3H1ZA

Molecular basis for the association of pipkigamma -p90 with the clathrin adaptor ap-2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 complex subunit beta-1
publication title Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 51
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h1zA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3h1zA02
3OC3C 1NH2A 1YTFA 4ROEB 2D0BA 1KYDA 2VJ0A 1RM1A 1QN9A 1PZDA 3OCIA 1QN6A 1D3UA 1B9KA 1AISA 1KYFA 2G30A 1QNCA 2Z8UA 1CDWA 2IV8A 3HS9A 1QNAA 1YTBA 1NGMA 1VOLB 1TBAB 1VOKA 1W80A 2IV9A 1R4XA 1QN7A 1E42A 4ROCB 4RODB 1VTLE 1JFIC 4WZSD 4PY5A 1QN5A 2MJ7A 3HS8A 1QN8A 3ASMA 3VN5A 1KY7A 1KY6A 1TBPA 1QTPA 2D0CA 1NVPA 3EIKA 1C9BB 3H1ZA 1QNEA 1KYUA 4B0AA 5IYDP 2D0AA 1PCZA 5IYBP 1QNBA 1QN3A 1QN4A 1TGHA 1QTSA 1VTOA 1MP9A 5IYCP
chains in the Genus database with same CATH superfamily
5E4OA 1AS8A 2JCCE 4GAAA 3ZJAA 1RULH 3GJFH 1ZA6A 1P6WA 2AVGA 1G9NC 2X5PA 5DVMA 2FX8L 4WCYL 3ZGIA 1JYNA 4DP2X 4IJ3C 4PJDE 3ZDXB 1ZTMA 2HT3D 2OMWB 4L37A 2ADGA 5KYYA 2DMGA 4X6EB 5IIEB 2ZTBA 3WEAA 1E8YA 3FO1A 3AZUA 2CBPA 1U3ZA 4YH6A 2Y7NA 4C47A 2NDGA 3KYKL 3MGTB 3WFBL 2HTKD 4NZUL 3B2VH 4YWGH 2YUXA 2EDLA 2W9LA 5D5ME 3U0TB 1HSAA 2FX9H 4OLZH 2NY6B 3WKYA 3KL3A 1FLTX 3FUIA 2FQFA 1QVOA 5LXGH 4UI2A 4YUEH 2UWEF 1BF8A 4KJWC 1T7ZA 4LASL 2DIAA 2MNJB 2VDRB 5GGQL 1HXYA 1CYXA 4I3SH 2E7DA 2A77H 5D93B 3RTQC 3MOAH 4HH9B 3HG1A 4EIGB 4F7TB 4HLEA 1NDGA 3QEGH 4JN2B 3B6SA 3VGHA 2NUPB 1HHKA 5FHBH 1L9PA 2OXGB 4ZUWB 2WM0A 5I76A 4YXLL 2EDDA 1DBAH 1PCMX 1C5DA 1XSOA 4M62H 5GRZA 2NOBA 3PIQB 4IU3A 1TENA 2AXHA 5KYUA 3BPOC 5ISZE 1UA7A 2WXNA 3WMSA 1M7DB 2P5PA 1JGLH 5C7XL 4TVPL 4ZQKB 5DRNA 2BNUB 4LVEA 5LHDA 2F54E 5E6RB 2ITCB 1DCLA 3P4OB 5LBSH 1MCWW 4MMZA 4U0QB 3QQ3B 4IKLA 4U6TA 5HXMA 2APTA 3VXSB 4KRMB 4U1IA 2J6EH 5K39B 1O7DC 1ZAGA 2EZ0D 4JM2B 4LLAA 4W9LC 1FWXA 1TNMA 4U3SB 4W9FC 5JA9A 3TT3H 1GR7A 3F84A 1QHQA 5HHOD 3BD5A 4HETA 5BV7H 4JFWA 2HMID 3Q44A 5SWQA 1M57B 5DVLA 4NKIL 3MCG1 1H0DA 1DR9A 3GS7A 3LZOA 3IFOB 4OLXH 1T0NA 5IB2B 4XPTH 2GT9B 3BD4A 3P1VA 3RWJA 1R3KA 5BNXD 3S3CB 2YA2A 3OJDA 4C55A 1LD9B 5BZWB 4UBDD 5DC0A 3BH8A 3CFCL 4UAOC 2JQAA 3C2SA 4GUPB 4H25A 1LM8V 2OSXA 1FL3A 5J7CC 1ZHLB 3U0WL 5HHXL 3STLA 1N2RA 2P52A 3UZVB 2HH0L 5GGTA 1EJOL 4CKVX 4K3GA 2J43A 3FMGL 2L4OA 3LEXA 1TLKA 3L3IB 4M61A 4XN9A 5D1XA 3WNNA 4A6YA 4YHPA 1U21A 2X9YA 3ARBD 4RRPA 1P7BA 3KVDD 4GXFA 4X6DA 5GS3A 4J2QA 4TL5A 3VTTA 1UATA 1R6VA 1S9YA 5C3TA 2GC7C 4N2NA 2OMTA 4AEIH 5ACLA 1ZHBA 4RAUA 2J21A 1F90H 1FV1B 5LNDA 1RPQA 2E4FA 2GTWB 4ALAH 4GXVL 3S5ZA 5ID0A 2DJUA 3FSVA 3LIUA 4LCWD 5I18L 2HT2D 2BOCA 2CLVA 2NTSP 3D52A 1M6OA 4ELMF 4LDEB 2AKRB 5L88L 5JZ7D 4KZDH 3EFDH 5BS0A 3VM5A 3KWTA 2APBA 3RIAK 1JUFA 1B88A 2WGXA 3KL5A 5ITFB 2N01B 1DQQA 3KPOB 3KPSA 2ED7A 1A0QL 3B2UD 3R0NA 5IFAL 3VYOA 3SGKC 3KLQA 4N2LA 4ORGB 3MYJB 4X80L 5E5MB 3ZX1A 5EU6E 2DM7A 1GGCH 1FZMA 1HX0A 4LSRL 2WPGA 4BXSV 1FZJA 1IGTB 1SLWA 2NCMA 2NCEA 4M5ZL 4PAZA 3HVNA 1SHWA 5H4YA 2XG5A 4UDUA 1CURA 3I74A 1U93A 3S2AA 1OTUD 3IJ7A 3MJ8A 3QEQA 3V4VH 1XIWD 1G9MC 3L9EA 4EMZA 2DL2A 4G70B 3RUGB 3NT0A 3RZCC 4RNRB 5KVEE 3HI1B 2V8QA 1F6LL 1CFQA 2V9RA 4I0PD 3MBXL 4NGHH 4PJIB 5A6MA 3C2AH 3IMWA 3MZGB 5I15L 1ZOXA 3I6KA 4NQSB 5FYLD 3IDYC 4KRPC 2Y06H 4OB5H 3VI3A 4U6HA 4DZBB 5EUOE 1D6EB 2VAAA 3FUKA 3DXAD 4YDJA 4JFZH 4OFQA 5EU5A 6PCYA 1H5BC 3G08A 4N0UE 4OV5A 1YDPA 4Y2DC 5IWLA 1HINH 1PY0A 2IANA 4LSSH 5EZIH 3TFBA 2DYPA 4MHHG 3MBEB 1AOHA 1U8IA 3IAPA 3KE0A 4PHXA 3QNXB 4XPHL 1SVCP 2XIIA 3WN5A 4X7TB 4ZDHA 3DMMC 1KB5H 2G2NA 3QUZC 5CEXA 4JRYE 1I31A 1IZJA 1BLIA 5DMGC 3SBWC 1YEGH 3VD5A 1HEZA 2D3JA 1CFNA 5D9SB 2R2BB 1KXQA 3BKJL 3RL1B 2DY2A 4OI7A 1G87A 4HS6B 1R46A 2BIPA 2PXYA 3BWUC 3BZ5A 4RGNB 1SEBA 3SDDD 3B9VA 3QEUB 4L5FL 4LHUB 5I1AB 2BC4A 4Q9RL 2KI6A 5JTWA 1OV8A 5E6IA 4WENB 1VERA 2GCYA 2NNRA 4HWUA 3UZQA 3O8XB 1MRDH 4N2MA 4D8OA 2VR8A 1FBIL 3Q01A 2C3VB 3A3YB 4FTDA 2WZPA 3PXHA 3O2DL 4X50A 4ZSOE 5EF3A 2C26A 1IL1B 1K72A 3R18A 1TNNA 1CDYA 1IBDA 2NYKA 2HPTA 5TE6L 3HUJB 4AC2A 2LAGB 3LPPA 2ZUTA 4FQXB 4C4UA 4M8QA 4ZAKD 5F9DC 2IOIA 2WLYA 4EO5A 5C6TH 1MFBL 2BZCA 1NC4B 1IAKA 3O4LA 4OUUA 4TVPD 5B1JA 3TO2B 1LNUB 2OMUA 4OFKA 3CVIH 2FE0A 4ZUVB 2WMPB 3P30L 1XX9C 4OQTL 3ZDWA 5KSAD 2RH0A 5F97E 5JLZA 2C9RA 2JLLA 3AT0A 3ILPB 4XMPL 5IQLA 3KPRE 3UAEA 1AFVH 1E9PA 3V5HB 5TPWL 1MAKA 2BIOA 3O3DA 4WHTB 5AVWB 3FQ1A 3TX4A 4G6AC 2VW6A 2YAEA 1PZ2A 1GYUA 3ZSTA 1EBAA 3LD8C 1ZV9A 4G7YH 5DR5H 3L1FA 5EWIH 1FE8H 1FNSL 2YPVA 3SDAB 2TSBA 4G6ML 5DD0H 3HVDA 4QLRA 1L9TA 2JELL 3ZHDA 2CBTA 1MCPH 3IDGA 1INEL 1I1FA 1ZV2A 1Y18B 4LRNL 1CF8H 4EDXB 4S2SA 4ODTH 1XF1A 1BM7A 2FLRT 3DX4A 1XV8A 3W37A 1QTPA 4L4VE 5IV2A 2NWVA 2JKTM 3FQ4A 1GIGH 2KDGA 1QWUA 3QORD 5D8JL 3ARQA 4OM0H 4ECNA 2JSFA 4JFDE 3QHFH 4GUOA 1NGQL 3C12A 4OGQC 5E8PA 1U8QA 1BJ1J 4P06A 4WWOA 5IBTH 4B41A 3MV9E 4XZUA 1VLXA 2PABA 1Z9LA 3LSOB 4ZFQA 4CDGC 2IIJA 4G6FD 4R90H 4EUPH 2YGNA 1P2CA 5GPRA 2ZOKB 5KBKA 2OCCB 3S48A 4BA8A 1S78D 2NNXA 4X99A 1P4BL 1OKEA 2OOYA 3QWRA 1FNHA 2MPAH 2G75B 2NXYC 3DJZA 2OTPA 3KEHA 1HCFX 2DWDA 2YHGA 5HGBA 4LSQL 4FQJL 4H88L 5EC2A 5HGHB 1NMBL 3NCCB 2O6DA 1RVFL 2OL3H 3WNPA 3D06A 3SCMA 1E7UA 1LXMA 4PJ7B 1WWAX 1X4YA 2XNAB 1RZ8B 3GKZA 4WV1C 2QZ5A 5IKCA 1NEPA 3G5XB 4Y4KA 3HR6A 2EXYD 1EAPA 3QUHA 3ZTJH 4P2AA 5A2LH 4PJEA 1FRGL 1QI5A 4IHBA 1IGYB 3F7QA 4XODA 2XI9A 3TPKA 3FCGA 4D0DB 1L7TL 3B9KD 1OP3H 1KCRL 1VTOA 4DWHA 4GUCA 1SBSH 4P5MB 1HEJC 3UDWA 3U1QA 1I8AA 2D0BA 2VXUH 3BWZA 5EA0H 4HIIA 1MLBB 5GGUA 5DQDH 3PABB 5BVJA 2FKMX 1CDCA 1QLRA 1NIAA 4QRUA 1T2QH 4M1GH 4MJIE 3BEVA 3HFML 3TZVA 5K59F 1MRFL 1CXHA 2HLAA 5MP6H 3MUGA 2EC9T 1NDTA 1JWSB 5KSBA 1T04B 1MJUL 3RWIB 2O30A 4L2LA 1W0WB 1Y1UA 2X88A 4FKHA 4MNQA 3LHPH 4I5BA 5I17B 2X1WL 2JMRA 3DHPA 1N4XH 1ZT4A 2XTLA 2VCOA 4RX4D 1JE6A 4AJVA 4CMMA 2DD8H 3V0GA 1QN9A 1N8ZB 2N59A 2JK5B 2BNRB 1XR9A 5DVNA 4WU5B 1EFXA 4EAJA 5LNEA 5BXFA 2D2CC 2CO1A 2Y72A 4W68A 1GJIA 1MWAB 4PJCB 5CILH 2CH8A 2EXSA 5GS0L 3LHAA 4KROD 4EZKA 4YHZH 3RVTD 3BSZH 1CFVL 2QPUA 1TZHB 1V54B 2CHXA 2XV0A 3CN4A 4NZRH 4A7UA 4FA8A 2CRYA 3OGDA 1ROCA 2PYED 4UNTA 5I74B 3IB4A 2QKSA 5KS9A 2OTWB 3GSVB 5T5FA 2R0ZL 3T0EC 3WV0A 5IMKB 4JDEA 3W0WA 4ODHL 3NZSA 4O58L 4XCYB 1X5MA 2UXFA 4EUPG 2BERA 5IQ9A 2XBZA 1YEEH 1YQ2A 5LJYH 1KFIA 4UQBA 4GP8B 4F8QA 3ZSSA 3OGCB 4U33A 3NCFB 2AJVL 2HSIA 5AVRB 4E5XA 3QCUL 5IB1B 4D7RA 3RBGA 4YDIL 1FFNA 4WUUA 1TJGH 3HB3B 3V6ZA 2CIIB 1T80A 1ZK5A 4EXPX 1ZWIA 2J4WL 1RK1B 3I9IA 4PJFA 4DEPC 4GQQA 2DQDL 1QLFA 3DX6B 3VRIB 4XMZA 3FT2A 1AR1C 1EIBA 4Z23A 4KY2A 2OJEB 2EVGA 4AM0B 4XCNA 4RESB 1TCRB 3V0EA 3V4UL 3C6LC 3ZTJG 2P8LB 5KJRL 3PPSA 4CNIA 1HYSC 1EXUB 5IMOB 2FBJL 5F1IB 3QEHB 4XCCH 2XA3A 4XVJH 5J4MA 1AR2A 4RA3A 5EU3A 4KGJA 3WIFB 1ZLSL 4HC1H 2V8LA 3NH7H 1T66D 4NN6B 3ZHNA 5L2JA 4LU5L 1SLXA 2JCWA 5CIPH 5GRWA 4FD0A 5I5MA 4OLUH 1OSPL 2IQAB 3LH9A 4ZUSA 4KFMA 5A2JH 2IG2L 2YRBA 3QRGL 4JDZB 5EO0B 4G8GD 3HHSA 3KPMB 1ZT1A 2R4RH 3S98A 1I7UA 1KJ3H 4JY6B 4Y1TA 3RTQA 1JNJA 3AVEA 5I6KA 1NMCC 4F7PB 4MJ2A 1PBYA 4MCZB 2QT6A 4G7RB 4QTIL 4TNWK 2Z64C 1QN8A 3ARBB 4WFED 3HG0A 3MKGA 3SZKC 1THAA 1JNNH 2O5XH 5HJGA 3PUUA 4KVCH 3TIEB 4G1MA 1HKFA 1R34A 4CVZA 2WP3O 1BVNT 1GSMA 5ACMA 4JN1H 2VE6B 2GBTA 5PAZA 2ZNWA 5IG7B 1Q0XL 3TXAA 3QXAB 3MR9B 1BQ5A 4OFPA 3UO8B 2B59B 3CVCA 3NAAL 2XZQH 4RGMB 2LW3A 3DIFA 4M7LH 1R3HB 3DVGA 3D9AL 1JZ8A 4FQIH 4KJPD 4KY1L 3CQFA 4JPSA 5HHMB 1LEIA 2LLNA 3GBNH 4I77H 3RWDB 2Y23A 3E2HC 4GKSA 2XWTB 2F53B 1CXIA 4OZHE 1YHPA 3A6CL 4J3TA 4X6DF 4A2DA 4R96A 1CGSL 1MW1A 1OQOA 2MPVA 2GJZB 4PR5B 1U92B 3OLEA 2W07A 1R33A 2CIKA 3LZNA 5EF1A 4JL2A 4L4TA 4W93A 5KG9A 2XWJA 4NB7A 3BAYA 4QMEA 5B39G 5HPOA 4BZYA 4G8EA 3WD5H 1J3MA 3AC0A 1E90A 1F41A 3ES6A 1WRFA 1A9BB 4WJKB 5CJ8A 5AKSA 1OK0A 1TZ8A 5BV7C 4TUUA 5G5DB 3T0VA 3PJSA 4PIRF 1BF2A 5MEND 5F7NC 1E8XA 1XIWB 2OM5A 1L9SA 3WJLC 5DVOA 4LT7A 4M1DH 1HAUA 4ZX6A 3VE0B 1UOKA 2ZOUA 1AXSA 4ILDA 1Q1JL 3TJHC 5EMYA 2AJZA 2VM9A 5I6NA 4NO0A 2NT0A 3RVXD 3TO4D 3UAFA 1AJ7H 2ENQA 4HWNA 4K7PL 1FL5B 3IT8D 2YGPA 2YEZA 4QIRA 4LZKA 4X4YB 3LQAL 3DXAB 5EPCA 3W57A 1E6JL 1RP9A 2O5YL 2X6AA 4FYSA 3IMRA 3G9VA 5LN4A 4OZIA 2AANA 2GUYA 2P49B 4UQAA 3N06B 4PJIE 3VN5A 3G6JA 3LV3B 4ZX4A 3WGVB 2BK8A 3UGXA 1TKWA 3EJQA 2ZX9A 4K7FB 3S36L 4LSPH 1I1AC 2FWSA 4S1RH 6FABL 4RMVA 1F4WL 2ZCKL 5IW6B 4Q52A 2FUQA 3LKOB 1MI5B 1MY5A 3VI3F 3E1F1 5GSRA 1EZVX 2F58L 5KANI 4I1PA 1V7NH 1H9VA 3CFEA 1EVTC 4WW2C 4X9YA 4ALAC 1J1XH 2CCVA 1BD2D 3NIGF 5DD5L 3ETBJ 2OZ4A 3SGKA 3VFOB 1K2YX 1F11B 4H7VA 1J12A 1KZYA 1YYMH 4Z7UE 4P2QD 5DXWA 2FR4A 4DGVL 1CL7L 3LXAA 4XCEB 4YK4C 5CCHE 4UV7L 2R23A 2NW2B 5E94A 2DTMH 2JCCA 4OFYD 3SIKA 2OMZB 2HWZL 3V52H 3BDYH 5ALBH 3L4TA 3KWWA 5C8JB 1DVFC 4HIJB 2YWZA 2D7MA 1URZA 4ZAKB 3TYGL 3RZCA 3BUTA 3CWUA 1R5IA 1Q9LA 3BISA 3AWEA 3CDFA 4K8RL 2GTZB 4MQ7B 2EILB 3MROB 4JM2C 3GQFA 4D94A 5BO1L 1WQAA 2I60H 2UZYA 1UOWA 1YNTB 5I1DA 2XN9A 5FIEA 3CFNA 5D5MA 5FK9A 5DQJA 3BC9A 5ESVB 2R0WL 1M9SA 1N0XL 3FQXB 3WJMA 4Z3IA 1Q94B 2IPKA 4D9QD 2WLLA 1DJSA 4L3EE 1L0QA 5J13B 5EBMB 3OB8A 1EZVY 5EPMB 1H5BA 4YNYB 1PLBA 3KLHD 1LYQA 4Y2DA 4YDZA 2AFNA 2HFGH 2WB1A 3KHQA 4GIAA 4KTDL 3CV5A 2ISDA 3TV3H 1J1PH 3FRUA 2N4IA 4DFHA 2RJMA 3OMZA 5HYSB 3ULVL 4R4NC 1J8HA 4PP2A 3RIAF 5IMLA 3DMMA 2PETA 1EEYB 5D55A 4JFED 2B3RA 3QUZA 4OF8A 5HI3C 5TFSL 2FHBA 3SBWA 2ZPKL 1MZYA 2DJ4A 5TH2B 1NFDB 3T2QA 2EDTA 4G9DA 4UOZA 4ES9A 1SOSA 4U1KB 1BOGB 2Z0BA 1NGZB 3RAJH 1M5Q1 3WCYA 4N0YL 1TZAA 1AXTH 3E9UA 4ZK8A 1E5AA 1EGJL 2E7HA 3DROB 4Q0XL 5CP3H 2CGRL 1NEZA 4MQTB 2XV2A 1LEKB 2XWCA 3LZPA 2W0FB 1KLFB 4HAGA 1ZIAA 1BXXA 3QDMA 2ZP9A 1MFAH 3WFBH 3B9EA 5EBWB 3RWEB 3X12B 5LGHH 1HOCA 1NAKH 3F5WA 4NZUH 4LARH 4N2OA 4ZMLA 3QJOA 5TDPB 3DYMA 2PWDA 2WUCL 5IVOA 1YN7B 4FP8H 4HKJB 4R2GD 5F3FA 4AX3A 4HJSA 3QCTH 5DSCA 1F6AA 3V9CA 5EOTB 3EJTA 4EN3C 1EHLL 1NZRA 3DX8B 3BLKA 5GGQH 2P8MB 2XRAH 4JM0A 3O3EB 3R0MA 5INDB 1X5GA 4R97B 1G4MA 3DX9A 2PR4L 4HPOL 1OVZA 2A2QT 4Z0XB 5CINL 4JKMA 2FRGP 4X7SL 2YQBA 2F5AH 3T8XB 1E4XH 1SM3H 1DVQA 32C2A 3FPYA 3OWEA 4LNRB 3UAJD 3D0LB 2DPKA 1MDTA 4UM8B 4OJAA 1WICA 1NCBL 2VDQH 5MI0C 1R3IL 3GI9H 1CWVA 3O2WL 3B2XA 4G83A 4M4PA 4MXVE 2UZIH 3P4MB 4TVPH 3W3BA 5C7XH 3L17A 5DJZB 2ZUQB 2HZMA 4JRXA 43C9A 4JPVL 4DUWA 3QIWB 5KTEH 5F7AA 3RFZB 4W1TA 1JPFA 2R9HC 3TFKC 1AQKL 3UTSE 5AZUA 2FAUA 2VN6A 2VN5A 3OG6B 3GBMH 3H7BB 1GGUA 4O2EA 4HKXA 3Q2LA 3Q2NA 2NZIA 4APQB 4Z7QB 4C58B 1LK3L 3O3UN 4NKIH 4R7XA 4L8CA 2XFXA 4CVUA 2D0AA 3H54A 1GKOA 3EO9H 4GOSA 4PVLA 5BZXA 3C60B 4PJEF 5JIDA 1AZNA 1ZS8A 2XQYK 2H8PB 4QTHB 4JO2H 1E67A 4Y2LA 3IPEA 1EUTA 2Z31C 3CFCH 1OANA 3LNFA 4DESA 4JFQA 4MZIA 5DJ2A 3Q6FB 5KOVC 2FT7A 2HVKA 3K72B 1M6UA 2EXTA 4F24A 5HPMA 2H26A 4U6VL 3EH4B 4HH8A 2WXPA 2VZVA 4LSVL 1A2YA 2DZEA 5F88A 3G5VA 4Z77B 1PX4A 4UQ3A 5KSBF 1PZAA 3BVTA 4NQXA 4JM4L 1P69B 3CFMA 4BQ6A 4K3DH 1CLVA 4UQ2A 5EU7E 2K78A 5IFJA 3O4OB 2Q8AL 5IB3A 1CLYL 2VIRA 2WLMA 4P5TD 3G5ZB 3VFGL 1JS4A 4YLCA 4YHYB 2ITFA 4WV1A 2GVYA 4B6ZA 3KYOB 4N9GA 5I28A 4O00A 1ICTA 5AAMA 2H2PD 4XXCC 2ITDB 1KC5L 2YLKA 2G9HB 5JHBA 4E9RA 4IU2A 5DEFA 2E59A 2HVBA 3B2MA 5L8LB 3SD5A 3UPRB 3BE1L 4BSWA 4QO1B 2ICWJ 1J0KA 1P5UC 2YIHA 3ZIMA 4FQXC 1N7ML 1SN5A 3MJ9H 5DUML 3ESUF 3VCLB 3IVKA 4N0UA 2E7LC 3QZLA 1R3JA 1IB5A 2VERN 4JCLA 1LQSR 4XBPB 2MZ8A 2VISB 2Y5EA 1TZIA 5KS9F 1F2QA 5DDHA 1S7TB 5KYNA 3WL9A 1ET5A 4NQED 1MNUH 2SEBB 3H9HB 3T4YB 2EYRA 4HVBA 2VDKH 3LNHA 1NIBA 4KUCF 2K45A 4X83A 4DOHE 5EEVA 4UTAL 3T2NH 3PNWA 4K8RD 1VACA 1TXKA 2YD9A 1CGVA 3HBGA 3F01A 2H4EA 1XCWA 4LSRH 4P23D 3D69A 3LKSA 3QJTB 1FAKT 3E8VA 4HX1A 3ZE0B 1MFEL 3FW6A 1SJEB 2FGTA 3WSQH 5HHOE 2R2HA 4J5VA 4OGAD 3SDCD 5INCA 3FT3A 3EOYG 2IDCA 4HJGB 5CJBA 3QWOB 5EC1A 1MAML 3Q1EA 4P4RB 3RI5F 4PCKA 2CR3A 4OCSL 3V4PL 4POYA 3MBXH 4HWZA 4G8GB 3X11B 1F2XK 3ULVD 5AWNH 2EADA 4X6FB 3ZT5A 2H1XA 5IB5A 4XZ4A 4DERA 4WY7H 5JMVD 2HL9A 4NYLA 4RQQA 4BSVA 4KKRA 5HDBE 2IPUK 3FFDA 3IJSA 5IYBP 2NOFA 5FEBA 1FP5A 2GSGB 3T0EA 1CXKA 1I53A 2XQYA 4JFVA 4NO2B 4UNUA 4LLUA 1RZKH 3LN4B 4IBQA 5H94B 1DFBH 4EQ3A 1P0SE 2GIYA 4QRRA 2PLTA 1BAWA 1XH1A 4DN3L 5ECJE 3L7EA 1RZGB 4MVBC 2VDOL 4QXTA 4UM9D 2NXZB 5L9DL 2NYZA 2A7BA 2IPTH 2CDGB 2NX5B 3TCLA 4J6RL 1AMXA 1RQ5A 2VR3A 1OIOA 5HYQA 5H2BA 3HBPA 4A7VA 2VXTH 5I1HL 4FKEA 2J20A 2WWMD 4L8DA 4LCWE 5F1KC 3U2SB 1U8NA 1WZMA 3V79C 3GZKA 3ENEA 4FNTA 4DP4X 3VJ6B 3C6LA 4X5XA 4PBDA 2FEJA 5IVZB 3ABGA 4UIMB 2FGZA 3O2DH 2LHAA 3GGWA 4HGWA 4BFBD 3JXAA 1BGXL 2B77A 3I3EA 4LPWA 2LLLA 3W9EB 4IBWA 5DEJA 4ODXA 4CBPA 3FOMA 1DQLL 4FTVB 5F89B 4LAJH 1LE5B 4PRDA 1MFBH 4PJHB 1Z3RA 2NY1D 1P84K 5JYLA 1HH6B 2LU4A 4AG4L 5F7WC 1KYDA 3MV9A 2ZOLA 3DSNA 3L1GA 4BUGA 2DMBA 1MW3A 4BWUA 3OXRB 1H15A 4KK5D 1BA9A 1NBZA 1IC4L 1E40A 1XD0A 2UY6B 2HT3C 3FTWA 3QCVH 1QMUA 4PB0H 4YDNA 3TBWB 1OL0A 1TTFA 2DIJA 4M9PA 2R39A 3O6FB 2JJTC 2HTKC 2NSQA 1DQVA 2R1YB 3SGDH 5FYLE 5DWPA 4YSEA 4QAMB 2B3IA 3JWDH 5EU7C 4YXHH 2P5WB 2XZCL 5CUSH 2DIBA 3TVMA 5F6HI 4X7EC 3DXAE 2BP0B 4LRNH 2VO8A 1KJVB 5C07B 4NHUB 1CICB 4JFYB 4RDBA 1SF3A 3FQWB 1T7WA 3DURA 4XMUA 2Z8VC 2R69H 1PS3A 1CTNA 3CX2A 4HG4K 3PQYD 2V3FA 3I50H 5I74C 4XP4H 4OZIF 5GGVY 4M5YH 2V8MA 2M2DA 2AV1A 3QUGA 4P2QB 3G6JF 2BDNH 2H0EA 2J6EA 4FNUA 3WTYA 3IE4A 1WD9A 5E8NA 5B8CB 5TQ2H 1K5WA 1TTBA 25C8L 4QHMB 3P3TA 1IGIL 1M3QA 4H1LB 3JWOH 4LCYB 4HEME 5LVEA 4HIEB 4O51A 4M7JH 3VXRB 1EXGA 2Y8LA 3GDCA 5KYWB 5D7IE 1PX3A 3KPQB 3LMJH 2VL5B 2Q6WA 1RZJL 2DIEA 3WJLA 1M7UA 4F8OA 1I9RL 2HKFH 2HRLA 3PWVB 3F0ZA 1DBJH 3U82B 1DBKH 4TNWF 3P0YL 5CBAA 4XPGH 4KX7A 2GUOB 1RERA 2EZ0C 3EOBB 4FFTA 4NAMA 4R0LA 1RVFH 2HMIC 3ARVA 2VKWA 1WHPA 5ADOH 3WIAA 4V1DD 2JCCF 4X6EA 5IIEA 2DW5A 1NICA 3N43B 2KUTA 2UUDH 1BMZA 3A5VA 2ZXCA 4P8QA 1KJ2A 2W80C 4TVPE 3UH8A 5HD8D 5BVPL 4O4YL 4QXUL 3V5DB 1T03L 1IU1A 1THCA 5F7KC 3U0TA 2D9QB 4UBDC 2VMEA 4HPYL 4PMEA 1G0DA 4XNQA 3WEXB 4NN6C 2DEWX 2QPEB 1NGWB 2VMJA 3D08A 1U0QA 4WNQB 5ICXA 1CFSB 1GZPB 2R0LL 2ILLA 2OQJB 2UXGA 5D5MF 4NCC2 4AGPA 4OBRA 3ZYIA 4C7PA 4GUQA 2ZJSL 4HH9A 4F7TA 8CGTA 4JN2A 1BQLH 3VFTA 4ZUWA 5C08B 3ARBC 1I7ZB 1K6QL 2KH2B 5TDOB 5JXAL 2PW2A 3RA7L 5EU4B 4ERSH 2EYSB 5JUEH 1AQ8A 3PIQA 1B3IA 4EOWL 4E9VA 4U7KA 3ARZA 3EIKA 3I9AA 5KYXB 4AENB 4PJ9D 4XNXH 3U9UB 4MCYA 1WP6A 4PW9A 5E1GA 5JOEA 5IM7A 1URLA 4ZQKA 2BNUA 1N0LB 2ESVB 4AYDC 5CGTA 3OB0K 5T1DH 4Y1AB 3AUWB 1D5RA 1ETA1 3P4OA 5D6CB 3FB6B 4XNUH 3UABA 3UAAA 4KHTL 1VPOL 5JZ7C 3P9WB 1JI1A 4FA6A 3BWUF 2LU7A 4NERA 5GGVH 5K39A 4DP1X 4JM2A 1MIMH 4U3SA 4NJ9L 2X0UA 4K94H 3WO4B 1NCUA 4DUXA 4X6CB 2BCKB 3HC2A 3TBYB 1Z6JT 5C9KA 5DZPA 2X4UB 1F1GA 2AJXH 3H0TB 3FSZA 4TQHA 3UO1H 2NLJB 1N67A 4GQ9H 3FHEA 3R19A 3IFNH 5IB4A 2HRPH 4F57H 1J1OL 4KO5A 3R7QA 1YN6A 3V10A 4YHNB 5ICYA 5K9KB 1ZANL 1NL0L 5E4EC 1DQMH 1IBHA 2EEFA 2EH7H 2P24A 3MO1B 4HS8H 4PLJD 3WIHA 5FXCH 5J1AB 2RHEA 3G9AB 1EAJA 1E30A 5GQBA 3WUWB 5BZWA 3DUSB 5T1KD 5DHMC 3IEAA 3ZE2E 4GUPA 2V2XB 4EZMA 1OTUC 3UJIL 2YH5A 1XIWC 1SDDA 4PGDA 3MCLH 4NRXB 1ZHLA 2KMWA 3MXWH 4TSAH 5I6PA 4TSBL 1XEDA 3A0OA 3UZVA 2J4WH 1FLRL 1N5YH 4TLUA 4I0PC 2WTOA 2G0KA 3MLVH 3L3IA 3VXTB 4DCQB 5J06A 4XX1E 1JP5A 5EZPA 3UMTA 2G4GA 5KJRH 4E9WA 4G5ZH 4JGNA 1A6WH 2AS5M 3HE7B 4OM1L 5AL0A 3IDNB 3T09A 5EB9A 1JRHL 5F7EL 1O6SA 4HUNB 4OZHA 1W72H 5TDNB 3P2DA 1ZLSH 4AL8H 5EEXA 3OKEA 1FV1A 1R5WB 3CHXA 1EV2E 3EF4A 3QIBD 1X5ZA 5I0YA 3NIFB 3ETTA 1IT9L 1F97A 2AGJL 3PU7A 4EN3A 3CXHK 3QRGH 3UOAB 1FNGB 1F4YH 4I88A 5E6YA 1CF1A 1WBXA 4HUWB 4HGKC 1IO4C 4R84A 3D30A 4KMTL 1UT7A 5ITFA 1Y07A 3HA0A 1UZ8B 4AEEA 1KV7A 4MMYB 4ODUB 3SDDC 4Z7OF 3QZBA 3BPCA 4WSJA 5EULV 4PY8J 3CZKA 5IESH 3STZA 5E5MA 4XX5A 1N59A 3L4VA 3NJNA 2ARWA 3ZDYB 1JGVL 2FEEL 1IGTA 4TULH 5T3XL 3TC9A 4G82A 1Q0XH 2XETA 1T22B 3N40P 5B21A 1MQKL 2W65A 4RBPK 1LO3L 5JHLH 2PYEE 4K07A 1ZIBA 2AV7B 4JO8A 4WWKB 3WY3A 1GGBH 4TPRH 4ZAKC 3VXUD 3NEOA 4Z7NE 4I4WB 1XGUB 1JFHA 3SKOA 4DPRA 3JT2A 1GOFA 3ECBB 3L45A 4PJIA 1AE6L 1ACYH 4NQSA 5AW4B 3NPSC 1LO4L 3O45B 1D6EA 5CM1A 5KSAC 4RLDA 3VGAB 4N2FA 2O72A 1BZOA 1FNEA 5FDWB 4IK7A 5HVGB 4BUHA 4P23B 2WQRA 3FCUB 1KLUA 2VITB 3X1GA 1WZ1H 2Y6TE 5GZND 2NUTA 4X5WB 2Z31A 1MVYA 2FD6L 4JZNA 2EVFA 4X7TA 7PCYA 3SDCB 1QQDB 4F37K 3WS3B 1HNYA 1FFPA 4P5KB 4U1MB 2Y2WA 4HV8A 4PJXB 5C0IA 2Y25A 3QI9B 1IC1A 1NA8A 2MJWA 3RL1A 1E9QB 4LSUH 1YPZB 4EUPA 1VEOA 3R4RA 2VLKD 1TMCB 3K6NA 3AS3A 3QORC 5C1MB 3QEUA 2BVYA 5I1AA 5LQBL 4N8VG 4KMQA 4IBSA 2CQVA 4L1DA 2YOCA 2FEDD 1N64L 1I8UA 1H3XA 4QOKB 2I07B 4PIBA 1QABA 4C56B 2I32A 3D25B 3LN5B 4G8GE 3O8XA 4AXWB 4XXCA 4NXKA 3GSUB 2RIKA 1E4KC 2ICCA 3QWQB 4U7MA 1IL1A 4O02L 4NC1C 2PR9A 2OL3A 2VDLH 3GRWH 2EEBA 1P5UA 4H5SB 4WFEE 4FQXA 1AI1L 5E0QA 1S78C 5AOMA 4HBCL 1DYZA 2X70A 3O6MH 4RETB 1BECA 2E7LA 1P4UA 1B4LA 3TO2A 5DD3L 4FQHA 3RJOA 2BHYA 1K8DB 4ZUVA 3LH2L 4XOCA 4CRPA 1T89C 1PJWA 3ILPA 4JO1L 2CO6A 4ZUUA 3EHBB 3K8LA 5EIIG 3QR1A 2VYRE 3QZWB 4UV7H 2Y2TA 5AEAA 4ZFFA 4DVRH 1FL6B 3NK4A 1DZBA 2EXYC 2N0MA 3RX8A 1CZ8L 2XKUA 5L4MA 4RMTA 3M17A 1CLOH 2AEWA 4M7LT 4PRHD 3PV6B 4OLEA 1DL7L 3UC0H 2V0AA 5KVFH 3QIWC 3B9KC 1JPTL 5E7FA 3RFZC 4QHKJ 5KAQF 2WWKT 3EH3B 1D3UA 2F8VA 2ZF8A 4K8RH 5I8CA 4G8IA 1Y18A 2L7JA 5D2NE 3IS1X 5D96B 3BRGC 4XP9L 3IU4L 5JQIB 3LH8A 1E42A 1KCSL 5I6XC 5DC9B 5ESAA 4F33B 4Y19D 4IYKA 5MENE 5D7LB 3GK8L 3I02B 4ZRGA 3DA0A 4WLCA 3NOIA 3WNKA 3GSWA 4TNFA 1FAIH 2PPEA 5F93C 4XVSL 5D7JD 1YY8B 3PAUA 5C0RH 3UYRL 1WZAA 5HDQL 3O0RL 1EAQA 4MRBA 3ULVH 4UB0H 4OCXL 2R1XA 4M5SA 2X1PA 2J8UB 2ZOKA 3FU7B 3ZR6A 2XKSA 1VKXA 5JPNB 4NCDA 1RZKC 3ARGD 1ZSDB 2MQCA 2MFNA 2KQMA 2WD0A 1BREA 3RVTC 5HSFA 3DSFL 2NW3B 1WA2X 1S6NA 1GGYA 1JNLL 4NZTH 2NNAA 2LE9A 2EDFA 2HJKA 1IUZA 3LZQA 2XNAA 2IAAC 4YHYC 2W0KA 3W5MA 5DEGB 1PPIA 1UT1A 3U25A 1AGBB 3NIDE 5AVYB 1EO5A 2QDVA 4J8RB 4GMSH 1GYWA 3FQUB 1NWOA 3BP5B 5AW8B 2KHAA 3CCHB 1BD2E 4N0RA 2JV6A 2Z4QA 1YY9D 5DQ9B 3FTUA 2X4PB 4P5RA 4D0DA 5IMMB 4CSPA 3EJSA 5E4IA 4OGXL 4WJ5B 5AW6B 1EHLH 4P5MA 2AJYL 2A1WL 3TH3T 5T3XD 3CLFL 1SFDA 4JY5L 4F5CE 2V17H 4ZD3L 3J2PA 4RISH 2I25N 2PPCA 4YHOL 4Z7AA 3FFCD 5DHVH 4N2IA 3G6AB 1JWSA 3DO3A 3RWIA 2DH2A 4WRLA 3B3IB 3VD1A 1W0WA 3CDGB 4V1DB 3JQOB 1DLFL 2CA4A 4PRPB 2BFVL 4WEUD 2N0KA 2HN7B 5CCKH 5I17A 3I0XA 3WYRA 4GINA 1QKZL 4LLVB 2JJTA 2Q20A 4Z3TA 5BRZD 1UASA 3CFJB 1N8ZA 4AGMA 5EEZA 1FH2A 3BVUA 1MDAA 4Y8AA 3QJFA 4WU5A 4ZX5A 4D9QE 1AQKH 2I24N 1AP2B 1KIUA 1MWAA 1B3JA 4PJCA 5FB8B 4L0PB 4XHJD 3FTXA 5EO9B 3DARA 1A65A 1JGIA 3CW7A 4FG6D 3QUXB 4MJ5A 1QFUL 4IMLA 3QNFA 1E2VA 3OH9A 3SJVD 1NGPL 1TZHA 1DE4B 4CC1A 3GXTA 4YGVB 4PLOB 1IIIA 1QEXA 2OTWA 4JFEE 3LNEA 1UXLA 3GSVA 3F64A 4LEEA 2B0SH 5EFIA 1JAEA 3AREB 4XWGH 3ZTDC 3ZRCC 1F58H 2VJ0A 4PW4A 3APNA 4RFOL 5KBMA 5AENA 1MUJB 2HKAA 1MN4A 2E8YA 5BQDA 1NCCH 3ILQD 1XDTT 1UB6B 1RLBA 1FZKA 1ZVYA 3P2BA 4IRZL 2PPFA 3V0WL 3A4EA 4LSVH 3SO3B 2FWOB 3LVEA 2Z7ZA 5IB1A 2X2YA 4H40A 4ZMVA 4PREB 1DSFL 2CIIA 2CKBA 1HDMB 3ULXA 1IGJB 1RK1A 4I9XA 4R3SB 2VDOB 5HHOA 2XT1B 1OM3L 3VRIA 1OT2A 1QFWM 1JGUL 1JCVA 2NNCA 3NFNA 2OJEA 3TIDA 4AM0A 3PL6D 4H2AA 2HT4D 1HQ4B 1K4DB 1N12A 1TCRA 1YEHL 2CZNA 4IIZA 1GW0A 3MACH 3EDJA 5KSUA 2CO7A 5DK0B 1FG2B 3RX7A 1EXUA 5IMOA 4NZ8A 3QEHA 5CJXC 1DN2A 5D2NC 5F1IA 5TK4A 4AQAA 4Y5XB 1PVHA 4QGYA 4F92B 4MMXB 3WIFA 5I1JH 4JM2F 5DUMH 2YO3A 2IQAA 3K74B 4IM8A 2EVIA 5E24E 1JZ7A 1IKOP 1X5FA 4XC3L 5EO0A 2Z7YA 4X7CC 4IGBD 4DEWA 2H6PA 3O9WD 1MCEA 1FYTD 3RVXC 3TO4C 3SYAA 4U1SB 4MCZA 5JIKA 3GHEL 3CVDA 4YLQT 1JFQL 1G9HA 3ARTA 3ARBA 3GMQB 1OGAD 3QUMH 2IC2A 1KENL 1ZE3C 3D87B 4UMSA 1W15A 3ASWA 1T4WA 4I0KA 3P4NB 4NP4L 3ETSA 2ZE0A 4H8PA 4FQ1H 3FUDA 4LDCA 2LLGA 3O6FC 3MRRB 1KY6A 2FSEB 2PF6A 4W9EC 5IG7A 3QXAA 1BW8A 3MR9A 2CHNA 4WDIB 2B59A 4L1SA 3N5AA 3QIBB 5F3BB 1R3HA 4OJEH 4BKLA 3MRJB 5B39B 3V4PH 2BSED 2KZ1B 2WKLA 3JV6B 5EEUA 2OK0H 1MZZA 3LPGA 1A7RL 4N2KA 3OLPA 5D72L 3CK0L 3RWDA 3UGEA 1MVFA 1CICC 2A73B 2XWTA 1YUKB 2F53A 2VDNL 2JLPA 5J6GA 1E9OB 4AYEC 1EHAA 4Z7VB 1G6RB 3OF6A 3MLYL 3VWKD 1IAOB 2H41A 2CAKA 2GJZA 2IGFH 4CMHB 4PR5A 4JZJB 4XRCB 1G1YA 4LIQH 1OTTC 2ADJB 3OR6B 4OZHF 2C4XA 3QUYD 4M5TA 3O41A 4ZMPA 3P11L 2PW1B 1G7HA 2YXVA 4WQOA 4P46D 2F7LA 5G5DA 2GJPA 2IH3A 2KLTA 4GEJA 2XVGA 1XIWA 1WAPA 3VXUB 2VR7A 4N22A 3VE0A 2OCFD 4WZSD 2FK9A 2E9IA 3IYLW 1TR7A 3WFEL 2CLRB 3K8MA 4I0PA 3HMXL 3ZKXB 5CIPB 3EO1B 1BVKB 3AMKA 1GHFL 2DN7A 2NZ1A 2XVKA 3ZDZE 2VC2H 3KPTA 1QR1B 3WI9A 4P07A 3DXAA 3B2DC 4S0HA 4HWBL 2QQLL 2O5NA 2GAZB 3KLHC 2EH8L 1NBVH 1BAFL 3SDYL 1UWGL 2FO4B 4F58L 3D2UB 4MA7H 1IVLA 3F10A 3O3AA 4F3FB 2J8OA 4NQEE 5KVFE 2DDQH 5CP3A 3ZOAA 1EQWA 1PSKL 3RNQB 1WWCA 3H2PA 4AMKH 4A38A 2Y07L 5IW6A 4PJIF 2W91A 3WE1A 1KPVB 4W4OC 4QRPB 2HLEB 3MLTB 2JI2A 4PJGE 5FF6B 2YAPA 5DO2D 4P9HL 1B0IA 4HEMA 5DC4B 5CO1A 4U1NB 1RJZB 2YMOA 5AZEH 1JXJA 2GSMB 5D7IA 4ZMQA 3WN6A 4AJ0A 2F61A 2HZHA 5FCSH 1NCGA 1IZKA 4LLYB 5FM5M 4YC2C 3CWTA 4G42B 4XCEA 2DQJH 5KVGL 3D85D 1J0HA 1AD9B 2NW2A 3ULVE 4LP8A 1UJ3B 2OMZA 2WTRB 5C0CB 1H3VA 4JGMA 3VYPA 3KGRA 5IBUG 5BJTB 1TVHB 3BHBB 3FUJA 3C9NB 4NUMA 4GS7B 3VD7A 2BZDA 4GT7A 4Z95H 1YMHB 3EGDA 5E1AB 1TVDA 1A25A 4ZAKA 2OS7A 4PJ5B 2X6UA 1FIEA 4MQ7A 1YYLH 1X4XA 2GTZA 1OE3A 3MROA 3ZYOA 1CFTA 3OMIB 5JIMA 3B3BA 2L3BA 3WO4C 1YNTA 4ODWB 3M8OH 2RQ8A 1KYOK 5DD1L 2XV3A 2ZT9C 4F7MB 1ZV5A 5ESVA 2G60L 4DP8X 1SQ2N 1Q94A 2WQWA 3L3JB 2VJXA 3HLKA 4A37A 5EBMA 3UAJC 4GW5B 5B38G 1WJ3A 1VGEH 5DFVD 4ZUTB 3EUDA 4WSKA 3MOBH 4L18A 1TJHH 4GAYB 3K2MC 3HUJF 4BZ2L 3OC3C 2RMNA 1UL7A 5HYSA 1D5ZB 4TQ8A 5JW5B 4U1LA 2AQPA 4NP9A 2G0LA 4ZO9A 1DZ0A 4Z5RB 2R29H 4OCWH 4EDWH 1ANUA 1UGNA 2X6BA 3FUMA 3P0YH 4OFIA 1WBZA 1BQUA 5TH2A 2NQDA 4JFFE 5EUKB 5GRVK 4LPVA 4U1KA 5F1NB 1BOGA 1NGZA 3ESVF 1ZLDA 1R0AL 4M00A 4D3CL 5LBGA 3DROA 3GXFA 4NJAL 2HKPA 4TVSa 1LEKA 1MHHB 2VTFA 2HZSA 2W0FA 1CQKA 4PYGA 5G4MA 3HZMB 2UY7A 2FGWL 4JG9A 1ET8A 1P9MC 3H9ZA 5D7JB 2CMRH 5EV7A 3A4DA 3X12A 5EBWA 3RWEA 3V7AG 2EO7A 1QUNB 3QAZB 5AYUL 1AY1H 1E4KA 5TDPA 2EE6A 3P0VH 1WCBB 3AU1B 1YN7A 4HKJA 1FSKB 3DBXB 2AQSA 1UEMA 1P7QB 5EOTA 1T5XB 4JPIA 3DX8A 5IR1A 3E6HA 3PWPB 3ARGB 4IDJH 4DQAA 1CVSC 2P8MA 3DHMA 2D7QA 2W59A 3HS0C 3VG0H 5T1JA 5IW1B 5D1QB 2MCPH 4JQIH 5IBLD 4Z0XA 2D8KA 1EJ6A 2WSKA 4YFDB 2YQ2A 1KJMA 2OSYA 3SQBA 1T89A 3T8XA 2YD4A 3AXIA 5A7EA 3MJ9A 1GY1A 2ZCHH 4W9HC 4K73A 2D9CA 4LNRA 3Q2WA 4G8FA 1KCVH 3IS0X 5IY5B 3MC0A 4P59L 2Y7LA 1NCJA 1B6DA 3OKYA 3MNWB 1NAMH 2ICWB 2ZX6A 2OMYB 2H2PC 2AP2A 3C6EA 3QHZL 3P4MA 4XI5D 5D4QA 5DJZA 2XWBA 1GZQB 4QF1B 3PQYE 3QIWA 3B9KA 2IGLA 2OP4L 4YE0A 1OGTB 3RFZA 4XBGB 3A67L 1IJ9A 3H3PL 3EKCA 4MXVF 1E27B 2WXFA 3RHWK 3VRLE 5IUCA 2VLRB 3G04B 1AD0B 4UWQB 4DW2L 3H7BA 3EG9B 4PD4J 5I5RA 3MCKB 1CL7I 3LXCA 2X4OB 5DJDB 1BJMA 2ZICA 5D70H 3S9DB 1IILE 5LB1A 2X40A 3GBEA 2J25A 3TM6A 3WHE1 4UILL 1OXYA 3ZY7A 2E76C 2HG0A 4ZNEE 1H3GA 2Z91B 4G6KH 2A6KA 4K8RC 3C08L 2C9QA 1IC5H 4P23C 3C60A 3KS0H 1HYRC 2WIIB 3L9RB 4QTHA 4RX4A 5FO8B 5SWSD 1INQA 1TCMA 1NANH 5F1OB 1A7QH 4RFNB 3TCXA 3OLDA 4GG6B 4OGAC 4XE5B 4PPTA 3SDCC 3NACL 4TQEL 4FNLH 1VFUA 3TP4A 1IC7H 3ZZQA 4B97A 1NDMB 2QGBA 2WOBA 4V1DE 4YSTA 3OAUH 1FIGL 2IWGA 1CPUA 4Z77A 3KM2A 3KR3L 5EIVA 2CJ3A 4ZS7H 2WBJD 2YS4A 3QI9C 1F8TH 3ULVC 3NCEB 3GSNL 1B0GB 3SE8L 2DTSA 1I82A 3K4DA 3SQOH 1OQXA 1NCDL 2X3AA 3KHOA 1PCZA 1T21A 3G5ZA 3OC5A 1RH8A 3D0AA 5DS8A 2CGZA 1SHMA 4OM1H 3KYOA 1A7PL 4JCWA 3GXMA 3GD1C 1PLCA 2QQNL 2Y1VA 4GRWB 5T3ZL 3AS2A 1U8PB 2G9HA 1DJXA 1SVZA 2CR6A 4TNVK 2LVEA 5GRUH 3UPRA 4PJCF 4CU6A 3NVQA 4B9ZA 1FVEB 3MBWB 2AGJH 1Z0NA 2APVA 3OJVC 3ASMA 2HJLB 3ATFA 2IADB 2FB4L 4TVUA 1KG0B 3VCLA 5F0LB 3ROLB 3BAXA 1S9WB 3O2DA 4KMTH 12E8H 5ILTL 3FO9B 4L9LC 2VISA 4OLWL 2VDML 3DX7B 3VFVB 1PAZA 2ZUUA 1S7TA 5IUSA 3T4YA 3H9HA 5AAWC 3LS4H 1FF5A 1DCEA 2RFXA 4TRPL 2A6JA 3EYQD 3OAYH 1A14L 2A6IA 4I2XB 4KTGA 2WXLA 4JRFA 3F7VB 4XH2A 1BFVL 3SOBL 5DT1H 4QAWA 2H2SD 4OQTA 1SJEA 3ARFD 2WYHA 4H20H 5E7BA 4MS8D 4NNPL 1XMWA 3QYMA 1HJBC 4TXVB 1S8DA 2I27N 4Z6AT 4KH2A 4HJGA 3IM1A 1GL4B 3S5LB 3ZO9A 1UA6L 4PLKC 2EDBA 2NY1C 3L2LA 4P4RA 5ID1B 4KQ4H 4N6RA 3L95B 4PRIB 1N6QL 4G8GA 1MH5B 3X11A 5D96C 2K8QA 1AE6H 1M3IA 4GO6B 3WTSA 5IOPA 2HX8A 1LO4H 4UT7L 3T71A 2CK0H 1Q9KA 4DQOH 4YDKL 5GGRB 2K1MA 2CPUA 4NC2B 1E6OH 1P1VA 5F71A 3HKFA 4AT6B 1SQMA 2YWYA 2YK1L 1AAJA 4K71B 4F15C 3A6BH 3CFBB 1EEZB 3LN4A 3UPAA 1JWUB 2IGTA 5H94A 5FKAB 3U4EB 3F58L 4WI7A 4GAGL 3FH7A 3FTZA 3MLUH 5F7DB 4NENB 3V7AE 4WNSA 4QJ4B 2VH5H 4OCNC 1WK0A 3SY6A 1RZGA 1AZBA 2QVTA 2HKHL 2ZAHA 3RWHA 3H56A 5DUPL 3ZZSA 3I3WA 4KI1A 4KZEH 5JPNC 3CMGA 2DLHA 4HZAA 4JKWA 1T0OA 2KQNA 2CDGA 3T6QC 1EANA 1YJDL 3RLSA 5AKTA 2OX5B 3QJVB 4UCFA 2XYCA 3BEWB 1T20B 2Z35A 2I26N 2ZQKA 3OKDA 5LQBH 2WQXA 2W9DH 2W60B 3U2SA 4N0CC 1KGIA 3JTTA 4IW4C 3BESR 4OJFH 3VJ6A 4OD1L 1X5HA 1N6UA 4TNEA 3FSWA 3QUYB 3VXMB 1EXHA 5CJXA 5IVZA 1FVCB 4LAQL 3QPXH 4S1SH 4X0KB 3I9GH 4O02H 4P46B 4GKNB 3VAEA 3Q6GL 4BJUA 3W9EA 5AZ2L 1K3IA 3D4GA 2X2JA 4O2FB 3FH5A 4WEBH 3STBA 3U4KA 1LE5A 1PKQE 4PJHA 1M1XB 3K0YA 1NSNH 5CZRA 1HH6A 3FTSA 1Z2KA 3BLBA 1U6AH 2WBXA 4YHKH 2BIIA 2WAQA 3TO4A 5DLMH 4IK6A 3OXRA 4WF7A 5E8OB 2BX5A 2UY6A 3VQ1C 2VOTA 4KC3B 2DKDA 3ARDD 4JG0L 4C83B 2EO1A 3VXUE 4NFDA 1W16A 3SOTA 2AXJA 1QX1A 4HD5A 2YA1A 1HZHL 3IFLH 3NSFA 3CU1A 3O6FA 3RB5A 5HD8C 5HY9B 4N1CA 2JTDA 1SFHA 4NKDA 4XPFH 1UENA 2HLFD 3MLXH 3PHQB 1KGJA 1RD6A 3G3LA 3NQKA 5H37H 2DICA 1FVDA 3NRFA 4JHBA 3RVWD 2BP0A 3EZ8A 3BUIA 5JHDD 1DJYA 1SLVA 5C07A 4NHUA 1CICA 4JFYA 1YYCA 1X9LA 4OZGB 4X5QA 3FQWA 4CBZA 1BCIA 3S4SA 3RGBA 1I1YB 4EBQH 2F2HA 3EJCA 3TCTA 5HBBA 4OLVH 5K69A 4M9OA 3HRPA 2C5DC 2E46A 3VI4E 3CJJA 4PJAE 4NM8L 1M2VB 3EYUL 1BLNB 4Y4KD 4P2QA 4EZLA 1AYOA 1BOYA 1J5OH 1KY7A 2QPSA 3LPFA 2DMKA 3EYVB 4F5CA 3UYRH 1G7LB 2KLRA 1BZ9B 3GMNB 4H1LA 4OFYA 1VADB 4KDTC 4PJ9C 3V9FA 4LCYA 3X14B 2BY0A 4B9KC 3T2PA 4KV5F 4RFEB 3VXRA 3OQRA 2VLKE 3MFFB 3B5GA 1BF5A 5DJCB 1TEYA 2WN2A 5AVZB 5GISL 3FU0A 3DECA 3PWVA 4MNGE 5EEYA 2YJLA 2A38A 4AMXA 3DYOA 5CCJA 2NY5H 3EGXB 2A74C 5D7IF 1W8EA 2CRMA 2GUOA 3GXNA 5AYQA 2OAAA 1VKLA 1SN2A 1NPJA 5IQ7L 2F74A 3NZ8B 4N8PA 1HILB 4PV1C 4RWYL 1V7ML 3KTUA 1OF0A 2WB7A 3MXVL 5AG8A 3NABL 3MKKA 5E1HB 2AJ3B 5JPMB 1QATA 4IBLT 4TL4A 3S5YA 5ESQA 4WI2A 2JPIA 1PY9A 2UWEE 3D48R 2X41A 3PGFH 1GGIL 3H42H 3O6KH 3PWLB 1Z0MA 3DI3B 4Y5XC 3V5DA 4DKAA 1KCKA 4PLJC 1EFXD 1KPRA 1ZDSA 4JAMB 1A3QA 4MMXC 2JKWA 3EBHA 4UINH 5FW8A 1MG2C 3WEXA 1ONQB 1TU2B 2N56A 4AH2B 3KJ6L 1JZIA 1NGWA 2PTTB 3H85A 4N5ED 2V33A 4JY5H 4W4OA 2DBLH 2IAMB 3PDOB 2X7LB 1YNTF 1CFSA 3FN3A 1VSCA 4WNQA 5I6MA 4ZD3H 3FB7B 4FX5A 3VFPB 3WIIL 4HU8A 3PGCB 4EJZA 2AK4D 3U4BH 2QSTA 2O5ZL 2E5EA 3K46A 2ZKHL 1JPSH 4XPAH 4PRHE 4YEEA 4IBTA 3ARPA 4TMPA 4ZI8A 1D7CA 2ZKXA 1A6UH 3DJ9A 5E6SB 3VM7A 4XO5A 5C08A 4ACTA 1I7ZA 3PWUA 5TDOA 2IOOA 5CD5D 2XHNA 5EU4A 1JGEA 3DVNB 3SKJL 1MFMA 5AKRA 3ZR5A 1OPGL 2YBGA 4AENA 4YSAA 5H37G 1I4FA 3U9UA 3UZEC 1XCXA 1C5CL 1VZHA 1N0LA 2ESVA 2FYYA 2YBRB 4Y19E 4YE4L 3QIBC 4UQCA 3REWB 3T08A 5D6CA 2P1YA 4KNUA 5E1QA 4QLWA 3L16A 3Q9QA 1N3NB 1MCNA 4JZOB 4KFZC 5DU7A 3T2OA 1TQBB 5FFLA 3RPJA 2BCKA 5AW7B 1G5GA 4HYTB 5DJXB 3TBYA 2WQVA 2X4UA 3H0TA 1NFIB 3UTQA 4CMHC 2NLJA 1F4AA 3MOQA 1TQUA 3VFUB 3QG7H 1MIEH 2VDNB 4MRQA 2O4EA 4YHNA 5K9KA 2KERA 2ZZUT 1E7VA 1KTDB 4HFUH 1H6FA 4Y8DC 1YEJH 5J1AA 1JZHA 1Q9WA 3ULSA 5IZ7A 3FHQA 4OLYL 3TJPA 3WUWA 2EABA 2FX7H 2P43B 2P5ED 3ELQA 4IRZH 4Y5VB 2V2XA 5F3HA 4QG5A 5AD0B 4MXWL 3BZEB 1IVTA 1I7TB 2Z92B 5CWSB 5LUMA 1WD8A 2GY7B 1AKJB 4FABH 1DSFH 5HDRA 4GAJL 1CLZH 4BQ8A 1YEFH 3ZE2F 2A3TA 3ZKXC 1YEIL 3DGGA 3QQNA 2K0RA 3EBIA 4YAQB 1HQRB 1JGUH 1RZJC 3IBEA 4A63A 2WVTA 3VXTA 5I73C 2D31A 3N85L 4DCQA 2VXVL 1RUML 1PZBA 1N68A 3GMMB 3CMOL 2FJSA 5T3XE 3TOPA 1P53A 3TASA 1P9MA 1IQWH 1OAXL 1VJSA 2GJ6B 2Y9RT 3KJ4C 1J5IA 4F8LA 4O2CB 1JK8B 3CN0A 3IDNA 3SKNB 2GIXA 3FFCE 3MREA 4JPKL 4XOAA 1MPAL 2WWNA 3LPWA 2HJFB 3D8MA 3DV6B 4XMLH 5TDNA 2QLVA 2VXSH 4PUBH 1BZDA 5TE7L 4CJ1A 2WQAA 3HI6H 4FEMA 1BV8A 3QJXA 5DMIL 1F6FB 4F1SA 1NPUA 3SE9H 3FCTB 1FNGA 1IGCH 4TPSA 2YUWA 4Z7QF 2EDOA 1T1XB 3OBAA 3HS0A 1IX2A 1QRND 3PPEA 3TU6A 4DGYL 2VUOA 1TUPA 5BRZE 3WKQA 4MZ2A 4MMYA 5HYJB 2FJHB 5FWRA 4R4FH 1D7FA 3SKMB 1KENH 2HL8A 2Z7UA 4MKMA 4JPWH 1KIRA 2FEDC 2EICA 4NKMB 1NMAL 4OIIH 1U8JA 4NZFA 2ZWZA 3U9PL 3DKHA 4JB9H 5KUMA 4F2MB 3S3JA 3DOSB 4NWTL 3MRPA 4FL4C 1UJ3C 3ELAT 5FW7A 1RHFA 2Q76B 3QSKB 2AF2A 3SJVE 1M53A 3K2UH 4HCRL 3WDJA 1GPOH 4GS7C 5LWYL 5SX5H 1OF2B 3HI5H 4HKZA 5D7HA 3AXLB 4IRJB 1YECL 5DVPA 2YD3A 5EOQL 1KXVC 2F5BL 3NSYA 3PGDB 2ZAGA 3US1A 1R3LB 3QO0A 2B2XH 3DHJA 4BH7A 4NO0D 5T1LD 1XGUA 1UA3A 4GRWE 3ECBA 3P3SA 4ENZA 1B6UA 4GT0A 2VWEC 4OQ1A 4NQEA 3ZQXA 4OGYH 2EIDA 3O45A 4QRSA 2DM3A 1FFOA 2JKRM 2MEJB 1Q1PA 1UD2A 4W9CC 3TH2T 1WISA 4ZPTB 4P23A 5GGTH 1W6LA 4NRZB 3S8GB 1XXFC 2WWOA 3II1A 4PJGA 2VITA 4NM4H 4Y4HB 2JXMB 3NN8A 3MQIA 1ML0A 4GI8A 3CN1A 1DVUA 4R9HA 2HRHA 2XVBA 4PCSA 4X5WA 3ME0B 3SPJA 3HE6D 1VF5C 3R4DA 2WNKA 4M6ML 2FATH 4A6YH 5J12B 2UX6A 2XA8H 1YAIA 3NA9H 3MV7D 3SDCA 1QQDA 3VH8G 3WFCL 4HJ1A 2QHRH 3WS3A 1XAUA 4POUB 2BP3A 5L7XH 3KLAA 2IDSA 4J28A 4P5KA 4U1MA 3HLAB 5I0WA 4PJXA 5I16B 1CU4H 1GC1L 3HMXH 3ABLB 3QI9A 4UT6L 3FTGA 3U79A 1GHFH 1MREL 3OAZK 4QXVA 2P42B 1YPZA 3GMOB 2QSCH 4O9HL 1IFHL 1YMMD 4KK9D 4GKZB 4XTRD 4LEXH 1TVBB 2RTTA 3FC8A 3RP1A 4F7CB 2VM4A 1UOVA 2SODB 2W1NA 1AKPA 3DETD 3ZE0F 2KPNA 3CLEL 2I07A 1D3CA 5D7JC 1Y0LA 4C56A 4F58H 3M45A 3LN5A 4AXWA 3NJVA 3T04D 3GSUA 1BBDH 1S2EA 1FYTE 1EGJA 4XNYL 3W38A 1LE9B 3I6GB 3HAEB 2KKQA 1HIMH 4XPBL 4WUKL 4LVNB 3RZCD 3PHOB 1FSKC 1OGAE 4UM9A 1E50A 4GFTB 3SE4C 3BVVA 2F19H 4LSTH 2C1OB 3ARGC 2QQKL 1O9ZA 3QIUB 2XN9D 1TPXC 1B4TA 1T7XA 2E9JA 2K3HA 2XN1A 3ZT6A 2ZP8A 3GUTB 1JL8A 5AAWA 3FT4B 3GBLA 3FQ2A 1JRHI 1MOEA 4G9FB 1HL9A 3UROR 3HZVB 3MRDB 4FFWD 5ITBH 3VXQA 3QZWA 5GRYA 4YSSA 1FL6A 5JW3L 5F21B 1XTMA 1QO3B 4JFHD 4Q6IB 4QRQA 4AJWA 5FM4A 1J8HD 5F7LB 1S5IL 4UQIM 1YY9C 5IJVB 4NKOA 3LDBB 2BJMH 5F9OH 1DVZA 3OKLB 1QN4A 2NR6D 4NQCD 3Q7JA 5HYIA 4HZLB 4M43H 3V6FB 3QB7C 4RMUA 4HOMA 1MRCH 4XC1L 4YGAB 3OX8B 3TBBA 2QVKA 1UC6A 1JV5B 1ZGLB 1RURH 1PDKB 2WVVB 4L3AA 2ZKYA 2FEEI 2IV8A 5D7LA 4C4BA 3I02A 5IEKB 2A6DB 3ARDB 3QDMD 4N5UA 1GAFH 1QN5A 1BZ7B 4MAUH 3M46A 3S96B 1C12A 2WBWB 2OOXA 4RGOH 3RNKB 2CO4A 4FQLH 2AEQH 3V0VB 4AK2A 3RZWA 1IFRA 4RRPG 3K6SB 1NKOA 4PJHF 4BE6A 1CFBA 4XCFL 3NMEA 3OC8A 3TBVB 3FQRA 3FU7A 3CXHJ 5JPNA 3BT2L 4R26H 3BGMB 5LGJB 1KSRA 3CPLA 3IMSA 1ZSDA 1BEYL 1MCJA 5FUCC 5FYJL 2DI7A 3MZTA 2DQHL 4FG6C 3VWJD 3N9GH 4N90D 3IWVA 2X1XR 2ZKWA 3OV6A 3MV8B 2J44A 2DRUA 3MJ7B 1RCYA 3LZFH 2WNWA 4M56A 5K9JL 2NY7H 4AIOA 2X0VA 4YO0A 3K3QA 4NZDA 5DEGA 2X2IA 4F20A 3BVWA 1JFIC 5DRXB 3GSNB 5JXED 4JRXD 3HOGA 1EDYA 4ROEB 4J8RA 3TWCH 3FQUA 3MVSA 2E27L 4KQ3H 5JQ6L 3CCHA 2CDEB 5K59E 1RUPH 5DQ9A 3Q2CA 5FGCB 4AYSA 2CDFB 3H9SE 4N2GA 5IMMA 3DK0A 3ILQC 5E56A 4WJ5A 2EC8A 4ZNEA 3FB5A 1AS7A 3WNOA 5EN3A 1HKLL 5E51A 4GBXB 5IVXB 2Q7NA 4PRAB 3B5HA 3HZYA 2VZUA 4BM7A 1BQHB 2XZAL 3KAAA 1K2DB 3L81A 3G6AA 2RCSH 1UZGA 4NAJA 2YPVH 4WU7B 3ZXAC 4WFFD 4AUYA 4TTDD 1UM5H 2B8OT 3CXDL 3RURA 4Q14A 4NUGH 3U83A 3CDGA 4V1DA 3PL6C 4Y88A 4AGNA 2HT4C 2MNWA 1RI8A 2VDMB 3AITA 2FL5B 3MLZH 4W9DC 2HN7A 2Y22A 1AZRA 1G0YR 4P2RD 4B60A 3FKUS 1IKNC 2X53A 1VOKA 3REVB 4AYID 3LRHA 5GGSB 1NLDH 1H3PL 2LR4A 4UTAA 3HBQA 1CCZA 3MHZA 3SE6A 3A67H 1QSZA 3X1NA 4BDVB 1TETL 1FGNH 1VB9A 1AP2A 5J6SA 2VJ8A 1OEZW 1MJ7L 1XF3B 4BCZA 1TG8A 4IOIB 4CADB 1N3CA 3HKZA 3QUXA 3RY5A 3O9WC 3MRMA 1XSIA 3N43F 5CEYB 3KEDA 3FCSB 3V4PA 1JTTA 3IF1B 3C08H 3CSGA 3LEVL 2UV3A 3QW9A 5BZDB 3S8WA 2ETWA 1O6TA 4KDWA 4NWUH 2NZ9C 3K71B 1HZLA 2VT0A 4K71C 3NZHH 3HG1E 1LDPL 1AOZA 3IKKA 4ZMWA 2AABL 5I1IH 3FU9A 4KDTA 3JVFC 4N3UA 4PFEA 4EI5B 1IBGL 2DKSA 2BFGA 1CE1H 4U3CA 4P4KD 3NACH 2FUTA 2OSLA 1MUJA 2IXQA 1GY2A 5AVTB 1Q0YH 2OJZH 4ABQA 3HFFA 1UB6A 3ZE1B 4ZODA 1DN0B 5DS2A 3NCMA 1KELL 4XMVA 3VFMB 1BFOA 3X3GH 3P54A 3QJHB 4MA3A 2X6CA 4PREA 1FFRA 1OE2A 1OLZA 3VXPA 3FN0L 1IGJA 4BUQA 5CSZA 2QEJA 3KXFB 5JYMA 3ERXA 2GFBB 1RK7A 3P77B 1LILA 1S5HB 4DN4L 4B3VA 1ZT7B 3FO2B 1ZVSB 4L8BB 1IBFA 2G3MA 2Z0UA 3TEUA 3L3OB 4LP4A 2Y7SA 1HQ4A 1K4DA 3QK0A 5F0JB 2YPLB 3S34L 1A7PH 1H8NA 1HH9B 1UG9A 4GW4B 2HVJA 1ADWA 4HXAH 3X17A 4GLRH 3CIAA 1FG2A 3QUYC 1ED3B 5DF0A 5DK0A 2VDRL 2NSXA 1XGQB 5C0AD 2XQBL 1OAUH 4OCLC 4Y5XA 2DJSA 4HIHA 1I8IA 2FJFB 4AEHL 4P46C 2VABB 4WFGD 4MMXA 3LVTA 1YEKL 5BO0D 5T1KA 2Q87A 1VDGA 5CD3A 1UM6L 2HFTA 2FB4H 3FYEB 1O5DT 4ZOAA 2VW7A 3WTUA 5CJQL 3NK3A 5E99H 1MQ8A 1KMGA 1KBKA 3R1GH 3PP4L 2K7QA 3Q8CA 3T65B 2EDEA 2Q2LA 1SJHB 2YR3A 3WOVA 3GXDA 2X4SB 4FCAA 2OSWA 2PCXA 4TRPH 1L0XA 3T0ED 1MFCH 2F7IA 3GMQA 4CKQA 1GOGA 1S7VB 2D7TH 5I71B 4PRNB 1YNLH 4QRRD 3WTWA 1QHPA 1I9JL 3SPVB 35C8L 3MPCA 4AVIA 3TTSA 4JG1H 2KL6A 1YTBA 3MRRA 4PJ8D 3UZEA 2BHUA 2FSEA 1LQBC 3TA3B 4LCIL 5F72S 2Z6FA 4WDIA 2E9BA 4LK4A 1A7NL 2E9WA 3QIBA 1E5YA 1LO2L 3WEMA 1FORL 1XGPA 2I5YL 5T5FH 4J23A 2B4CL 3KRMA 2FO8A 4AQ8C 2O61A 2A73A 5DO2C 1AR1D 3QFJB 5FC9A 4YDKH 4DKFL 5FDYA 2IJ0C 3IETB 2QVFB 1Q72H 1AZUA 1IAOA 5E00B 2B9AA 4E2OA 1XGRB 1HYSD 4JO4L 4JZJA 4XRCA 4QKXB 3OKKA 2V9UA 3OR6A 3WKMH 1MCOH 3Q05A 3NP3A 1PTZA 3K2IA 2PW1A 1OHZA 2FWUA 3NIFF 3O0LA 1G9NH 5I30H 3DX3A 1L3WA 3N44B 2HKHH 3NEXA 4G71B 5DUPH 1NIFA 3NCXA 1QBLL 3ZK0A 4IEFA 2WNXA 3NJJA 1OAQL 3VXUA 1NCAL 4HWEL 3HNTL 3BAJA 4M3KB 2VDPH 5T1LB 8FABB 4LGPB 2C9SA 2CLRA 1ZHKB 4BK5C 5HI5D 3EO1A 1ESOA 1NC2B 4IQHA 1IEHA 1C16B 1MFNA 1J8RA 3D4ZA 3B7UX 3RPBA 5C0EB 3NFPB 3BDXA 4Y16B 2V5YA 5KVGE 2QGDA 4KVPA 1QR1A 5C2BH 1RK0B 1YQVL 2V2TB 5JPMC 2GAZA 2XTJD 5DFVC 2QRDA 3VI3E 2FO4A 2H3NB 4F1ZA 1A66A 1PEWA 5GZNA 4X4MA 2IBGA 3Q6GH 4F3FA 3IPBA 3TVMD 1U95B 4M29A 5AZ2H 3NIGE 1RJLB 1XH3B 3KYMB 3RNQA 2F1EA 3D39D 3Q8AA 4ONHB 3WXWL 1X5JA 2ZUXA 4PJAA 2E8ZA 5T5NF 4QRPA 4RODB 3MLTA 1QWHA 1INDH 4ONFL 4YSRA 2F18A 4NPJA 5IBUB 5FF6A 2BSTA 1ZA3A 2IWEA 5JDSB 1WVZA 1KB3A 4X4ZA 1L7IL 1RJZA 1A7OH 1YMMB 2VLKA 5CR1A 4FXLA 3EGSB 3KNBB 4L8SB 4LRIC 4K15A 2IQ9H 3SB3A 1LVEA 1RIUL 4LLYA 4PS3A 4G42A 4MNGA 4AEFA 4QXWA 4E9YA 4PRBB 5IGXH 3ATDA 1FGVH 1AD9A 1YZZA 2FECL 1NBYB 5AALA 1UJ3A 2WTRA 2NY0B 3OZ9L 1BM3H 3KLLA 5BJTA 2YAQA 3UTTB 4X9IA 4YXKH 3C9NA 3VSVA 3BKCL 1T2XA 3HC3H 4PJXF 3E7JA 1PJ9A 4I18C 2DMCA 3K81A 3NTCL 1KXVA 4K23H 4APXB 5E1AA 4BJLA 3ULVF 2YKLL 1OD9A 1WEJL 1YPZF 4JO3H 4PJ5A 3BUBA 1T1YA 2CBMA 5IOKA 1OLLA 2CJSA 2K7PA 4A7TA 4HOZA 5IBLC 3DX1A 2WUBL 2EJ1A 3W1ZA 2P45B 2NRDA 1PZDA 4ODWA 4H8WL 5IHBA 4K2UH 1H8SA 4E5XG 1S7RB 1J0IA 1K35A 1OB0A 4NBZB 4WK2B 3NJFA 3EJRA 3EYUH 3L3JA 5CGBA 5DMYA 2I9TB 3L4UA 2ZIDA 5AW2B 3N2JA 4LLMB 4LDLB 1YC8A 4QHNB 2LU5A 4N8UA 1HHHA 4ZUTA 1C5BL 1ILUA 1KEML 3LEYL 5CJOL 4I1NB 1MHCB 3NYKA 3MCYA 4R5VA 4GMTL 4XI5C 2NY6D 3EH2A 3ZVVA 3GSQA 1BXUA 2A9NH 2HA1A 4U1GC 1D5ZA 5ENWB 1CUOA 2WCPA 1E4JA 3L3GB 3NSJA 1B4RA 4ODSH 1NLBL 2DS4A 5C3IA 4FS0A 5C86A 4CGTA 2Z0FA 5A43C 3MRFA 5EUKA 4Z9KB 2A9AA 3V8OA 4N86A 1M1SA 1V7MH 4NIKB 5E08L 1RLWA 3MXVH 4JANA 2NPLX 4PWGA 2GI0A 4YQXH 4FMKA 4J2XA 4PY5A 2BWDA 4KWUA 4E36A 4MAZA 1MHHA 4JY4B 1OW0C 1ZLEA 3HZMA 5TGBB 4DVBB 2X1OA 5D7JA 5AVVB 1I8KB 3B9DA 1C1EH 4AIEA 2OZ4H 2J2ZA 3IN2A 3L13A 1WCBA 2YSTA 1DLHB 2PYFB 4QGTA 4YR6A 2K4WA 1AGEB 1JWMB 2J72A 3MTXA 3ZTNL 1E4WL 3VXSD 1P7QA 3SE4A 1CDHA 4HP5A 2W9EH 3ARGA 1OZTG 3MI6A 3QO1A 4FFZL 4C4KO 3PREA 2MJ7A 4FJYA 2WBJC 1T1ZB 2BY2A 3WUZA 2QGEA 3L8QA 4HXBL 1RZQA 3MRCA 4JHAH 3VWJB 3X3FH 1ZEAH 4X8CA 4ETQA 4YHML 5EEWA 3TPUB 5C09B 5ALCH 1KGWA 3DUHA 1DQTA 1LWWA 1L9RA 5JHDE 2ROXA 5GJSL 4KVNL 4P9HC 1UXWB 2XJLA 1BSIA 2OMYA 3C09B 3VDBA 3BKMH 4FF9A 1RUKH 4HT1L 3D4VA 1UM4H 3F7LA 4NFBA 3BUYB 3W39B 3GIVB 3BMWA 4AUJA 1QG3A 1Z9PA 4IRJC 2J1ZA 1AIZA 1E27A 2V9JA 1U8MA 2RD0A 2G2RB 5KBPA 2W0LA 5GHWH 3VD4A 2CPCA 3EG9A 4YDLB 1C4GA 3FFCA 1DBBH 5DJDA 2X4OA 4DHLA 1ZGLM 4XGZB 3VRLF 1NIDA 2XY2A 5FO9B 1VFBB 2I5WA 2OBGA 2GEEA 2JB6A 4YSUA 2X4QB 4NPYB 2J5LC 2TRYA 3EYQC 3RKPA 2Z91A 1ZVHA 1ZHNA 2YJQA 2ORBH 4N1EA 3FRPB 4FAAB 2Y4SA 1J0JA 1XT5A 2ALAA 1GMEA 2E6JA 2WVSA 3M1OA 5I8OH 2WIIA 4P2RB 1KTRL 4G6JH 1UVQB 1RZFH 2QADB 2H2SC 3G5YB 3SYQA 4JKKA 5FO8A 5KSBE 2NY4B 5BRZA 3ARFC 5EORH 5J12C 4GG6A 5FUZH 2DBJA 2D4FA 4MD5B 5IFHH 3AT9A 1NDMA 4UZSA 4C59B 2PP9A 4GRLB 5A2CA 4PG9B 4PSPA 4FNPA 3TV8A 5KW9H 1UXMA 1SXAA 5EZJA 1B0GA 3N85H 5AVSB 5GIRB 5IW3A 1KDIA 1JV2B 1T5KA 3SO5A 5FLVA 1FHGA 4XNZC 3I2CH 4IKJA 1CJYA 2VQ1B 5E9AA 4OZFB 4LLQB 3QUKB 1C9BB 5FECB 2ED9A 4CN6A 2VQUA 3RDTB 4B0AA 1BVZA 3CQQA 2OJ1A 2R7EA 2AK4E 4JPKH 1TDQA 3GC3A 1U8PA 2WC7A 3PLYA 5I19H 5TE7H 5KS9E 5IJBC 1ADQL 3V0HA 1A6AB 3MRIB 2R9HD 4LVNC 3TFKD 4Q11A 2BMKB 3C8KB 2J3SA 3EDFA 7FABL 5B1JC 3MLSL 1HN1A 1JPST 1KG0A 1QZ1A 3ROLA 5GS2D 4O02A 3FO9A 5D7SL 3GXUB 3APCA 2E0PA 3DX7A 3VFVA 1DBMH 1NCWH 1MCCA 4UV4H 1S9VB 2BWQA 3CWSA 3RTLA 1XZ0B 2YGQA 3VG9B 4PY7A 1V3LA 1XSJA 2B7DT 4JREB 4X8XA 2EXWD 2ZYHA 5I1CH 5DJ0B 4I2XA 3DPTA 3MBED 2J88L 2ADYA 3VW3L 2VB5A 2Z8WC 1M05B 3F7VA 1T6WA 2R0KL 3DDFA 2WZ0A 5C0AB 1IKNA 4Q6IC 4RMWA 4IMKC 3EFFB 5EOQH 1PW3A 2Q9OA 3AG2B 1WS7A 3FBKA 4XP5H 2IH1A 4M6OH 3OPZL 3BQUB 5ICUA 2YRZA 5AQ0A 4YL4A 3S5LA 3GMLB 4IRSB 3WENA 4YHIB 3RU8L 5M95B 3L95A 4JFPB 4PRIA 4ZMTA 2DKUA 2Y0SA 1MH5A 4I48B 4ZMYA 5K9QI 3ZL1A 4RGND 4UTBL 2VQTA 1KB9J 3LB6C 1AO7B 4LHUD 4YBQD 1EZLA 3CXFA 1M71A 5DZ9A 2DV6A 1UGKA 1DJZA 2ENYA 3BUPA 3F7RA 3D12B 1T5WB 4BIKA 5GGRA 2P5EE 2ATAA 5JMRA 2F08A 4OAWB 2UXVA 2PTVA 5HVWA 1OGAA 3A23A 3ARDC 3AABA 2JIXB 3E8UH 4AT6A 3O8XD 4Y9BA 1GYVA 3MX0B 2OMXB 1RJCA 3EF7A 1TITA 2QZQA 5D2LE 4PJ8B 3U4EA 5F7DA 4BWTA 1NEZG 3L4ZA 4NLHA 1ASOA 2H32B 3AB0C 4IS6A 4NENA 2HLFC 1BG9A 3VDCA 3WFCH 1KN2H 2DKAA 2Y6SD 5I75B 4Z3JA 2B5IB 1NC4D 2E4TA 2RACA 1JHKL 3RVWC 3VX1A 2BSEA 2E3VA 3ECUA 3VMNA 5C0GB 4LVOB 4UT6H 5GSVA 1MREH 2AK1L 5SWSB 2DLEA 2WO2B 3OJ2C 1B2WH 5HJDA 1QNCA 4QRBA 2OX5A 1BG1A 4IOFC 1UFGA 1E5BA 1XB6A 3BEWA 4K5NA 1AQHA 4D7QA 5AUMA 4K5MA 1U30A 1UACH 5CLTA 4MAYB 1R24A 1J8SA 3N1PC 2DQUH 2W60A 3BWAB 4NEHB 1RL1A 2Q86A 3BUDA 1O7DE 3CWAA 2WP3T 2B1HH 2D3VA 5TE4L 1TYJA 5DJ6B 2ZWNA 4PGCB 3QUYA 4MBOA 3WLWD 4XNYH 1EJFA 1FVCA 1QRNE 2IALB 5CP7B 5AB0A 2Z7WA 3MGAA 3SDAD 4P46A 5I1EH 1G94A 4YBLB 4BGLA 4XNDA 4NBYB 2BRRL 3CZLA 4J3OD 4N0FB 3ETBF 4O2FA 3NG5A 4ELMB 1FC1A 3CLWA 1G1OA 3J27A 3K8KA 4N20A 1MFDH 1P7HL 4HSCX 4XAWH 3JV4B 4PP1D 4WFHD 3SDXB 4J39A 4E9TA 4S1QH 4ZBJA 6PAZA 4GSDL 2ID5A 1MCSA 5MEPB 4J27A 5KZCB 5E8OA 3PV7A 1LLAA 2I69A 2XKNB 4C83A 4KZCA 4BFGA 1AHKA 2X28A 3ZZ1A 4LL1A 3THMH 5I0XA 2AEPL 3HMWH 4YFEA 5HY9A 1DIZA 1MJJA 3QRBA 3U1SH 2ARJQ 4MVBD 2V5SA 2X89D 5CKGA 2DWEB 1RFDH 3VA6A 2ADFL 1TBAB 4FXTA 3VVVA 1HVXA 4NN5C 3S88L 3I75A 4P3DB 4OZIE 3NESA 4N5EC 4L48A 1BZQK 2H4LX 1B0WA 5I24A 2WANA 1UWXH 1J86A 3G6JE 4X9FA 4N2HA 4OF0A 1LO0L 4AQ8A 5I0ZA 3ILEA 3WLBB 2H0FA 5HSHA 2AEOA 2Y8QA 3GZQA 4DIXA 3CFKA 5C71A 4KMLB 3ALPA 1DJIA 4QR7A 1I1YA 3MV7E 4Q89A 3WXVL 3MRKB 1NUGA 1FZOA 4LPTA 1M2VA 1BLNA 5CD5C 1GZHC 3EYVA 1CGXA 3CFTA 3D85A 3AAZB 5L6YH 1BZ9A 1VADA 2EAEA 3X14A 3HNVH 2WN3A 3FUEA 4FHJA 1AHWB 1XR8B 1YMME 4PJAF 4RFEA 4HUCA 4TLTA 5FA4A 5SWZD 4D8PB 1A1NB 3MFFA 1T1WB 4AUUA 5DJCA 4KXBA 5I1KH 4OKDA 2NY3B 2VLJB 1BEYH 1FDLL 2QVIA 5B7FA 5FYKL 3X13B 1HZKA 2G30A 1ZLUK 5C7ZA 3U7YH 3BFQG 2VMDA 3N42F 4FQCH 4Y5YC 2ED6A 4BK5A 4DZ8B 1J18A 3WY2A 1IGFH 4RAHA 3QZNA 4IRZA 4EAGA 1HILA 1ZD6A 1KIQA 2DLTA 2UYLB 1F3DH 1T0PB 5B1CA 3HW7A 3CTTA 3VH8A 3U30B 5F1SA 2ODHA 4NBXB 1RHHB 1YJDC 2AJ3A 3RQ3A 3UX9B 5JPMA 3R06B 2OYKA 5C0JB 4JR9L 4JE0A 4QRTA 4TUOB 2XN9E 2AZAA 1HS6A 3TT1H 1WFMA 5FAAA 4CN1A 2BNRD 2JHNA 1PYWA 3T77B 1MCKA 5HI4D 1EZSA 1NH2A 3G7TA 1JBJA 1XTLA 3JT0A 9PCYA 4AH2A 2HRGA 5MHSD 1M9WA 1BBJB 1RMFL 1KEGH 3L1OH 2IAMA 2YLHA 3DIDA 2X7LA 4JKPL 4NQDB 3PGCA 5BMFL 4JFHE 1JHLH 1T0MA 1ASQA 4MLIA 1J8HE 5JO5B 5KBDA 5FKPA 3BPNC 4XVTH 1V5JA 2EVJA 4ZYKB 1PZ5B 4LRIA 5FV2A 4GSRA 4O5LH 1SXBA 2R27A 1TGHA 2AMUA 3DVNA 4NQCE 1WS8A 4NHCL 5FFOA 1JN6B 1RJYA 4XBEH 3CVHL 4PVMA 5I82A 1XCTB 2PCPB 4HF5L 2BHFA 4GKLA 4MA1C 3IDJA 4NQTA 5J89A 1K8IA 2YBRA 2XQYG 4FZ8H 2WWKO 1A4JB 5FCUL 4I18A 3HG4A 4XMKL 1QPPA 1U3HB 3BP7B 3QDME 1N19A 4MRCA 4Y9EA 3HB3D 1MXGA 4FFYH 4ODVH 4P57A 4QI3A 3OKNB 1AQDB 1AGDA 3X1BA 1N3NA 1WFOA 3EYOA 4R5XA 4JZOA 3PWNA 4E9XA 4YHLL 1J05A 1NUDA 2EIZB 4I87A 4A2MA 5FFGA 1GRWA 3L9YA 3APFA 5DJXA 1S7QB 2R1WB 1RUQH 3LKQB 1EZUA 4TTGA 4I3RL 4L1TA 1NFIA 4FXGC 5F96L 2ENSA 1D6VL 1XSKA 5DWUL 3V5KA 5KAQG 2JOIA 2YSSB 3VFUA 2AABH 3LRSB 2FZ3A 3W2DH 4G59C 1KTDA 3ZW3A 5F9JB 1NFAA 4LLWA 5TF1L 4OBSA 4N90E 4LCVA 3BVDB 2R8SH 4NXSA 4EEEA 5FYJU 3OXSB 1X7QB 3HHMA 3OZKA 5AOLA 5AD0A 3BZEA 3RPKA 1I7TA 3LS5L 5CWSA 1RIVH 1KJ2H 1AKJA 3VQLA 4JRXE 3NFSH 2COVD 2VZ1A 4B9PA 3NGBB 4L1LA 4Y4FD 3H6JA 5B22A 1HQRA 3BAEH 4YAQA 3UYPB 2WO4A 1ID2A 3CZUB 1MJ8H 1X6LA 1PFCA 4Y16C 4ONGL 4GEIA 1OW0A 5H35B 4Q2ZB 3HMXA 4ELKA 4HAKA 5G4NA 4U3HA 1JI2A 1WH0A 1JK8A 5J8OA 3C04A 5KSVB 1DEEB 5EZOH 5SWSA 2R2EB 1EHKB 4CSTA 1KFQA 2HJFA 3DV6A 3HE6C 1N5AB 5GJTL 1HHGB 4WFFE 4HWBA 3B1TA 3RFRA 4Z7OE 1XF2B 1GVIA 5HHMD 1AISA 3FCTA 1EMTL 3U6RB 5BW7C 2F53D 1VOLB 2D4DA 4JJHA 1T1XA 4P2RE 3K91A 1DQDL 2WBJA 4OCRH 3OF6D 5C6WH 1IKFH 4CU7A 2PO6B 4BYHA 1D9KB 4KK9C 5F7BA 5FHAL 5CJ5A 3CUPB 3HG2A 2FJHA 4XTRC 4AV0A 1ACXA 4M4RB 4P49A 2XX0A 4G5AA 5HGAB 3SKMA 1QNEA 1YLBB 4H13C 3DETC 3NCJH 4NKMA 5EOCL 4PBVC 2AQ3A 3VTMA 3CBRA 1YTFA 3RPI<