ZS8A 1CGYA 1I1YA 2X6VA 3ATBA 1SEBB 1VB9A 2PCPA 1NUNB 3I0WA 2CRYA 5HD8C 1Q9OB 3P77A 3NSFA 1SBBA 2ITCA 3L48A 4FTDA 2VDRB 3HJEA 4HK0B 1JZEA 3UTTD 4B7IA 2YGNA 1CT8A 2AVFA 3K2UL 4QDGA 5LXVA 2ZUTA 4QRUA 2VXVH 2I5WA 5HYJE 4G8IB 1OW0A 1WCQA 2ZP9A 5HI3D 2XHIA 1QLFB 4D7QA 1V5JA 3CUPB 3HKZA 3HVDA 4KKBC 5EUKA 5I2IA 2VISA 1XCWA 4RAUA 2HT2D 5DHYA 1DVUA 1H19A 2X1XR 3DA0A 3I6KA 4A2EA 5J11B 5DZLA 2VQ4A 3C5ZD 1VTLE 4JPKL 5GZOA 3K8KA 3JTSB 5F88A 1N3AA 2DBJA 3HZMA 2A9NL 4MX7A 3BN9C 4DOHE 4WY7H 3TEXA 2E4FA 1GGBH 3N9GL 5DQDH 4YX2H 3IDJA 5D6DC 3N0AA 1QTPA 4W9ZA 2GHZA 3IBEA 4FQHB 1VOKA 4JCMA 1L0YA 3TT3L 1CGVA 5IFAH 1S7VA 3DWTA 3L3HB 3CFMA 1E90A 5ID0B 2PW1A 3OSTA 2Z31A 5MHSE 3L5XH 2NY2B 4N1HB 4O02B 3KGRA 4EN3A 3T2PA 5DRNA 1YEHL 2K70A 3ZTJG 4NZUH 1T7VA 4MCNA 3VJ6B 3FT3A 3PABA 1KJ2B 4L5FH 4QGYA 3LB6C 1DBAH 4ZXBD 3NFNA 4QCIA 3HFML 1NOLA 1SJMA 4YSOA 1QZNA 4X7CC 3CFKB 1DVYA 1AY1L 3L1GA 1AQKH 1FHNA 1DHKA 2FCBA 2V2TB 4P23A 3NIDB 2W0KA 1CL7I 4FHBD 1MZZA 2BNQA 1A6VH 4HX1A 4KWUA 5KZCD 2AJYH 5DMGC 1U8KB 5JW4M 3DARA 1KV3A 1NDMA 4TOYH 3PP3H 1KYUA 1P4IH 5AB9A 4GLRH 1WFOA 2QSQA 4LLUB 1HCZA 1C8QA 4FA8A 1E4XH 3FTYA 2KZWA 4G9FE 4TNVK 1J5OH 3BIKA 1CDWA 2HZHA 2BFVL 3WFDL 3Q8CA 4Z3JA 3DX8B 3NZ8A 4IOFC 4PRDA 4AKQA 5GGSY 4JDEA 4ZD3H 3M6DA 3VD7A 3O2DA 5DUJA 2YRPA 1T2QH 1NMBL 1AIZA 1ES0B 1SJVA 4UDUB 3N1MC 4R96B 3U7AA 3GPEA 4NZDA 4Y2DB 3OJDA 3OKKA 3MUUA 5ABDE 5JOPE 2E6JA 1RU9H 3I9GH 4ZW3A 1ZGLM 4Q9RH 1WBYA 4B95C 1ZT1B 2AP2A 3MV01 4WHTB 3FQXA 4NUPA 4PS4L 3VWJA 1J5CA 4BFRA 4PR5A 2BVQA 1SXAA 4MA1B 3WIFA 4Y19E 3I9PA 3UAJA 5IB1B 3IGKA 2HJKA 3WGUB 3LS4L 4FULA 1SDAB 4UT9A 4NNPL 3VA2C 4RWYL 4FMKA 4DAGH 1D7DA 3S4SG 4QO1B 3W38A 5F7LB 2W65B 5IMMB 2BVPB 3K1DA 1BX2A 3S96B 3OSVA 3WOVA 1KFQA 3S36H 4KHXL 3QCUH 4LSPL 1BLIA 1OSPL 1XGUB 1KENL 1NOFA 2YAFA 4G43A 5KJRL 4RGNE 1IGFH 4LK4A 2PTTB 3HN3A 1EWHA 4TSCL 1WIPA 2FD6L 2FEEL 1IEBB 5HDOA 3VGAB 4J3OG 3P73A 1JV5B 2YAPA 4KI5D 1LD9A 3EJSA 5GZNA 2AJ3B 4N0UE 3TBVA 2DIAA 4Y9GA 5BUAA 1OAKH 4HGWB 4ZXBB 4R7DA 1JP5A 2GJZA 3LH9A 1TJHL 3DURB 3AG3B 4MNQE 4Y4KA 3KVQA 3QIBC 1HH6B 4LLYB 1PD6A 1QVOB 2W1NA 1ERNA 3C08H 4QLRA 4YLBA 3UABA 4JFHD 5B7EA 2E9JA 1M7IA 3DLQR 3FTGB 2XI9A 5EEYA 4HS8L 4LT7A 1NGQL 2UX6A 2ZG3A 4GRLA 2X4RA 1CD8A 1JWSA 3EG9B 3LMJH 4LOEA 4GW1A 5I16A 1RULH 3JWOC 4UOW0 3OGCA 2K6WA 2OLDA 3QDHA 5E6YA 2A5UA 5KN5A 3MLPA 1NBYB 4XPGH 5KSUA 4EN2A 5GJSH 2GSGA 4XPTH 3MOQA 4A2FA 4DEPC 3KR3H 2EO1A 4N28A 5C86A 3KVPA 5CILL 2HKFH 3ZL2A 4P3CL 4L2YA 2IBBA 2VRKA 4AITA 4Y16D 5AOZA 2C1PA 3EHBD 3B5TA 5LAPA 4NQXA 5GISL 4C58B 2DMHA 4L8CA 3APCA 4EAGA 1N39A 4PRHE 3AROA 2Y72A 1A22B 4OD2B 5JHAA 3DO7A 5DS8B 1EJOH 4LAQH 3IDUA 1E9PB 3MHZA 4HFUH 4HUCA 3X13B 2OYPA 1ZPLA 5IK3B 2DQHL 4BXVA 3EDEA 3VTAA 3OC3C 2FQFA 5CHNA 2D31B 4K94L 4CADA 1YNTA 1QNZL 4Q52A 4NKIH 1CFNB 4CJ1A 2CAKA 3N85H 4PG2A 1E3ZA 1TEGA 2K6YA 1VEPA 2DICA 4TUKL 5I8OH 1IC4L 1ORSA 2A0LC 4IQHA 4N4YB 5TGBA 5F9OL 1YQ2A 1MFCH 5KWYC 5CP7A 2D7NA 4ANKA 3MFGB 1P9MA 2FQGA 4IRSD 1ONQA 3QUZD 4J3OH 4M4RA 3SDAD 3E2HC 2DQFA 1KEML 1H3GA 2W60A 2XETA 3G6AB 4KH2A 3FO1A 3BWUC 1KY6A 3L4VA 3PHAA 3PWLB 3DNKA 5MERA 3LN4A 3UC2A 3P0VL 1XGZA 2VL5B 1I3RA 1BZ9A 1FZKA 3MLWH 1TYEB 3IMTA 4RDBA 4Y4HC 1YMME 3B3IB 3LZQA 3QRGL 2WO2B 4AUJA 2YQGA 3AREA 1U42A 2DYRB 3KAAA 1CBJA 5E2VL 4R90H 3S34L 1WFTA 4DNLA 2WN3A 4PGZA 3DPTA 2VXVL 2Q87A 2BIOA 2ETWA 2HTKD 3TL5A 1CYWA 4W4OC 4GI9A 2OI9B 4BCXA 4AL8C 5EC1B 4WGVB 5EEVA 3GS4A 2YN5A 1F3RB 2LU4A 2Y6SC 1J1PH 2YA3A 3R06B 4HIEB 4KQ3H 4YR6B 3M46A 3UERA 1A4KB 3VNZA 3T4AC 3EYUH 1DE4B 4N0FB 1J5DA 5IQMA 3NH7H 3TJPA 1FL6B 1GW6A 3QO0B 2CKBH 4QRBA 5B39A 4YX2L 3GSUA 4XI5D 4PRBB 1I9JH 3L3JB 4F8LA 1TJGL 1YUKB 2OQJA 3KLQA 4NM4L 3GIVA 4URTB 6PCYA 4EDXB 3ASWA 3HAEH 4Y16B 3T6XA 4JQXC 2KLTA 3BKQX 1YYLH 3EHBB 4OIIL 1A8ZA 2XA8H 1QAWA 1L7IL 2NXYB 2HVBA 5GS2D 4MB5A 3Q13A 43CAB 3OCIA 1WVZA 3L5XL 2MPVA 4TM9A 5F1IA 3TBYA 4ZX3A 4NZJA 1WA0X 2Y4SA 3MV7E 3STBA 4GSDH 1MQ8A 2JKTM 3FU5A 4P4KD 5DJDB 2EE0A 2B9AA 2V9QA 1DANU 5GGTA 5KSAD 2PWHA 5I71B 5I18H 2X4UB 1WFMA 2ZUQC 4L5FL 1A4CA 1DBAL 4YO0A 1EO8L 5CGYC 4J4PC 5C9JA 5DHVA 3JQOB 3OG6B 1D5XB 5T1LB 1EDHA 3WIIL 4YHIB 2IWFA 1JGUL 4OCYL 3L3OB 3B37A 5T1MA 3CBJB 2B59B 2QBWA 4UV7H 4GKLA 3QUZB 4IRSB 1JNHA 4TVPL 1DIZA 1IC7H 2JELH 3ISWA 1ZAGA 4RAVA 1XV8A 3MKKA 3ZTEA 5J1AB 1DBMH 5E2TL 3AWEA 2BHZA 3PWPD 1RL1A 2AK4D 3OZLA 2E4TA 4LRNH 4NN6B 3WJJC 2R1XA 2A6KA 5F1SA 1IRAY 4R0LA 5HDLA 3W39B 1P7KA 4FZ8L 1IGTA 5I19L 4PTUB 2P5WA 5EOTA 4I9WD 1YEIL 3IJHA 3L1OH 2QKIA 1T2QL 3V0IA 1UWFA 4ZPTA 4WFGD 2COQA 4XOAA 4FNLL 1Q72H 4TUUA 4QR7A 1W0WB 3AZUA 1UATA 3UCRA 1KIQB 4RFEA 4FFWD 3T0BA 4DT2A 1A6ZB 1RU9L 3I9GL 3SKUD 3K6DA 4MLSA 1UM6L 4I0KA 2Z8UA 1ZSDB 4I9XA 4GAJL 4LLQB 1CDBA 4ZX5A 4LF3B 3W82A 3D1MC 2VDLH 2NY5C 1KUMA 1D2PA 2QQNH 2F19L 3C09B 3X3GL 4AYFA 3DHMA 4ZPVA 2O6PA 3FL7A 4FFVD 1HHJB 3FFCB 2WLIB 3G7TA 1N64L 2A1WL 4PJBB 4F8NA 3UZQB 5IW6B 4ZO7A 2WTPA 1MHEA 3VFOA 4A7SA 3FUKA 3AM8A 2NTFA 4ANUA 4FZEL 3HPLB 3QXUA 3TYGH 1LHZA 2H32H 3MNWA 3HC2A 5AW2B 5AAWC 4WUUE 32C2B 2BO0A 3B5GA 1JWMB 2H8PA 5IMOA 2V17L 5A40E 5KSBE 4ZMYA 1SHXA 2WC7A 3O4LA 4P4KB 5LQBH 5SV3A 5T1KD 3SEPA 5KSAB 2NRDA 4JO5A 4PGCB 1HS6A 1I8LC 4OGAC 3JV4A 4OCNC 1THCA 1E8XA 2ZOKB 3QT2A 2WWMC 5DMIH 1GKOA 3FUEA 5J12C 3X2QB 3VXRA 3ZKNC 3PUUA 1H6EA 2D2CC 2XPYA 3UO1L 1FC2D 3Q8FA 3MRHB 1A7PL 1J8SA 2ZSVB 3K71B 1GSKA 5D1XE 3GEFA 3MMEA 3QFGA 3PWPB 4ZFOL 2AK4B 3QC6X 5D93B 1EUVA 3IJSB 1PSKL 1NCNA 1KYOJ 2CLZA 3BH9B 4HIPA 3EUDA 2PN5A 4L37A 4XPGL 4YIQB 3K6IA 5FM4A 4JQVA 3WKPA 4D9LL 5BMFL 4LBAA 2G2NA 4I48A 3C2AH 4JE4B 3MV8D 1XR8A 4LDLB 3W0WA 4ENED 1NCIA 1ETA1 3TF4A 2R7EB 2OMWA 4R7NA 1MFAH 3LQAC 5CWSA 3JWNH 2LU3A 3EJJX 5DWUL 1MVYA 1T1WA 2JI3A 3QIWD 4GXVL 1WBZB 5D2NA 1MI5D 4ZO6A 1V3LA 1JZ5A 5TE6H 4CSZA 1MNUH 4GW5B 1DQJA 4UNIA 5TF1L 2R2CA 1L6XA 1U91B 1SF3A 1VFAA 5F7NC 1OT2A 1WUZA 4HJ0D 4X5WA 1Q0XL 4HAFA 4NKMB 3MNVA 3SKMB 4Y4FA 4HYTB 3QUHA 3MROA 1OSZB 4PQXA 4HCGA 1M9WA 3BUYB 1MXDA 5A1AA 1ZT7B 4MJ6A 2H1PL 5BRZA 4DGIH 3SYPA 4PSPA 1RJZA 1KIUB 2RQEA 3ZDYB 3VFMB 4E9TA 3SGKA 3IKKA 1DUZB 1H15B 2B4CL 3FU3A 4S0SD 5D4QA 4PJXB 5I8OL 3AITA 1T7XA 5GRWA 1K5NB 4BFBD 4LVOB 5DDHA 4ZTEA 4FFTA 2C4FU 1FN4B 1TYRA 5G2NA 5ACZA 1YEDA 3HPJB 4PJGF 4UMSA 4WJ5A 4F33B 4LPYA 4UYQA 1N4XL 4D0DA 3DOSA 5IB2B 1UXWA 3CCHA 2YLHA 1SF5A 5GS1B 4N6RA 5T1KB 4YPGA 2IWGA 3KPNB 4BFIB 4LIQH 3QEQD 3DX6A 4MMYA 4HEPA 3WHXA 5I30H 3FQ2A 5DHVH 5I8KH 2WLNA 4N2OA 3T1FB 3ABLB 4CN4A 3N44F 3A3YB 4DULA 2NQDA 5MEPB 5HJBA 3AGVA 4J2QA 3JYBA 3DRQA 3TTYA 2NY7L 4WW2A 3KYNB 2XWZA 3CNKA 5GGRY 3BDXA 3G5ZA 3V4VB 4IGBD 1AGDB 3KLDA 2BC4A 3P69A 4PWKA 3UTQA 2P8LA 4XTRD 1UA7A 4XVUC 2QVKA 3ABGA 1PZ3A 1ESOA 3CVCA 3LPGA 2JB5H 1KPRA 3CZJA 4RMRA 4UILH 2OTWA 4DVRL 5EF1A 5EOQL 3LJ3A 4XMVA 2CKBL 4KITB 1VHPA 3E3QE 2W9DL 3JWDC 2XZQH 3PIQA 3IAGC 3EJCA 3MV8B 3RL1A 3GS7A 4IU3A 3RY6C 3W11D 3VU1A 3UL4A 4JRFA 5AEAA 2I9LA 2VDPL 4OCWL 3IKCB 3N50A 3FT4B 3GBNL 1RUQH 4S11A 3B56A 3BKYH 4B9PA 3QIWB 1NGWB 2GAZA 2NDFA 1EXHA 2OR9L 1P0SE 1LMIA 1WGVA 1VIWA 2KL6A 2Y5EA 5JHDD 2X1QA 4CU8A 3FCGA 5EBWA 2ICCA 3EH5B 3Q43A 2AXWA 4B7LA 3MA7B 5D6DA 5IHBA 4NI6A 5CLXA 3JUYA 2EYTA 2XY2A 5KBKA 5K93A 3FU6A 3K6NA 2Y7OA 1BJ8A 1C16A 2RAMA 3C60C 1A0QL 5DT1L 5LAXA 2D3NA 2P42B 4R4FL 3I75B 3O11A 5EPMB 2WQAA 1ORQB 4XBMA 4F9LC 2NUPB 4JDZA 4OGQC 1J0ZA 4KNQA 1R5VA 3FN3A 1F90H 5MENE 2PXYA 2PP9A 5ADOL 1K8IB 3S9DB 1E8WA 1XAKA 2LU7A 4B5ZA 5I6OA 4QHPA 2DQ6A 4BIKA 2OMBA 1DBML 3GSWA 3GJFB 2J72A 3TOPA 1MFEL 2IOIA 1TU2B 3QWOA 1OOWA 3QEQB 3DI2B 1HINL 1IBGH 1QFWL 3V6OC 2YEQA 1E4XI 3SCMD 2Q9OA 3WSQL 3SDDD 3VXUA 3KZ8A 1A6AA 4U6YA 3B9AA 3GD1C 4HJHA 4X8JA 1FZOA 4ORGA 1JAEA 4NZRH 1A4BA 2N7SA 2NOEA 4GMSH 4HSQA 4MHHG 3LD8B 2HB0A 4JDVB 3QJSB 5HHOD 2E7DA 5C07D 4I8OA 4IGBB 4HULB 1AC0A 2QQLL 3QQDB 4H8WL 4QTHB 2VO8A 5FUOL 2YFNA 1JZFA 3VWKD 1BZ7A 1YQRA 1OAZL 2GUYA 3TA3C 3UYRL 2J1XA 1PKQE 3MOAH 3BP5B 3DX0A 4MXVF 4C54A 4JJHA 3V0EA 1SNRA 5JXED 4JHWH 5E5UB 1KYAA 1BWMA 4KO5A 4F24A 3T71A 1DYZA 4NC2B 1R17A 4S1DC 5JIKA 5ITBL 4QXGL 1Q0EA 3HG5A 3MV9E 1S7QB 2HN7B 4Z78B 4NHCH 4JFXA 4QF1B 3UG4A 1X7QB 3PDOA 1AGBB 3K74B 3ARGD 5JHDB 3PGFL 4G6KL 1R3LA 4YWGL 4JFQA 5IOPA 2J6EL 3UZVA 1CTNA 2DIEA 3IT8D 4PS3A 5IM7B 4JREB 5FYJL 1IJ9A 4OD3H 5IVXA 5E9DD 5ILTH 1QFPA 2B2XL 4LEOB 3IETB 2K9FB 3VFTB 3D05A 2ADJB 2BRRL 1JXDA 4N5UA 1H6FA 2R0KL 2NOIA 2B1OA 3WY3A 3FU9A 3GBEA 1SYVB 1AFVL 1PY4A 3BSHA 1OE3A 4UAOC 4YK4C 4E9QA 3I50H 2JMRA 2R2EB 3CN4A 5C0RH 1M5Q1 2C9AA 2JNZA 4E9SA 3A4DA 4XAWL 1M3QA 2D7PA 2J5WA 1S9WA 5TDPB 4C4KT 2PMZA 1NEPA 3DYOA 1UGKA 3OH6A 5H4YA 3RTLA 3G04A 2KMWA 4H88L 3QIBA 2WWKO 4PGJA 2DY2A 4JRYD 1MCLA 5DRZB 3UBXA 3SCMB 1FDLH 5ICYA 1PW3A 1M6UA 2WO3B 1XGYH 3F7LA 4F91B 4FQCH 4EVNB 5I1IL 4IL8A 4G6ML 1RZFL 5IVNA 3K6SA 2QSCH 3KPLA 4U3SA 3ULUH 4LHQB 2ITDB 1BFOB 1EXUB 4RH4A 4NX0A 1O6VA 1PMYA 5IBUB 3P9LB 1JNJA 5HHOB 1BM3L 1B0WA 5D70H 2LAEA 4RODB 4F57H 3NJIA 1H8OA 2WLKA 2OZ4H 1FZJA 5TE6L 4ELKB 4PJ5A 4EUPG 3MRKB 3G5XB 4HSCX 5GQBA 4MJ5B 4XMUA 5DJXB 5L7XL 2CHNA 3QZWG 3TBSB 1GR7A 3Q5YA 2BSRA 1UXSB 4IKNA 4BSVB 1A1MA 4JY4A 5E8NA 3SQBB 2ZCKH 4AQEA 1NPJA 3AXLB 4LPTA 4YQXL 1ZA6B 3CDYA 1UD4A 4WFHE 3ILDA 2GFBB 3HRZB 1QNBA 4KNTA 1J10A 2XFXA 3N5AA 3S0PA 2BCKB 2XG4A 1GGYA 1X5XA 1F42A 4FQLL 1I8MA 1WCBA 3V7AE 1IGIH 1SMOA 2HLFC 1J86A 1DVFD 1X5FA 2AI0H 1MCPL 2Y24A 5ESVA 4MWFB 4UB0H 4QHLB 1JGVH 3QNYA 4ANWA 3PGDA 1CN4A 2V2WB 4EJZA 1O7DE 3I02A 4P57A 3CWUA 3F5WA 4POZD 5HI4D 2HX7A 4LIQL 1CK0H 5E9DB 2HCZX 3RJOA 4PJGE 3CWSA 2DQEL 3U30B 1G7QA 4L3AA 3EGDB 2DIBA 5I8KL 3SHSA 1P84K 5DA4A 4E41D 2VDNL 4L1TA 4XBGB 1YTFA 3IDNA 2VM4A 4Y5YC 2X4TA 4PJAA 5K69A 2WXPA 3SDCC 1CR9H 4UNUA 3AABA 2IPUK 4YHYC 1PZ5A 4DP6X 3AACA 1WK0A 4P06A 2Z91A 3WNIA 1CXLA 1PQZA 4X0NA 3EIFA 2QRDA 3UTZB 4K73A 1LK3H 3FNKA 4KI1A 3KL5A 5FAAA 4D8OA 3WFHB 4OLWL 1PIFA 1A4JA 2Y7QA 2CR6A 5FV2A 3VDBA 4EE2A 1RUAH 3ETBF 4M5ZL 1F00I 3KE0A 5E4OA 1S7UB 4ZUUB 3H54A 4MTMA 1DQKA 4X99B 5IROC 4D7BA 5KYWA 3T4AA 5EHFA 5GGSA 3TZVC 5CD5C 4JMNA 2ZUYA 4JHUA 5CN3A 2QLVA 1V10A 2J44A 4QUOA 1GIGH 5DD1L 1X9RA 1WF5A 5LB1A 2BFGA 3QDJD 1XH1A 4ONOA 3GI8H 5MEQA 3WKML 3MJ9L 4EAIA 4LSRH 2IALA 3PQYD 4ZBJA 1WISA 3VXSE 4GG6A 2Q1EA 3K6FA 1TJXA 3QCVL 4D7RA 4U31A 5HPMB 3R4RA 1BQLH 3DOHA 2UYLB 5BCAA 5IB5A 3HI6L 3QZNA 1HQRB 1KY7A 4JHAH 4AGLA 2Z92A 1F90L 2NQ3A 3J8F7 1F6LL 1VENA 2GPZA 3VSVA 5D7JD 1DVFB 1H3VA 4HGMA 4BFFA 4AH2A 3OKOB 1KJMA 2EZ0D 2F9BT 3D8MA 1JXJA 4M1GL 2EXWD 3LEXB 4XC1L 3W9DB 2FUTA 2DLGA 2XTSA 1ASPA 1Z3RA 1C1EH 3ARFC 2Y3NA 4N90E 5DRWA 5ID1A 4FXGB 4L8SA 4PCSA 4CU7A 4E41B 5I1HH 3D7QA 4AZUA 3H3BC 2FJGB 1GS6X 1XGTB 4NQUA 1VFMA 3OMZA 3A24A 3DOIA 3MRFB 5A2JH 3G5YA 3RDTC 3RAJH 1AR1D 3QFDB 4KKLC 4FNQA 5JPNB 3FTWA 4QHUA 2BY1A 1O5DT 4XN7A 1LTXA 3GBDA 4I18B 4J23A 2YN3A 2UZPA 2OL3B 3HUJA 2ZAHA 3E6FB 4U1NB 2H6PB 3AXHA 1A9EB 4JS7A 4APQC 4L1BA 4X4ZA 4M43H 1BLNB 1ZHKB 4Q7DA 1AZBA 1DFBH 4V33A 3SNSA 3FO0L 1HSAB 1ODUA 1RI8A 3CXDH 3K3QA 4Z7OF 4NM8H 2DMCA 2JK5B 3FOLA 1TETL 4FQ1H 1TZ8A 1NMCB 2NQCA 2V5RA 4ODXA 5CMAB 1DBBH 4XVSH 4MXVE 5I5JA 4U7MA 4CL7A 1HT6A 4K8RC 4P5KA 4TVSa 5I8EB 1AJ7H 1HSBB 3O6FC 5J7CC 5EA0L 3AMKA 3MJGX 5L8JB 4TQIA 3SKOB 4H26B 1ANUA 2DWYA 1UB5A 3SQOH 5FCSH 2WOYA 3WEBA 1XH3B 4OLXH 4PRPA 2HTLD 3V0AC 4UI2A 5DHDA 4PJHF 4MB1A 4XWGL 1B6DA 1FNEB 3PQYB 5HYQA 2PYEA 1MCBA 2CWRA 4HUVA 1UWEH 2J2ZB 1QW8A 3O2VH 3CSBA 2XWTB 1RZ8B 3QARA 3KPOB 4RMVA 3QHZL 1J48A 3OHXB 4JKKA 8PAZA 5FO9B 5I1KL 5TE4H 3FRPB 1HC1A 1XR9A 4HUNB 4MDJA 5AAWA 1DJIA 5DQJA 1U92A 2HFGL 2UXGA 2FJSA 4NQVA 4ODSH 3RWFA 2I9TB 2EIBA 5D7JB 4JM2D 3KBEA 3KYKL 1CICC 4PV9A 4ZMPA 3VDCA 1GGIH 4LGPB 3RUGB 4P2QD 4RGNC 5EZLB 1EERB 1QATA 5DF0A 4QWWC 4HUMB 3DO4A 3PL6A 4G1MA 5CBAA 3NJVA 4CC4C 5BJTB 3U0WH 1YY8A 1PVHA 3IJEB 3H3PL 4FEMA 3HLAB 1L9SA 4PJ6A 3MDJA 3THML 1OEZW 3PPSA 3CU7A 1CFQB 2QSCL 3KGSA 2X89D 1BZ8A 4BKTC 1I1RA 2H2SD 1AR1B 4X4YA 1GCFA 2WQWA 3MXWH 3MLSL 1NEZG 2GK0B 3BP6B 3RGVD 4KTGA 5DYFA 2J56A 1BOYA 3SPHA 1B2WH 4KMQA 5FPIA 3ZR6A 1WP6A 4NJ9H 3WS6C 4CC0A 2B08A 3ABKB 4ZTPH 5ANME 3OJ2C 4MA7H 3TS8A 4QRRA 1TEYA 1BZDA 3FQWB 4XXWC 1KCSH 5CEYB 3SB3A 3GQFA 2E47A 1U8QB 3RGHA 4N1CA 12E8H 1PVSA 1Q9UA 1DBJH 1FSKB 2JF1A 2IFGA 3ZGIA 5FA3B 4XMZA 1UB6B 1OTUC 1PEZA 1QASA 1T03H 1MQKH 1I53A 5E94B 2YA0A 3BKCL 2PNDA 4CBPA 3FFCE 8FABA 4OCLC 3MLYL 4GBXA 4XHJD 5GRJH 2ZXCA 1AHWB 1RMFH 2PPAA 4G3YL 1I1FA 5IZ7A 3DVNB 2WB1A 4IRZH 2HVJB 5A6MA 3KWVA 4LHUG 5E6ZA 4Q6KA 2DWDA 2R51A 3QJQB 1IT9H 3GC3A 3LSOA 1N5AA 4XZUB 5JDSB 4XNZB 3C87A 2HVKB 3TH2T 3ULVL 5GJTL 5KJ7E 5LJYH 4KAQL 3FQYA 4KHTH 4PP1C 3V2AR 3LXBA 1I8AA 3GPSA 4FTVD 4M9OA 3BE1L 3S5LA 4L0YA 4JFDE 3GTTA 1GW0A 2HX9A 2CG9X 2Y06L 4NCC2 1G5GA 5JPMC 4ZFGH 2Q6WA 3D9AL 4K7PH 2IH1A 1AGEB 3WJMA 1HJCA 3WE1A 3POCA 1A7QH 2Z93B 4HKJA 2ZOLA 4N0RA 1AD0B 4XNQA 5F1OB 3RZCA 3QEGH 4C83A 1HNFA 3LRMA 1KLUA 1UH3A 4P2QB 3NRFA 3KH4A 1HN1A 35C8L 4IK7A 5E8DH 1VESA 3P1VA 3TPKA 1C08B 3KCPA 2FT8A 4CMHB 5BXFB 1HFUA 2ZZUT 4WO4B 2R2BA 3EO1A 1DEEA 4NQSB 4R26H 1H3WM 1OB1B 2WKLA 5ERWA 5B1AB 2YD9A 1DQVA 1YNKH 4YBQD 1NBZB 4OY9A 5DUML 2X4PA 1A6TB 5KVGH 2Y7SA 4KROB 5DR5L 1V3JA 4RBPK 1R3JB 3RGVB 1OM9A 1LQSR 4FMVA 1UA6L 2BXYA 1ICTA 1MY5A 5GRVL 1HYSD 2C9SA 3CZUB 3N1GC 1E5AA 1CBVH 1J0IA 2VSMB 2A38A 3D2UA 1IGCH 2PF6A 4HAGA 3GI8L 5IQOA 4ZQTA 1BVLA 4L4VA 3RY6A 5CFHA 3QUYC 2QVIA 1BXAA 1BQKA 4HCRA 1KCWA 1MHPH 1S7RA 4OF8A 3T2NH 2QVFB 3F7KA 2CO4A 3R0NA 4LCUA 3RTQD 3JTBA 4NKOA 4OLZL 1I7TB 3DHPA 1UM4L 3N42B 3LH8A 2G9HB 4AEHH 1MRFL 3CX5K 2MNJB 1BOGA 2NY5H 3J07A 3BWZA 2NNAB 1WBXA 4HDIB 2CDGB 2O5XH 4N1EA 1CO1A 2HT4D 2VLMD 4LVEA 4CW1A 4JY5H 3GMNB 3ZQXA 2EADA 1OCCB 4JG0L 1Z3GH 1CLOL 5KVDL 1J8HA 1G9MC 1J1OL 4FTVB 4NBYB 2MCPH 3KLHC 4JFDA 4LB8A 2XPGB 4K3JH 3NJFA 3PJSB 4U1KA 1OAUL 3BZ4B 3VFWA 5D9SA 4BRVA 4YOKA 4AQ8A 1NCCH 2M26A 3C6LD 3ECVA 2I24N 2HT3D 3CXFA 3ZKXC 3WEXA 3D50A 5D7LA 2NR6D 3GRBA 3FSVA 2F53E 4WTXA 4HH9A 2ZE0A 5AWNH 1C5CL 2OKMA 4LQFH 4PB0H 4KZEL 4J2XA 2E76C 4WJG3 3GI9H 2CD0A 1T83C 1VFBA 4UQBA 1B0IA 5HHQB 3CXDL 3LEYL 5EN3A 1CF8H 1Q9LB 3T8XA 2VR9A 3C2SA 4KV5F 3NSCA 5K59F 4NO3A 2J8HA 4LLDB 2JJSA 2IDUA 4XVSL 4HWZA 2I69A 2NY4C 4KOBA 1P5UB 2JI2A 1W0YT 4Z7OE 5I0YA 5TQ0H 1OTSC 3LXUX 1DVQA 4ZDHB 1N5YL 4J3OD 4C56D 1PYWB 1HIMH 2Y7LA 3TEWA 3GMRB 4FQXA 3IFLL 1J9QA 3II3A 1B0RB 2EIMB 1BQSA 4LCWA 3WN5C 1TJMA 3D6GA 1U2CA 4UAHA 5MI0B 4HKBB 4D0CA 3LQAH 3OKMA 3NN8B 2ADIB 1MUJB 4R3SB 5ESQB 4GKSA 3HHRB 4KJWD 1DDTA 1UWXK 3HC4L 4Z7VF 2X9XA 5DO2C 3QFJD 4PJHE 4BUHA 3RA7H 3RILA 2BJMH 1XIWC 2D0HA 4PJ9A 5D6CA 4LP8A 4D8PA 4DN3H 2QMJA 4OZGA 5D96C 2WQSA 3GXDA 2EDKA 2CRZA 3IJ8A 4P49A 3BP4A 1TMCB 1I4FA 4ZSOA 1BVKB 4ONGH 2IQAA 3FT1A 2YAOA 3DUHA 4OJFL 3BAEL 4ZUSB 3WXVH 4QRPD 3GRWL 1I8IA 2HFFB 1HQ4A 3VRIA 4PRIA 4G6AC 3QXWA 5FGBA 3HBZA 4U1GB 2DF3A 1WD8A 3S37L 2BW4A 2NXZC 2X5PA 1ITBB 3B7TA 1IM3A 4MJID 1F4WH 1JNLL 1KTDA 4FABH 1N6QH 4JHBA 3ZMNA 3MYJA 2CRMA 3N41F 1I9EA 1OF0A 1XGRA 5DQ9A 2EYRA 2OCCB 3RVUD 5IJKC 1W6WA 4NQEE 5CAYB 2OMZA 4FYSA 3VQMA 4HS6B 5FUZL 3CDGA 1F3DH 3CFJA 1TTCA 2IADB 4KK9D 3S5ZA 1QRND 4TLKA 4MHHI 1NGXB 2G3ZA 4OUOA 4ZUWB 3RBGA 3FKUS 4Y2LA 5ICXA 3ZMEA 4NCDA 5L2KA 2Z4TA 4OZHF 4JQIA 3QAZC 5EV7A 4JFFE 3BEWA 5D1XC 4F5CE 2WYIA 3CWGA 5L88H 3PMGA 1QSFA 3BWAB 1KO9A 1MOEA 2WJ7A 4PWGA 4X6FB 3B6SB 1KCSL 5GGQH 2GBAA 1SDYA 4XWOC 2J25A 1WGOA 3DPBA 5D5MA 2WZPA 3O3BB 4JFZL 1DBJL 5FYLE 3I3EA 4OZFH 2J5LB 1PDKB 4H8PA 3WXWH 5D7IF 1JPFB 3DX1A 3QJFB 1Q9KB 5TDOB 3WTVA 2X6AA 1FYTE 4MAUL 1NSNH 3CMOL 2D7QA 5CIPH 1MWOA 2E7LC 4M5SA 4R83A 4B9JA 1ZEAH 4C56B 2WY3B 2PCFA 3T77A 3O9WC 4NZTL 3TVMC 3VFRB 5IEKB 1O7SA 4UOQA 3IAPA 3KWTA 4GUOA 1I1AD 1EZUA 3BZEA 3UPRB 4YAQB 4M6AA 5EN2A 1ED3B 4ADIA 3OF6A 5D1ZC 5AZ2H 2Y5TA 4GY4A 3SOTA 3D18B 2VKXA 1OPOA 3Q6FA 3FTVA 2R29L 3MR9A 3OAYK 2IANA 4NHUA 4WEBH 4ZS7H 2VM3A 2IPTL 2ICES 3K91A 1TZHA 2MZ8A 4OCMC 2FO4B 3QUXC 1L9NA 2CPUA 3QFJB 3PFQA 1G7MB 4KJPD 5HHNB 4ZW5A 4YHNB 2V9UA 2G2RA 4JM4L 5EU5B 2VAAA 3K0YA 3VI4B 1N2RA 1JGEB 1GHFL 2YGQA 4JFOA 4BFNA 4ADJA 1RPUA 3NABL 1W72A 3WUWA 5CUSH 4Q4IA 4QRPB 5EIIB 1FNGA 1KCRH 3HG1E 2VUKA 1IAKA 5L2JB 4ZMTA 5C0IA 2CKBB 3EOBA 2Z1KA 5K9KA 2ORBH 3V5KB 4OTXL 4D0BB 4HV8B 3I74A 4MJIB 4LL4A 2FH6A 1FYHB 1ZWIA 2ARJB 4H7VA 1FP5A 1JHLH 2VDPB 4PJFF 4U2YA 4UTBL 4PBWD 2Z65C 4TMPA 1Z66A 1G7LA 1QRNB 4PJCF 4DFHA 4NZFA 3ZO0A 1R24A 1WHOA 4F15C 3GUFA 3BOVA 5J13C 4IS6A 5DZAA 1KZYA 1AGFB 3WFCL 2NX5D 1CE6B 5LO7A 1TBAB 5FB8B 1UZ8B 2DKMA 2ZWSA 1QNEA 2WINA 5E1QA 1AC6A 1GYVA 3T6WA 3VG9B 4JHZA 1HOCB 2XCMC 4EZJA 5FM8A 5F0MB 5JZ7D 4UU9B 5DD6A 2K9UA 3E3QC 4EDWL 4N22A 2CMRL 4LLVB 5F2FA 4Q6YA 2A2QT 3TZVA 2XBZA 4R7XA 5DJ6A 4WK2B 1OP3K 4MDRA 3DSNA 3O8XC 4NKQB 5D7KE 5EWIL 3X1GA 3ECBA 1F8TH 2HRGA 5FEBA 1KN4L 1GMIA 1NM9A 1I1AB 5CINH 1NJ9A 1IM9B 5T5FA 4XPFH 4BQ8A 3P4MB 2O5XL 2OYKA 5AW3B 3B1TA 4I1NB 4IBTA 5E99L 1SGKA 2GJ6A 2WIIB 3NJXA 1J1XH 2EDFA 3OKLA 4JY5L 3LDBB 2PO6C 4WEUD 4FLOA 2AQ2A 4PYHA 4JN2A 3DMMC 1R5WB 3NDYE 4OSUH 2IDCA 4K3JL 3IFPA 3RNQA 2LFEA 3PPEA 4QOKA 5E5MB 1F1GA 1IGYB 2IGFH 1ID2A 3TIEB 2QGDA 3HNSL 4X80L 3J27A 3ARZA 4DVBA 3HMXL 1WEJH 1PY9A 3QDAA 4OQTA 4P99A 2BOCA 4X6BA 5TTRA 4AE0A 4N3TA 3H7BA 4K7FB 4AGOA 2A7BA 4XP1H 4AJWA 4DCQA 4GSUA 1SVZA 1ZTXH 2NY6D 4KRNA 7PCYA 3IDIB 1CWVA 3C5JB 3IS1X 3FBKA 5GGVY 3TO2A 3NSXA 1UCBL 1TCMA 2WWOA 1JCKA 5L9DH 3BUBA 3TN0D 2WXJA 3DTDA 4U7SA 3BDBA 3ECQA 3NZSA 2X9WA 3KLLA 3MRLB 1U3HB 5JW5B 1TTBA 3QZMA 4XPHH 4PH8A 3VXTA 4BSWA 5HBBA 4YHMH 4MMXC 1UXLA 5EIVA 1HNGA 2WPGA 3VE0B 1CS6A 4XP4H 4NENA 1OE2A 4KV5E 2ED6A 1U8IB 4KK8D 3T0XA 4APQA 3PWVB 5K59E 3IBOA 4PSRA 2NX5B 3KG5A 4TTDD 2YO3A 4E0RB 1MWAL 2ZPKL 5F89A 4O51A 2ATPA 3U6RB 2E59A 5CBEB 5CKAA 4Z7WB 3FF8A 2J1ZA 1TENA 1SMDA 2VN7A 3JVGC 1M3HA 4YL9A 1IC0A 4XVJH 3SGJC 2BIPA 1QW9A 4GI6A 4NAMA 4Q9BA 2ZONA 3O6FA 2UY6B 3S35L 1LK2B 2BERA 3DUUB 4LLMA 3PHQB 4S1QL 4U1MB 3L4XA 5E0FA 5E6RB 1SM3H 4F58H 2G0KA 4XP9H 2YGOA 5IVZB 5C0GB 2ROYA 3SDXB 4MMZC 4ADGA 4MQ7A 3EO9H 1IL1B 1EV2E 3NSYA 5HJ3B 4Z7VE 3RZWA 1G94A 4ONGL 2YBGA 2FZ3B 4QMEA 5LNEA 1S8DB 4G80B 1E9QB 4ELMF 4ECNA 5JIHA 3NIGB 5IOKA 3EW3B 5IT2L 4YXKH 4A63A 1U6AL 1UC6A 4KKQA 5I8CB 2O5ZH 3QWQB 2NY2C 3BQUD 2IPKB 1BD2E 4NXSA 1SYSA 1N6QL 3IGAB 1G9NL 3GZOA 4AJVA 1UT1A 2H47C 4I5BB 2UY7A 2EE2A 4EO5A 1QQDB 4XXCC 4XN1A 5C0CA 4N5ED 4G83A 3V6FB 4JB9H 1HXYA 3HVNA 1T2JA 4ERSH 3CVTA 4L3EA 1X5KA 3E9TA 3FB5A 2JHNA 4IOSD 3DYMA 4FXKA 1M6OB 2NY6B 2PPDA 3CMGA 3L3GB 4LCYA 1P2CA 2H1XA 4FDWA 2NY0C 3BSZA 5KBMA 5I1CL 1MPGA 5IQ9A 1OCZB 4OZHE 1RERA 1KGUA 3GJEA 1UWGL 5C0BA 1LEIB 1CD0A 3QG6A 3IU3A 2YFOA 1QBMH 1TOXA 3BGMB 4PD4J 4BZ1L 1RVFL 1A21A 3EZ8A 2V3DA 3MRCA 3PAZA 4YFLI 5T3XH 1JGIA 2MRYA 4JANA 2V7HB 2YAEA 1EMTH 3QORB 1EEZB 4GAYB 4Q74A 3TF7C 1P1ZA 3I6GA 4XXWA 2AZAA 1DQDH 2CUAA 5E7BA 5C0AE 4Y2DC 4K71C 1KT2B 2CHZA 2OS7A 5FFLA 2GC4C 1TO4A 2VDOL 3WFBH 2HT2C 3L4TA 4WLCA 3BP7B 2ZX9A 2YKKA 4TUJA 1WQAA 2MJ7A 3GKWH 4BFEA 2VDNB 5IYDP 1X9UA 3WTUA 5D2LF 4EJYA 2HFTA 1CQKA 4FS0A 2XTJE 3A67L 3MRJA 2JWYA 1FRGL 2FEDC 2EIZA 2C9RA 2CZNA 5IKCA 2HRPH 5KW9H 3FF7A 2Q86B 1YO4A 1MEXL 5BS0A 1QBLL 1V54B 2EILB 3G5WA 3BW9B 4IK6A 4GJTB 1GS7A 4MB4A 5CUSL 5ALCH 3H7LA 1HILB 2P49B 3LQZA 3WO4B 5A2BA 5AB0A 2ICEA 4Z9KB 4L4TA 1ROCA 4U1HA 1RCYA 5H8DA 4OM1L 4OV5A 4FD0A 1RURL 2EUWA 2VITA 1O7DC 3BQUB 3WO3B 4Q97A 1RHFA 3GK8L 1HHKA 1MCWW 4JCLA 1GZPA 4FYQA 3AXIA 4XCCL 5JPMA 2R9HD 4X4MA 5D1QE 1QA9A 2FATH 3CLFL 1X7SA 3KPRE 4U1IA 4OFYD 3L9EA 4HIXH 4UT6A 2IF7A 4CVXB 1VGKB 4ZXBC 1KEGH 2Z0UA 3CSTA 3KJ6H 1WHPA 4G72B 4HA1A 4P07A 2X2UA 1UVQA 2Q7AA 3UTSE 1O6TA 5JHLL 1P7QD 2BSSA 3MOBL 2VQ1B 2Z4QA 3H3KA 4PJFE 4QRSA 3NCYP 4AV0A 5JN5A 3Q2LA 1D5IH 1G6RA 1KCUH 3GMLA 4M7KH 5J1SC 5KSVA 2A74B 5AZEL 3T08A 3V9CA 4PJCE 1DSWA 4HC1A 4HPOH 3OGOE 2NLJB 3ASNB 1I7UA 4FQPA 1E4WL 4WWKD 4MBRA 3X14A 5LHDA 2HA1A 4OZHA 4HJGB 4K5OA 4ZFFB 4WHYG 1B4LA 3GZKA 1CGWA 2ZOOA 4WI0B 3ZZLA 1SLWA 4BGLA 2Y9RT 3HZVB 1VFUA 5JNYA 1F13A 1SDDA 1S7TA 2BP8A 3F2LA 1U33A 1Z7JA 4KXZI 3KLAA 4AT6A 2ATKA 5D7IA 5I5MA 1JFQH 2V5MA 2YPLD 1BJ1H 1XWVA 4G71B 5ES4B 4JVUA 4Q8BA 2I5YH 2Z8WC 2GY5A 2MHAA 2W07A 4V1DA 5HYFA 5K9JH 4UUJA 1P6WA 4RQQA 1TQVA 5DJCB 4K8RH 5E5LA 1J1XL 5CEZE 2X9ZA 3BX7C 5FDYA 5B39G 2N0KA 5CJOL 4Z7IA 2A99A 4FN0A 3MGTB 4OSUL 4P2RD 3T3PB 3ULUD 4A6YL 4ODVH 1EEUA 4PWHA 4U1SA 4ABWA 3GS0A 1CLZL 4OFQA 2BNRE 2ZT9C 4Y88A 1WEJL 4J3TA 1N0LA 5DK2B 5HD8D 2R0WH 1DUYA 3QYNA 3A6CH 4MFHA 4HBCH 3T6VA 5BW7C 3EYFA 4QHMB 1LP9F 3GMMB 2ITEA 1AZCA 2J88L 4FNRA 3L6FA 1A7NH 4HUUB 2VC2H 4Z3TA 4G59C 1XT5A 1MPAH 3H6JA 1HCVA 2GIYA 2Y36H 1H6TA 1AO7A 1CYXA 1BPVA 1QN4A 4KKBD 2BDNH 3ALPA 4KZDH 5DLMH 2QPFA 3CC5A 2FJHB 1XSIA 1T22B 5EZJB 1K72A 4YHML 2RJMA 3EYQD 3BVVA 1H3PL 5I24A 2DI7A 4EKXA 4TQEH 1U0QA 3IDGB 3EYOB 2CO6A 1P7QB 5CU5A 1J18A 2YXVA 4AKOA 3BN9D 4WNQA 2EVGA 2I27N 2AXFA 5FYKL 3C75A 3RWCB 1XXDC 3QDME 3FO2A 3OQ3B 4WHYH 3MUGA 3IN2A 3T0EB 2ED8A 1I7ZA 1MH5B 3HNTH 5E03A 4W9FC 1P4BH 2AXHA 1EQWA 2ZYRA 3ULVD 3V52H 2YQ2A 3Q6GL 1TCRB 3OGDA 4XVJL 4NIYE 1XDTT 4S0TD 2KUTA 2H3KA 1VACA 5FUCC 1BBJB 4P5MB 1HEZA 2FAUA 2AAAA 3V4UH 2YARA 2FBOJ 4KH9A 2L04A 3Q3GA 3FONB 4F2MB 4L3CA 3L16A 4LSSL 1SXBA 4F8TA 2A77H 4G8GD 3DUSB 1SJEA 2JTYA 1X5YA 2ZWLT 4PP2A 2OCFD 2YPKA 2YPLB 2ZX8A 3WN5A 4TVPE 3P3RA 4OFVA 5C8JA 3MJ8A 2NXYC 4YXKL 1DANT 4JO2H 3B2DC 3GDBA 3I6SA 3IFOA 2EICA 3BGFC 1HKLH 4B0MM 4IIQA 1GGUA 1D7BA 2FH8A 4J6RL 5LWYH 5DMGD 2ESVA 2DTML 4BH7A 3P40A 4P2RB 2BINA 1NC2A 1ADQH 3P0YH 1SOQA 5HDQL 1M2OA 5I71C 2X4OB 4U4IA 5ESAB 4RX4D 4UOJA 1OM3H 5FF6A 3RI5F 3D0LA 4KRPC 1M3IA 4X42A 3VFVA 2V7NA 4ERSL 2YBRA 1NBCA 4N9GB 4WENB 3VG0H 1M2VA 4IOFD 5KTEL 3D39A 4APXA 5IFJA 5ISZA 1GL4B 2OJEB 4MSWB 2ADGB 1S5IL 3DKHA 4IRSC 4D9RE 3QJTB 1AQHA 5IJKA 4QPEA 3D85A 5DRXB 3JV6A 4PUBL 1GOFA 2W59A 4HLJA 3BO8A 4DKEH 1XEUA 2OXHB 1LWVA 3U7WH 4NN6C 2C3VA 2OP4L 3KW7A 5GRXG 3OPZL 2ZUUA 5JORA 1D5MB 1QSEE 3BHBB 3C6EA 3LIZA 4Q11A 1KJ3H 2P80D 3L7EA 3VW3H 5A16A 4K2UH 1TZIB 5IGXH 1KWGA 3QVAA 4AJ0A 5FOJA 4PRAB 2F74A 3OLPA 3QUMA 2APVA 4DETA 1JGDA 1YEJH 5FO8A 5CP3A 4XGZA 2OV0A 3BAJA 4RIRA 1USZA 3O2DL 4JRLA 2JKWA 1YVLA 5A43C 4YDJA 2DLFH 2J8UB 1WH0A 4FP8L 3UMTA 1M7DA 4GRWB 1WC7B 1OY3B 4MJJA 3GBMH 3O9WA 3C09C 2HRPL 4G8GB 1FL5A 4YSTA 2IQ9H 4M5TA 5SWQB 2IBZX 2VN6A 3D25A 1B3IA 3QQ3A 1DZ0A 1OGPA 4ZK8A 5D2LE 1LO0H 3LVTA 1TZGH 4LCCA 4WHCA 4C4UA 5D1ZA 2A83B 3IAQA 1AOZA 4IU2B 4XMPH 3H9HA 3VGGA 4XBEH 1XGPA 2UZXB 3QUXA 4UT9L 4XC3H 5HDBB 3O41B 4NRZB 5C0DB 4E2OA 1S9VB 5FCUH 4ELMA 2I7SA 3IJYA 3LCYA 2A9ML 4GIPD 1BXXA 3P30H 4P4KC 4DQOL 1WA2X 3LKOB 1Q9WA 4X6DB 4HETA 2FATL 4EUPB 3BPOB 5AVUB 3VGHA 4BV1A 1OP5K 3KJ6L 4L8DB 3ZUCA 1TZOA 3MREB 5DC4B 4J1UB 2Z9TA 3QYCA 4X9IA 1KBWA 1EFQA 1IJNA 1RP9A 1U8CA 2JJWA 1KCUL 2VJ8A 1G9MH 4TLUA 5CJBA 5HVFB 3UO8B 5F9AC 1QG3A 3B7RL 1G1OA 4KKRA 3FQ4A 4GRMB 4TSBH 3VB8A 4POYA 4KVCH 4QRQA 4HEPG 5D93C 4XE5B 3B9DA 5HGHB 2E7HA 1WLHA 3AB0B 2VN4A 2ZXGA 3DX2A 3VAEA 3IE4A 4I77L 3RWGA 1FORH 1N7MH 4P4RB 1KFGA 2WV3A 2O1AA 3FU7B 2L8AA 3MO1A 1FG2A 1T7WA 3T09A 1ZHNA 5A7EA 2VDKL 3H56A 1JHTA 2ZWKA 3SGDI 1J05A 3DVGA 2R2HA 4DQAA 1QNAA 2C7UA 5HY9B 1MZYA 3MA9L 2WM0A 3QNZB 1AG6A 4M6OL 2H26B 4G8FA 1MRDL 1IILE 3VD5A 2A0LD 1ET7A 2LFGA 4YXLH 5AYTA 4KXAA 4HHAB 3RWEB 4J28A 3ENEA 2P8MA 5C97A 4JZJA 3SJVD 3TLRA 3BZFB 1TLKA 4ODVL 1FGNL 3HS0B 3AG1B 3O8XA 5CD3A 1O7VA 3II1A 3NEEA 2E86A 2ZNWA 3AS2A 3PWUA 4MNGE 3TIDB 1Q1JL 4JW3A 1SPDA 4S1RL 2CGZA 4X6CB 4JR9H 2OMUA 4W9HC 2EDLA 2DM4A 4QY8A 2FIRT 3S97C 4G8EB 4LVOC 4XZ4A 4G5ZH 2BVOA 2PO6A 1SVBA 4L9LA 3FT0A 3HCVA 4W9GC 3G5VB 3SE3A 2CHWA 3MLUL 3ZE1B 5C70A 3BI9X 3KWXA 4LAJH 4NQCD 5HGAA 4X8XA 2Z8SA 1AQDB 5EU7E 2BDNL 4DEUA 2X38A 4TQPA 1OAXH 3O0RH 4JKNA 2YR3A 4KZDL 2Y6SD 5AVQB 2R83A 4A2HA 2ALAA 2F8XC 5HYSA 1F11B 2DQUL 1MF2L 3MN8A 4B3VA 2JQAA 1CFSA 1KXTB 1UGNA 2R1WB 4DEPB 2FX9H 3OJMB 1IAOB 3F12B 4XHQA 5LCVA 1QR1B 3TNNB 3DV4A 5IQ7L 2XWJA 5HTSA 3RGBA 3EFDH 3NJGA 3WMSA 3QQ9C 1C12B 2AJZB 3TEYA 4AIZB 3T8VA 1YECL 4AK1A 4XMWA 1FBIH 3KJ4B 1XF3B 4YHOL 4AEEA 1A47A 1BDYA 1G5AA 1W91A 4HK0A 4R4ND 4MDIA 4HUWB 4NGHL 1DCEA 1S6NA 4YDIH 3LIZH 4HF5L 4F2EA 1I8KB 2F7IA 2WUBL 4IBQA 1HL5A 2A77L 1CXEA 3IJ9A 4G8IA 1QLFA 2FGWH 5D4IA 3GM8A 2XN9D 4KTEL 3CUPA 4MGXA 1YN7B 2AERT 3QUMH 5IESH 4J4PD 5CP3H 1E50A 5LDUA 3QIWC 1CDIA 1UM5L 1I9IL 2A9DA 3JTSA 2X40A 5HPOA 1JMXA 2XQYG 1MAML 4A55A 3EDDA 3SJVB 4WU7B 2MOGA 1U8MB 4JPSA 4FFYA 1DBKH 4W1TA 3P0YL 4NT6B 3TBWB 3VNYA 1EUUA 4HJIA 2LGNA 4FQHA 2ENJA 2WSDA 4O00A 2DWEB 1OM3L 5HVHB 2FTAA 5IJDC 3HG2A 5GPRA 2B5IC 2IDFA 3L3HA 4N8CH 4NWUH 5ID0A 2GJRA 3CVHH 5AVXB 1BFTA 2P5ED 2WXRA 4I0CC 1HX0A 1RHHB 2YJLA 1DSYA 1ZANH 1THAA 5GGTL 1JZ3A 43C9B 3RX9A 4O02A 3C6SB 3G6JF 2R4RL 4NQCB 2J55A 2V37A 1BVOA 3VJ6A 4BYHA 5KVEE 3F64A 1HHGA 1LP9A 4Z7QB 1KJ2A 1INQB 1FO0A 2VMEA 2VLRD 4RDQF 4XXCA 5HYEA 1CLYH 3CFKA 2H3NB 3I85A 2A4CA 4DO6A 2DI8A 5GS0L 1PZ2A 4LFHG 1RP8A 4OCXL 1KJ3L 5FA4B 5IW3A 4QKXB 4YNYB 3N40F 4PJ7B 1H6UA 5F71A 1WS7A 4DKFH 1BYNA 4Y1TA 3O6LL 5GSRA 3QDGE 2QMKA 4LDEB 5EORH 3BRGC 3LD8C 3D4YA 1HCFX 1A65A 2ZD0A 4LLUA 5JDJA 1IX2A 4IGBC 4IW4C 1C5DB 4DPRA 4KU1A 2W81C 2VABB 5FYJE 2GTQA 4XRCB 1O5PA 4Z7WE 3WL9A 3UBXG 4O5LH 3SIKA 1N6UA 2K7QA 3CAFA 3DX8A 2CO7B 2EIJB 4A7TA 4CRPA 2EDDA 4GG8B 4LOUD 1A25A 4ZUVB 3UTTA 2X10A 2CR0A 3GBML 2CLRA 2XG5B 4YHKH 1ES0A 2BP0B 2EKSB 4R96A 4UDUA 1HZKA 3BMWA 3MBEB 3W11C 4DTGH 1TSRA 3FHAA 2ZUQB 4FQJL 1LO0L 3FJTA 1M4KA 3LPWA 4OGAD 1NIBA 4G9DA 3GO1L 2WVSA 3V0FA 3K2KA 3S3BB 4EI6B 5DMKB 3GUTB 1MJ8H 5K1VA 2WWMD 3C5ZA 1IVLA 1ZT1A 1P6FA 2OMVB 4XBEL 5MEOA 1SBSH 1WICA 1IKFL 4ETYA 2XYBA 3Q8BA 3BZDA 5IFHL 4X7EC 1NEZB 1VEMA 5IB1A 3WV0A 1FE8L 1NDGB 1NGYB 3QWRD 4DP1X 2GEQA 4JREC 2AXGB 4N8PA 1CG9B 1QFOA 4YGVB 3UEQA 4QO1A 3REWB 4KXBA 3QS3A 2W65A 4RFOH 4GO6B 4FRWA 4QG5A 3NZUA 3S96A 3HE7B 1S9YB 1E4KC 3O3DB 4AQOA 2P5EB 3ZDZF 4Z7UF 5HXMA 1XGUA 1EEYB 4XN8A 4LSUL 1DN2A 1XCTB 2KI6A 2XVLA 5GIRB 3W2DL 3IVKB 1IGML 4ODWB 5C3TA 1X5JA 1IEBA 2CJUL 2EACA 3MACH 3VU2A 4W9LC 2WLHA 3M1BB 3VD9A 1JV5A 4H1LG 2MPAH 4M6NH 4NB7A 4EBQL 1JN6B 2AJ3A 5EEUA 4ZXBA 4LLYA 4L2LA 1HH6A 1QVOA 1N7ML 2CDFB 1DO6A 5F7EL 3SCMC 2JKXA 1CI5A 1XF2B 1OCWH 1FNSH 2PWGA 2CDEB 3GTNA 4JFSA 3DI3B 2HMIC 1SY6H 2XNAB 4Y1AD 4G7SB 4XOEA 5LCVH 4BA8A 2AW2A 5L4MA 5LGJB 4RBPH 4JO1H 4OLVL 4N9OB 2VJXA 4BK5C 5SWSE 2EUVA 1MJJB 4QNPF 5JMVD 3S8WA 1F4YL 1IC5H 1T6WA 3DSFL 2QZQA 3K8MA 2SODB 2VDRH 3D4ZA 5JIDA 1IAIL 1OALA 4KBPA 3AUVA 2FX8H 2N4IA 3CFIC 4XMLH 3RDJA 1IBDA 2GBVA 3S36X 5DD5L 4HVBA 5KS9B 2WGNB 1F3DJ 1OGAE 3QRBA 4JR9L 3FU0A 3L5IA 3WLBB 1IEHA 3CZGA 1PG7H 5A2CA 4H20H 4HPYH 2X70B 1I75A 4B5EA 2CLVB 4P0DA 4PIRF 5DS8A 3P2TA 1SVCP 2XV3A 3X13A 5IK3A 4TUOB 1NAMH 2F54D 2JCWA 3F0ZA 1R3KA 1TVHB 2D31A 3M8OL 4B27A 4ZW8A 4LSTH 3S88H 1CFNA 5HGDB 3OSKA 4XVUD 3P02A 4FG6C 5KVFL 3BGAA 2ZICA 2AJVH 2DAVA 1JFIC 2WB7A 2XZCH 4H1LH 4O02H 2I07B 5SWZD 3MCLH 1ZXKA 4WU5B 3G6AA 5PAZA 2DYSB 3NK4A 1DQIA 3PWLA 3EO0B 1HHIB 3EOYG 5IB3B 5JO5B 4M7LH 3H55A 2OSLB 2D3LA 4AG4H 2VL5A 2KPWA 4KDVA 5CZXD 1QUNB 4BZYA 3B3IA 3GLDA 4NI3A 3PNWB 2LHAA 2WOBA 3TE5A 4O58L 3UP6A 3V95A 1E6JH 5CU9A 3MLXL 1HAUA 4GS7B 3VFNB 1Z32X 3WTSA 5FKPB 2D4DA 1B4RA 1IAMA 3K7UA 2E0PA 1VJSA 4ONFL 1S7WB 2FNWA 5EC1A 1YEGL 2PR4H 3C60D 1TYJA 5JLZB 4Z6AT 3NT0A 4GIAA 3R06A 4HIEA 4YR6A 1A4KA 5KANG 5E1AB 1YYML 2ZP8A 1DE4A 5EU3B 3V6BR 4GXUN 4U0RC 4OLUH 4ZZFA 1PAMA 3QO0A 2A9CA 5DZJA 4LOVA 1TVBB 1V7NH 2F58H 5JUEH 1D7FA 1OZTG 2H5AX 3G08B 4WXAA 4N2KA 4MS6A 5B38B 3T0AA 9PCYA 1DBKL 4PRBA 2VLJD 3L3JA 4U6HB 1E2VA 4Z77B 3ZBMA 2EDTA 4YFDB 4JHVA 4Y9EA 1CVSC 5H35B 4EDXA 3HW7A 1T1ZB 5HHPB 1ZCRA 4Y16A 5CGBA 3WFEH 1OGAA 2C9QA 43CAA 3FXIC 4HLEA 4GKNB 4N2BA 1BWWA 4FFZH 4AENB 4AYGA 3ROOA 1BVNP 2GCYA 4Z8FL 3CHXA 4XCFL 4Q9QL 5JIMA 5H37H 4MS8C 1AS8A 3T65B 3IDXL 4OZFB 5DJDA 2F54B 1QNIA 3FFDB 2X0VA 3FH7A 2X4UA 5K9QG 1S7XA 4A7GA 1ASQA 1DVXA 3IMWA 5CM1A 3W9EB 5C09D 3APNA 3G6JE 5AYUL 1S46A 3TA3D 1D5XA 2WNKA 1UJ3B 5D8JH 2X6BA 2X87A 4M8QA 5IHWA 3MBXL 3L3OA 2CKNA 2CE6A 4XP6H 1NCAL 4J5VA 2B59A 4IRSA 3QUZA 4EQ2A 3SDAA 5JQ6L 3VXMD 1IGJB 2XWDA 3BESR 4S1DD 5JPNC 5IMLB 3IXAB 5J1AA 4I18C 4NBXB 2F5BH 2YD7A 2V9JA 4ZS6C 3ENOC 2HJFB 3T0EE 4O5LL 4LNVA 2AABL 5GGVH 3ZY7A 4DP4X 3D87B 1I3GH 3BYYA 3DXAD 2KKQA 1B4TA 4PLJD 5EPCA 1ZVSB 1U21A 4Z1PA 3OR7A 4QXUL 4PJEB 2P44B 4FE9A 4DTGL 5AW7B 4F2ME 1KGYE 4WWOA 4X6EB 3SY0B 1PZUB 2DWSA 4ZNEE 3U9UB 1D2OA 2ZCLH 5JTWA 3C60B 4FI7A 1A6ZA 1TQCB 4TTGA 1I9RH 3KLSA 5F96H 1ZSDA 4ZOEA 4LLQA 1TIUA 4CN6A 3VXPA 2JCCF 1Q94B 3L54A 4LF3A 4YDKL 1CF1A 1PG7W 3EYSL 3T2QA 1JRHH 5CZRA 2UVFA 4HWBA 1JPTH 2H7WA 3NA9L 2CIKB 3KPSE 4XCYB 5ECJE 3MLRL 2VW7A 4Y5XB 3WYRA 2VLJB 2OX5B 4JFED 2M1KA 1HHJA 2WLIA 1AS6A 3QYMA 2N1KA 3NESA 2WQRA 2NWVA 4NUMA 1S7SB 4PGEB 3W3BA 2XTJC 4PJBA 1ZJAA 4HKZA 3UZQA 4RFOL 5IW6A 4AYMC 1YTBA 3OHXC 5BMPA 3HPLA 4MA8H 4JDTH 1RZ7L 4UIKL 2AJSL 4HJSA 4PJDF 3PV6B 3TTSA 5H94A 32C2A 4NUGL 4N2HA 3CN2A 1JWMA 3B5HA 1C4GA 2EE3A 4F9PA 2QFPA 5D7JC 3A6BL 2VR5A 3RWIB 2B1AH 1JDDA 3ZDZE 5KSAA 4Z7UE 1M7UA 1NKOA 3Q1EA 1LILA 5FS5A 5AALA 7FABL 1I8UA 4ZT1A 5C09B 2WLZA 1DJSA 5E9NA 3S5LG 2ZOKA 5D1QC 2DD8L 2WVVA 4FHJA 3TA3B 3TEZA 2YD2A 5C0NC 4OZIF 4GQPH 1TXKA 2FJFB 1EAOA 2W5PA 1SY6L 3MRHA 4A2DA 4KVNH 3HOGA 3OSMA 3NBNA 1YQLA 1AR1C 4FXTA 4LBEB 5DJ8B 3VXMB 2B20A 3PWPA 2YMXL 1INEL 3E1F1 1SHWA 3GYRA 2DMBA 2E9IA 4K5LA 3BH9A 1IQWL 4HK3J 4XE0A 3RVTD 2IIJA 2QGEA 3IF1B 3EGSB 3DXAB 4GUPA 2HLFD 4QNPE 1F4XL 3NAAH 3MTXA 5INCA 4K94C 1F41A 3K2MC 1UD2A 4R5TA 5I74C 5E08H 1IAII 2R7EA 1FSKC 1RZGB 3ZU8A 4FNSA 4ZOBA 4XCNB 1WBZA 4GW5A 4HQQL 1NKRA 3RP1A 4A67A 4H20L 4JJOA 1OF2B 1AHWC 1D5ZB 5EO9B 1BBDH 1OP3H 2JPIA 5I6LA 4NKMA 5KYYB 3SKMA 5CFAA 2FWUA 2AJXL 1B0GB 4ZUTB 2HTLC 3BUYA 1DN0B 4XXDB 3SDCD 3WJLC 5HDBE 1ZT7A 4UQ3B 3IM1A 4ZTOH 1CGXA 4JFEB 5DEFB 5T3XD 1KIUA 3IE9A 2HKPA 1RLWA 3KCWA 4RGOH 4LP5A 1V8HA 1N0XH 1H15A 4IYKA 5DEJA 3KDMB 3ZUNC 5AN4A 4PJXA 3NQIA 2DJSA 3NFSH 1K5NA 1PY0A 2JV6A 2XWRA 3GSRB 4XCEB 5E1HB 1VPOH 2AJVL 4DZ8A 3PE9A 1FN4A 3HPJA 3P77B 1CLCA 4F33A 5TD4A 4QAMB 4F2FA 1QO3A 2ZXWB 5IB2A 4OIBA 1TJIH 5GS1A 3AS1A 5T1KA 2UWEF 3LN9A 1E28B 3KPNA 5DZ9A 4LVHC 4XNXL 2NT0A 5IROD 5HYJD 4HUKB 5E70A 2NSMA 1MIEL 3CK0L 1J12A 2CXKA 2MQCA 5FWRA 5I2IB 2VISB 1UOKA 5TQ2H 4WO4C 3RI5K 2Z35A 3CVBA 5MEPA 4OVVA 1GPOH 2B0SH 2QEJA 1O0VA 4HT1L 3KYNA 4QRAA 4P9MH 2H2SC 2V0AA 4LSVL 4ZODA 2FL5B 4ZW7A 3TM6A 3FMGH 4KROC 4MX7B 1Z9LA 5C1MB 3RGVC 1JZJA 2D03L 4QXTB 4KX9A 3ALXA 5E23A 1DSFL 3QB7C 2PP7A 2ENPA 3L2NA 5AL0A 4GH7B 4KDTC 3L17A 4F93B 1CFVL 1KF9B 3R7QA 4FERA 5KVDE 4AL8L 3KGTA 4A1RA 4Z7NF 3MV8A 3ARVA 2H6UA 5JW4R 1EGJA 1LWRA 1HU8A 2ZUVA 4NNXA 3WD5H 4KRLB 3MUHL 5MHSD 4D9QE 2Y6TE 3IKCA 4EQ3A 4KJQC 3FT4A 5HI5C 3UDWC 2JJUA 2R8SH 3LZPA 3QXVA 3QIWA 5C6WH 4GSRA 1MI5A 2IFFL 3ARFD 4XB3A 4Y8AA 1GAFH 2MEJB 5CJQH 4LSQH 3ARDA 3PABB 2R56L 1ZV5A 4Y5YB 1SUHA 3MA7A 3SODB 4PJIF 1O6SB 2YPVH 4QRTB 3RDTD 3VH8A 4HWBH 3X17A 5EZIL 3SDCB 1A9VA 4Z95H 4ES9A 1WZMA 3INUL 4HX1B 4YEEA 5ABZA 2NY3D 4Q56A 4YHYB 5F6IB 5BOPA 1H3UA 3ZDXF 3I75A 5EPMA 2WXQA 3Q9QA 1YPZB 1CGTA 2KZBA 2NUPA 1Y6MR 2ZTBA 4MRBA 5HHVH 4AQAB 3QH3B 1KCVL 4G9FD 2IV9A 1AISA 1JHKL 4YSQA 1M1XA 2YZ1A 2PKDA 3OL2A 3ESMA 4JKPL 4JDEB 1BJ1J 3GJFA 1WWCA 4K8RD 2F5BL 1KGCE 2X4QB 4WJKB 3LTVA 3QEQA 1YUHB 3AJ7A 4CKQA 4WTZG 1J3MA 1QEWA 4HOMA 4GAFB 1EO5A 4D2NA 4AQ1C 4AIOA 1DR9A 2V8LA 1H0DB 1RIHL 5JOPD 2IAAC 3KD4A 4HPHA 1RK0B 1WBYB 1NGPH 2H4EA 3MRDB 2Z7UA 1E6OH 3FQXB 5F1NB 5KAQF 4JDVA 1ET5A 1LO2H 2HJLB 4IGBA 4HW6A 1P5UC 2VXUL 3QQDA 5ICZB 5L8KB 4Y19D 1PNDA 3U46B 4DOHB 3U36A 4HIHA 3TDHA 3SBQA 5FOBA 2FWLB 3BP5A 1Y0LB 4HXAH 4X7SL 2WXMA 4AXWA 3U48A 2JTDA 4P5TC 1QHOA 2TRYA 1CICD 4WGKA 5MI0C 2JCCE 4LPCA 4L1DA 2Y7MA 1ADWA 3CDFA 1DLHB 4LARH 4RGND 3E8UL 3UGEA 3MRPB 3SE4A 3CIQA 3H9SE 3ZSSA 2G0LA 4Z78A 2A9AA 3DJRA 3P73B 4QF1A 5JW3H 3TJHD 2DYPD 3D3VE 2XRAH 1X7QA 1AGBA 3ESVF 3MRIB 4JEGB 1BCIA 5JHDA 4MNQD 4XP5H 2MTPA 1N26A 1ZLWH 4XX1G 3QCTH 1FVEB 4RVBA 2MCAA 3FB7B 3V5HA 4I1PA 1RV6X 3RDTB 4BA0A 2Y1YA 1TT6A 2ZF8A 5IM7A 1M7IB 1A14H 3BEVB 3U4EB 3UFIA 3BYTA 4PJDE 1L7TL 4HEME 3O6ML 4LEOA 2H0PA 2HT4C 2NY3B 5FKAA 4BELD 4GRLB 4P5RA 3VFTA 1IUZA 25C8L 2ADJA 3S8FB 1OD9A 2N0MA 1WTGT 2AGJH 1MCJA 1SYVA 3OAUH 4HMEA 4QHNB 2VLLB 4G9FB 4JPVH 1G7IA 2P43B 2J4WL 2R2EA 5F97E 2XQBH 3IMSA 3WUWG 4MNHB 2XWXA 4OZIE 1OTUD 2HT3C 3AG2B 5TDPA 1E5YA 3ECUA 4I85A 5DK0B 5JW4Q 3SCMA 4JZNB 3SDDA 4B9YA 3P11L 2C1PB 3CZLA 3TO4C 1BQ5A 5AENA 2CK2A 3NAAL 5C9KA 3B2VH 1BFOA 1EXUA 4PRHD 4KY1L 1TTRA 3P9LA 2B4CC 2CQVA 1H9DA 4RZCB 4UBDC 4PD4K 5HHOA 3V4VH 5C07A 4Q0XL 3H42H 4QIRA 4JY6B 4PP1D 4ELKA 1QYGL 1IQDB 3VWKA 3ZE2F 5BZDB 4GKOA 2BSDA 3ZT6A 4J3OC 3RFZC 2EE6A 2VC2B 3WY1A 2VTFA 4M00A 5DJXA 4KUZL 2BH0A 2PYFB 5E51A 3CFBB 3TBSA 5I0XA 2B7DT 4S1SL 2L7QA 3FT2B 3K80A 5JXEA 1UXSA 2Z0FA 4M48H 4BSVA 3SQBA 1A7RL 1E7VA 1A9BB 1SMAA 4FCAA 3T3MF 3AXLA 1TFPA 2HH0L 1CICB 1ZA6A 4NPKA 1KB5H 3MPCA 4MAZA 4LASH 2QHRH 3ET9F 2GFBA 3HRZA 4H25A 4N86A 4M4RB 2NNCA 4RGNB 5JHBA 4KJWC 1R19A 2HKHH 4ORZC 4PGDB 1FL3B 2RCSH 3I0XA 2AC0A 2DYPB 2WXHA 3LN4B 1BZQK 1JJUA 5IP4A 1ZDSA 2ADYA 1I3RB 4HIJA 4N0UB 1FZKB 3ARGA 3MCYA 5I6NA 1BF8A 1J0JA 1YMMD 4H5SB 4MNQB 4MWFA 3BPNB 2V2WA 3GXUB 5FO7A 3BH4A 1CL7H 3Q7JA 3V4PH 5E9DA 1QFUH 5AVTB 4GMTH 1EAPB 2W9EL 3D12B 3EGDA 4AM0Q 4OB5L 2NNRA 2OMYB 4DGUA 5HHME 3C04A 5EU7C 2ZAIA 2HFEB 4XO5A 2UWEE 4PCTA 5C08E 3EJUA 4XBGA 3QPKA 1HESA 2D7TL 4YUEL 1UD5A 4OKVB 4P2OC 1N9PA 1VFOA 3RU8L 3UAAA 1QPKA 4KK9C 1VEOA 3QUYD 4PWJA 3BQVA 3UMNA 2ZUWA 3V0VB 5B39B 4N0YH 5FK9A 5IQLA 4JRYA 3UTZA 2AQRA 4XO9A 1TKWB 4BJUA 4LNRB 1CTOA 2OXGB 3VG9C 5I6PA 4LEXH 5DJAA 3TBYB 4MASA 4JKWA 3WMPA 3MV7D 1S7UA 3WBDA 4WTQA 4Z7NE 4X99A 4FQIH 1A6WH 4HD9A 2AV7B 1V3MA 1T3FB 3R18A 3JWDL 1CXKA 1KTJA 2P9RA 3B2PA 1RD6A 3BVNA 5FYLH 3JUZA 1WZKA 4XR8C 1FH5H 3LIUA 4M1CC 1BGXH 1KFAH 4HCRL 3VO0A 1LEKB 6FABH 3V0WH 4OJAA 1G84A 1ZLUK 1JNHB 2CBMA 4PG9B 4MQXD 3NZHL 3REVB 4PJIE 2UYLA 4Z76B 5BV7L 3U4AA 2IGLA 1SLVA 1HQRA 1EHXA 4KJPC 1AACA 2AF2A 5HHVL 2C34A 3CZNA 3UPCA 4BK8A 4DUWA 2WO4A 1CTMA 3GLZA 2R1XB 3ZDXE 2EH7H 1DVFA 1P7KB 4WCYL 1LLAA 3LNHA 2VN3A 3OKOA 4J6IA 4H8WC 5I9QC 1GVIA 2NY4D 3WNJA 3QWNA 5EOTB 3W9DA 3W5MA 5DVMA 3U79A 3OPUA 2YRZA 2ZX7A 3TC9A 3ZT7A 2DQDH 2YK1H 3BUDA 3DETD 3EH1A 2AHIA 5B22A 1IZJA 4FXGA 4U1LB 3EH4B 1JI2A 4E41A 3O3EB 4NP9A 2FJGA 2YWYA 3NDZE 1U3HC 3B9VA 4URKA 5F9DC 1OGTA 3MRFA 3JYCA 1KZQA 3QFDA 1LO5B 1DJHA 5JPNA 1LDPH 1FNLA 3Q8AA 4H13C 5BO1L 4AIEA 5I1EL 3QUYB 1RFDH 4I18A 4MD4B 3LQMA 2XKNB 3V4LA 4PB9H 2OL3A 1ITCA 1W8EA 4AYFB 3E6FA 5DO2D 2H6PA 2M83A 3DV6B 4N2LA 1ZJBA 2ZXAA 5BRZD 3TNMB 2GB2A 5KANI 2DEWX 2KPNA 5I82A 1XIWD 1BLNA 1ZHKA 3ARXA 5JOFB 4YHZH 5G4MA 2TRHA 2B14A 3BFOA 3OWEA 1HSAA 2F1BA 4NJAH 2JK5A 2F8IA 5HGBA 1RPQA 4O9HL 3DBXB 1UADC 1NCTA 4G7VH 1XF5B 3ISYA 1UZGA 3L3KB 2CGRH 2QVMA 4WUUD 3MV7B 1HSBA 5D72L 4BEIA 4FADA 1E0OB 1E3XA 4WQOA 1JBJA 5JW3L 3SKOA 3LN5A 4RMUA 5E2UL 2CA3A 2D7MA 2Q7NA 3ESNA 3QXAA 1XH3A 1D5BB 4DN4H 3JV4B 4E9LA 4YFEA 3QCTL 4BINA 3S6CA 3IFNH 1NANH 3QDJA 3GMOB 3OKDB 1R3IL 1FNEA 3PQYA 5K9QI 1MHCB 3IDYB 3ZKXB 2VLKE 3JV0A 4NP4L 2J2ZA 4DP9X 4YDNA 2F0CA 5D1XD 4MBOA 1RZ8A 3FULA 3HTLX 3K8LA 1P7HL 5FO9A 3U1QA 3KTUA 4PLOB 3OAUL 2UZYB 1FCGA 3F01A 1DP0A 4NLAA 4JPVL 5BPPA 2X2HA 4XWOD 5DD0L 2I9TA 5D7JA 1ZVNA 3AW5A 4NAJA 1WWBX 4XN4A 1UYWL 3CVDA 1WV7T 1FNAA 4N87A 2NY4B 1T89A 4I48B 3RUGA 1LE9B 1LWWA 1E9OA 4X5QA 2JKRM 2Q3ZA 5EZLA 1SOXA 3WDJA 3ZW3A 1N3CA 2K3HA 5CWSB 2UZIL 4YLQT 5BJTA 3SPCA 3HC0B 3IJEA 1FIGL 3TVMD 1DJWA 3HLAA 4OI7A 5GRVK 3BD5A 4I2XE 3TA4D 1VFAB 4AEFA 2X88A 4JQIL 5I0DA 1V27A 2E74C 3QQ4B 2XN0A 3O3UN 3CQFA 1NCDL 2GK0A 4Y4FB 1ETJA 3BP6A 1NWOA 3MTRA 1T03L 2OW6A 3Q48A 3QORC 4PI2A 2F7LA 4KK8C 5BRZB 2HLEB 4DP0X 1PX3A 4ANVA 3VD4A 2A9NH 1XIWB 4WI6A 3N9GH 3FQWA 5EBLB 5CEYA 3WAKA 1A3QA 4UTAL 5T33L 1U8QA 1WFJA 3ZE2E 2EH8H 1UFUA 1J88A 3CG8A 3TT3H 1ACYL 2PPFA 5FA3A 5CJ5A 1J9CT 1V7ML 2QHRL 4LSDA 1NVPA 3ENCA 1YEDB 3V5DA 4WUUB 5E94A 2R4SL 1UXWB 3CCHB 4J8RB 2RCSL 3DPDA 4P5SA 2NMSA 4NN5C 2YGVA 2X4SB 3CFEB 3EBAA 1AHWA 4LOFA 1JOIA 3DVN<