3H1ZA

Molecular basis for the association of pipkigamma -p90 with the clathrin adaptor ap-2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
b'GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 complex subunit beta-1
publication title Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 51
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h1zA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3h1zA02
1QNEA 4ROCB 1QN9A 1KY6A 4ROEB 1RM1A 1CDWA 3VN5A 1D3UA 1PCZA 1TBPA 1QN7A 1KY7A 3ASMA 1QN8A 3H1ZA 2D0BA 1QNBA 2VJ0A 4RODB 1QN3A 5IYDP 1QNCA 1NVPA 2MJ7A 1VOKA 1QN5A 1W80A 1KYUA 1QN4A 2D0CA 1NGMA 4B0AA 2Z8UA 1PZDA 2D0AA 1NH2A 1AISA 1TGHA 4PY5A 1R4XA 1B9KA 1QNAA 3OCIA 1QTSA 1MP9A 4WZSD 3OC3C 1VTLE 1QTPA 1VOLB 1VTOA 2G30A 5IYCP 1C9BB 1TBAB 1KYDA 3HS8A 2IV8A 3EIKA 5IYBP 2IV9A 1JFIC 1QN6A 1E42A 1YTFA 1YTBA 1KYFA 3HS9A
chains in the Genus database with same CATH superfamily
3HE7D 2HT2C 1JZ8A 1KOAA 1NUDA 1SXCA 5EUKB 1NZRA 5F21B 4ZOAA 5JHDD 3PXHA 4PJBB 3DX3A 2XXGA 2QQNH 3NJJA 4M8RA 2WQRA 1MY5A 1R3KB 3D18A 2X6UA 3DX6A 3V5KB 4F8QA 2O6DA 3FO0H 4EAGA 2BWQA 5D1QE 4TPRL 1V55B 4YHLL 1A3QA 3S5LB 1DQTA 4L3EE 3NIFE 5J5EA 4HOWA 3NTCL 4U1JB 5GGSA 2PW2A 3ESOA 1YY9D 2L7EA 4K4KA 5C6PB 5J7CC 1AHKA 3M8OH 2H1LM 5B8CC 2PPAA 1T2QH 2EEFA 2FBOJ 1T7YA 5DD3L 1N5YH 3ENOC 1GOHA 4KTEH 4QRQA 5C86A 3NSJA 3MRIA 3WN5A 4M43L 1PD0A 1RUPL 4QO1A 3ARBC 3RTQA 1U3HD 1MVFA 4YC2B 2Q2EB 2DTMH 2ZXBA 2HJFB 2F15A 4BGLA 3FN3A 2CRMA 2H0JA 4IOSD 1NSNH 4K23L 4Q0XH 4HDIA 4TL4A 4D2NA 4WK0B 5CGMA 1ZGLP 2X6CA 5CN1A 3RWGB 3G6JE 1LK3H 3MLXH 3LS4L 5HDWA 1OM3H 2YPVL 4AQEB 3JT2A 4P4RA 4L5FE 4GRWH 2RD0A 3L48A 1YNKL 1H8NA 2VDLH 5CCJA 1BHGA 5E0QA 4UQ2B 1P5UC 4UT9A 1EAJA 4NEHB 2V6HA 2C3HA 1HIMH 3OKMB 5FUCC 3ISYA 1EAPA 1RJZA 5HI4D 3SBWC 2QFPA 2XUWA 2XN2A 4OM0L 1VGKB 4BFEA 4C55A 4PWEA 1QNZH 2E9BA 3UBXA 4R0LC 4AJYV 2AJSH 2B1OA 2Z8SA 3QIBD 2YRZA 3GXUB 2VN5A 1F90L 1D6EB 1NC2D 1C16A 2ZCLH 1E3FA 1ZA6A 1Q72L 1CDYA 4D9RD 4D9LH 1XTMA 3QXAB 5DS8A 5J6GA 4JO4L 1PZ5B 4WY7L 3WNJA 2WQUA 4NKMB 1AR2A 1F42A 5FGSA 5GGVH 2W65B 1EDQA 1TEFA 2GVYA 4FHJA 4FQ1H 3WL9B 5C0JA 3OH9A 3GMNB 3ARFA 3CLFL 3AITA 1NCWL 1GAFL 3QQ4B 1ZRUA 3GKZA 1NLBL 1OTTD 1FV1B 4D0CA 2Z91A 4FQCL 1SJEB 3NZ8B 3IE9A 4JREC 4KXAA 4PP2A 3RWEB 1NFKA 4PS8A 3KEDA 1IC4H 4E41E 3L4VA 3BUYB 2VLKE 3PABB 5D72H 2IH3B 2XQ0A 5D93C 3ZYZA 1M7DA 2J6EA 3VI3E 1QUNB 3K6FA 2A9AA 4PRIB 2QHRL 3P9MA 1E8ZA 2B1HH 3BUDA 3QVAA 4JKMA 3ZE2B 1KYOJ 4W9CC 2R56H 1PSKL 2DYRB 5AZ2H 4X8JA 2G3MA 3NFPA 2D4FA 1PX8A 3NFNA 4I8OA 3PFUA 3WN5C 4G6KL 2ITCA 4OJYA 4OAWA 1GL4B 1V3MA 3VMOA 3RTQC 2YIHA 2CLZA 2AQRA 5JOFA 1HINH 1MCWM 3QR2A 4KXZI 4XBEL 1GS7A 4HUVB 1QLEL 2DIAA 4GBXB 2DIEA 1J88A 4FZ8L 1WISA 4DVBB 5CLTA 2ZX7A 3CH1B 1O6VA 7CGTA 3KPSA 1IC1A 3AROA 3K3QA 2IPUK 1UTDA 1EEZB 1CDJA 1IAKB 2H4LX 4YVUA 2OR9L 3OZ9L 2J8UF 4G7VL 4WWKB 1CFSA 3L5XH 5GRWA 2ICWB 3CDGA 4UMSA 2I9TB 2ODIA 3VI4E 3PJLA 1HHJA 4PW9A 2AJZB 1ETZA 4LHQB 2OSXA 3QJHB 3L1FA 3S35L 1VIWA 1JDCA 2ZXDA 4HC1A 2WZPA 4GJTB 3P9LA 4Z9KB 2D3JA 2B9BA 3DX2A 3HC0A 4OGAC 1ZS2A 4M4PA 4LCYA 2YAPA 1I1AB 4XNYL 2FATH 2J6EL 2QEJA 5E2VH 4XPFH 1TVBB 3DGGA 2D3VA 2BINA 4KUZH 2WLLB 3QUKB 3T6XA 3ZT5A 1KIPA 3A6CH 1BFSA 3FT4B 3NP4A 3QO0B 4KK8D 3T0VA 1FYTA 5A2BA 3BP7B 4NCDA 1AS6A 3LSOA 1QZNA 3ARFC 3ZMNA 3ZL4L 2R59A 1UXWB 1V05A 2EKSB 4UUJA 4FQXD 3UFIA 1AO7B 1ITBB 1T89A 2OPCA 4OJCA 5CWSA 3SPIA 3IAQA 3JWNH 3MUGA 3V6BR 3LVTA 1K4CA 2GK2A 2K6WA 4HKXB 4P5TA 5GGSY 1JGEA 1WBXB 5ADPL 1E42A 1MVYA 1OB0A 4N9OB 1BCIA 1TO5A 4ZUVB 3RUGB 4N26A 3UZQA 3N1PC 4OF8A 4P4KA 2DQHL 3L5WA 2OZNA 4AEHH 2EUZA 2HH0L 2FZ3A 5JHBA 1KB5H 1T20B 3W2DH 1MY7A 1JZ4A 5HPMA 4PJEA 1UXSB 3QULB 1JPTL 1OV8A 4J6RH 4C4BA 3GPEA 4R7XA 2UZYB 5EZIL 1VGEL 1PY9A 1E2ZA 1T5KA 4TOYH 4X50A 2FAUA 3HNSL 4FCAA 1DBML 3MV9D 3QJXA 1U8CA 4ECNA 4RQQB 4ZFZB 2NY1B 4WDIA 1JHKL 5GIRB 1XSKA 5TH2B 5C7XH 5ACMA 3GSUB 1KBVA 1P84K 3EYVB 3F0ZA 4CW1A 4XMKH 4F91B 4PJIB 5T5FH 4EUPG 5BS0B 1HSAA 1X9UA 4JG0L 5F0LB 5J1SC 3CVDA 4FQHB 5CGTA 5FOBA 1M2VA 2YLKA 5GS0D 2NY3B 4JRLA 5EIVA 3UJJL 1NGMA 1BX2B 2IQ9L 3MRGA 4FMFA 5D1QA 3VGGA 4K3JH 2CO1A 3VXUD 1JRHH 3FB5B 3FQXA 1JP5A 4GQQA 2R9HC 2O30A 2WXPA 1GGTA 4L3EA 4D9QE 1YTBA 3BKMH 4YSPA 3WFDL 3BQUB 4AT6B 4AZUA 3PGFL 4IJTA 5EIIB 4ZRGA 5MEND 3HCVB 4AXWB 1YEEH 4AMXA 1WBYA 2DQEL 1ZT1A 3RURA 3MGTB 4DUXA 1NGXB 1U3YA 1X9RA 1D5RA 1KCSH 3P3SA 1L9OA 2OA9A 4HK3J 3ABZA 3NRPA 2ZWZA 2JKIS 5KYYB 1U8KA 3B1TA 1WWAX 3V2AR 3APCA 4QAWA 4KAQL 3WI9A 2WBXA 3UZVB 5KVDL 3CFCL 1GTFA 2ENYA 2UV3A 2F08A 1Q9LA 3T0DA 1T89C 2VO8A 2Z35A 3GMQB 1IFGA 1WFIA 3CJJA 1KIRA 4GI8A 4P5TC 4Q52A 3DARA 3G6JA 1QAWA 1ZGLM 2R8SL 4S2SB 3NSXA 1E50A 1RJYB 2W38A 1UKQA 4BD4A 1AZCA 4NZTL 2HTLD 4YUEL 2R39A 3AT0A 1AQDB 3RL1B 3V5DB 2R29L 3H85A 3WKQA 3QUHA 3O6FA 2I07A 2Y22A 5HY9B 4QEGA 2DTSA 3HZMB 3V4PL 3TO2A 3MRDB 4PI2A 5B8CB 2HYMA 4HKJB 4YAQA 1RJLB 2VT0A 1BVKA 3AW5A 3FBKA 1CLYH 2DQGH 2WVTA 1A7QH 5IMLA 2P8MB 4OV6F 2YSSB 1U8LA 1HCZA 1FZMB 1T04B 4Q9QL 2E7CA 1D7DA 3L45A 4MQTB 1IM3B 2YHGA 3WMQA 1M1SA 3ARBB 4HJJH 1DJZA 4LLWB 5H4ZA 3SNSA 1Y1DA 1HC1A 1K5NB 5JXED 2VXTH 3ZSTA 1CZ8L 1RK0A 4KBPA 3O6LL 3HFMH 1JNNH 4OQ1A 4UV4H 5GRVL 3CIQA 3S88H 3GSXA 3BCFA 4XO3A 5E6YA 3RWFB 1OLZA 2YQBA 5D1QC 5BZZA 3C09C 4E41A 5EO9B 1FZJA 4QXTB 2VLKA 5DEJA 1OB1B 3MLUL 3F7RA 4QHLA 2Y3NA 3PPSA 3F6LA 3CZLA 4UOW0 1YY8A 3VI3A 5C0CD 2A83B 5I6PA 5E2JA 2GSMB 2W9LA 4QTIH 2K8MA 3DHJA 1P5UB 5ESAA 4JAMB 2OZ4A 3V4UL 3C9NA 3NZUA 4G8EA 3K0WA 1DVYA 3V8CA 2BSSA 4FFYA 1XV8A 4N0UE 4A67A 2VCOA 3RIKA 1ZV5A 2PYED 4LPTA 4L5FL 3IDXH 3TFKC 5F7DA 2F58L 4R0LB 2XPGA 2J1YA 3WE1A 1R5WA 1N7MH 2ZKMX 4ZO9A 4GEJA 3EF4A 4J1UA 2X7LB 4XE5B 4H25A 2UWEB 1KJMB 3QG6A 4EAKA 2O6PA 4F7CA 4NKOA 2VRQA 1MRFL 3QG7H 4GH7B 4IU3A 3ZIMA 4JPWH 2C9XA 1FG2A 3CK0H 4RMQA 4JO5A 3D18B 5T1KD 3DX6B 3TCTA 4MS8C 4KY2A 4PJBF 1T5XA 4GIAA 2JI1A 4PRDA 2N56A 3PHQA 3VI4A 5AKTA 1ICTA 4WSJA 5EA0H 4Z0BL 4MMZA 5D93B 4YGVA 4ODTH 2Q2LA 3EOAB 3VSUA 2CHZA 3O6FC 1UD3A 3FUEA 3VRJA 5JQ6L 5GGSB 2PW2B 1UH3A 1UUNA 3MJGX 4N5UA 5L2KE 4FJZA 1CO1A 2YKLL 5FLVA 1CE6A 3QYNA 3IDJA 1JNLL 4QOKD 4QKXB 4QRQB 1BZ9A 1GH7A 3MRIB 4KO6A 5LNEA 3WN5B 1AAJA 3MLRL 4QO1B 5CUSH 4D3CL 2ZAHA 1U93A 3RTQB 3E0GA 2OZ4L 1IV8A 1HOEA 4FJYA 3F05A 5GXBB 2R51A 4FFYL 2V2XB 1DCLA 4WHTA 5A2KH 2WINA 4B50A 2E4FA 3T3MB 5JPMA 3GUTA 4B3EA 4HDIB 4PJ6A 1PG7X 2XVBA 1L7IL 4JFTA 2YD4A 2VWEE 4DVRL 5IBLC 1A14H 5A43C 3D08A 3D4GA 4OZFA 1FFNB 3X3GH 4DEPC 4Y0GA 3LB6D 4MJIE 4C4UA 3L4WA 3S8GB 5CZXD 3WMPA 1QWHA 2DBJA 1EAPB 1RJZB 3BFOA 1QLEB 3TJHD 4LVNC 3B2PA 4HMDA 3FHQA 3UBXB 2QVTA 3FQRA 2OR8A 2ROYA 4N22A 4N2MA 3VXMD 4NUJA 5HVHC 4JE4B 5HDOA 4XN9A 4DP9X 1HQRA 4G7RB 4PGDA 2OJ1A 5AAWA 3CN4A 3HC4H 1FL5A 2P5WE 4NZ8A 5I6OA 1C16B 4F57H 5L6YL 1ZA6B 2V7NA 1EVTC 5DS8B 2A6DA 5J6GB 2YARA 3HHRB 5AUMA 1OT1A 1KIQA 5IBTH 5C0JB 4MRBA 3AQZA 3ARFB 5CP3A 2A9ML 4PMFA 3D39D 1LD9B 3D8MA 1OIOA 1G9NL 1NCBL 1ZHBA 3FRPG 5DA4A 5AWNH 4ES8A 2AEPH 3VSVA 4D0CB 3CSYA 4YIQA 2Z91B 3E2HC 5LNGA 2NY5C 2QR1A 1KCBA 4MMZC 2IH1A 3QYMA 1M7DB 1SFHA 1SLVA 4G1MA 4JW3A 3RQ3A 3TM6A 5EU7E 4LRIA 2EDEA 5C0GA 3HS8A 3P9MB 1ODAA 1JXJA 1UACL 2HX9A 5GGTA 1J8SA 5C0RH 2ZTBA 4K07A 1DR9A 1QX1A 2DB8A 3L5IA 3FOMA 3NFPB 5HHME 1JF6A 3NFNB 5FCSH 2W0PA 1T4WA 5CU9A 4LLMA 2ITCB 3SPGA 3NCYP 4R7DA 3PF2A 4TS6A 2DQ6A 5KZCB 2CLZB 5JOFB 2GITA 4I85A 3C8HA 5SX5H 1G9MH 5T3XH 4UQEA 1HL4A 5ITBL 3RVWC 3T5WA 2XLLA 3A6BH 5JPMC 4Y2NA 3KPSB 3WUWG 3V0VA 3FUIA 4W9EC 3DVFA 4QMEA 4E9YA 1QHOA 4LP4A 3U6RA 1J86A 1VADA 4OZGE 4ROEB 1KGXA 1TJGH 3MMEA 2O6EA 1CFSB 1UD4A 1UOKA 3VWJA 5EU5A 4Q97A 5DC9B 1YQMA 3HFFA 4HA1A 2A74A 1A3ZA 2MH4A 3F83A 2C4FT 3LTVA 1ETZB 1MRDL 2QSVA 4KJQD 3BAEL 4E42A 5AFAA 5J12C 4A55A 4W9LC 5JW3H 3P9LB 3ILPA 5E2UH 1WT5A 2FYYA 1DVSA 3HC0B 4LCYB 5B3JF 5K5YA 3SKUD 4P9MH 3DGGB 1JI1A 5GGTL 1KIPB 1U8QA 5TQ0L 2EQDA 1VAHA 2WP3O 1FYTB 3OMZA 4M1DL 2EYTA 3LSOB 4HJ0C 2JE8A 5AVSB 2APBA 2BC4A 5AVTB 4UUJB 4RRPA 4KRNA 5CWSB 5AZEH 2YAOA 4FNPA 1K4CB 2F1AA 4Z23A 1FFTB 4P5TB 3Q05A 1JGEB 3RWJA 4CVZA 2BFGA 5IQ7H 2FDBP 3PNWB 4LRIC 3DJSA 1AISA 2FWSA 3IJHA 4X6DF 2CM5A 2IG2H 2OTPA 4YBLC 3UZQB 3L13A 1XR8A 4A7GA 3RUGF 2FUVA 4D7RA 4QD2E 2Y23A 3Q5OA 1AIZA 1SDDA 5D7SL 2O3OA 4Y7MA 1LMKA 3MX0A 4NN6C 4N0UA 2QBWA 3WKYA 3R06A 5HPMB 4EBQH 3BAKA 4PJEB 3HG5A 3GBNH 5DWUL 2JKSA 2ZWSA 5LAPA 3CVIL 1UCBH 1YECL 3FSAA 1CLZL 5AVZB 3BDYL 4BE5A 5HHVL 2X9XA 4L9LA 5T5NF 1U8CB 2H45A 1J48A 4AM0Q 4FNUA 3MZGB 4WDIB 3SDDB 4Z3FA 4ETQA 4MA1C 4ZT1A 4YZFE 1OAZL 2IBGA 4EZJA 3BAYA 4FFVD 4UB0H 3JWNG 4CW1B 1XGYL 1XWVA 2MTPA 1HSAB 1RSFA 2XVGA 4OBSA 3EH5B 4O4YL 5DK2B 3VWJC 2WKLA 1ZWIA 3QUMA 5FOBB 1MCRA 1AXSA 2A74C 1BF8A 3MRGB 3OKNA 5D1QB 43C9B 1CR9L 1EJ6A 3C09B 5LGHH 3FQXB 3TVMA 2EIMB 4L3EB 3NIFB 4OGYH 3DHUA 3KLQA 3SE9H 1X7QA 1BFTA 2AV7A 4GQRA 3MXWH 4KJWD 1DSFH 1WT5C 3FUFA 4OCWH 1FWXA 3UYRH 3V6ZB 5DEFA 2JF1A 4PS4H 5L2KA 1WBYB 1MDTA 3BISA 1H3PL 4NNYA 4KKZA 3H55A 2EXWC 4BA8A 5FWQA 1YSOA 5SWQA 1TSHA 1U8KB 5GRJH 3ML9A 1R9FA 4BFFA 3IU4H 4IRZA 1DJXA 3MV7E 4V2BA 1Q9LB 1BMGA 1IAII 4JCLA 1C47A 4NNPL 1BMZA 3HR5A 2Z35B 3DSFL 1KIRB 3WY2A 2ISDA 5LQBL 1AP2A 3ESVF 4ODHH 3G6JB 4NJ9H 2PTUA 2GJ6D 2W5PA 5DQDH 3CPLA 4UAOC 5ELIA 3ETBJ 3VGDA 1FFQA 4XCCH 2UVFA 2QADD 5F6HI 1I9JH 1Q4NX 4YL9A 3VXQA 1ZV9A 4MJIA 1PJWA 2Z65C 5HHNA 1XSIA 2PXYA 3O6FB 3VUAA 4BWTA 4LARH 2VDNH 3TO2B 1E30A 4YAQB 1KSRA 4Y1AD 3II3A 3LV3A 5KYUB 4L9LC 3U7WH 5L2JA 1BQUA 1BVKB 2P5WA 3WUZA 4FTVD 3LQAC 1F1DA 2VZOA 1WC7B 2CPUA 2TRYA 2HN7A 3QDJE 1U8LB 1WUNT 3QHZL 3HB3D 3IPFA 4FQIH 4JQIA 3FRUA 1NINA 3WEMA 4ZS6C 1C08A 2GK0A 2QZQA 1OT4A 2XX0A 2DMCA 5K59F 4QRSB 2R69A 1RK0B 3IFLH 2OMBA 3QA3A 2IXQA 1EJOL 4OVUA 2NOEA 1VACB 3I9GH 5C0DA 2EVIA 2CMRL 3DMMD 1P6FA 4XVTH 2HVJA 1FZJB 2MNJB 2FEEI 3TVMC 4QHLB 2QPUA 3MA7A 3GM0A 1YY8B 2YK1L 3N50A 4OLUH 1J1XH 3JBG7 2W9EH 2ZCKL 5ESAB 4DEPB 3C9NB 4KQ3H 2QHLA 4G8EB 1ZLVK 3K6DA 4O2FB 1C9SA 2WUBL 2BSSB 1E4XI 4LVNB 3J07A 4X7FC 2VUKA 5F7DB 1WGOA 4KX7A 4XAKD 3KM2A 2XPGB 4YSRA 3SOBL 1ML0A 5HVHB 3GF8A 3AS1A 4PLJC 5C2BL 3JZYA 2GBUA 4QCIA 4YGAB 4PWJA 3LEXA 4J1UB 5CJOH 3VU1A 5I82A 4DGVL 5I9QC 4H25B 3ATEA 3QG6B 4F7CB 2FD6L 1X3DA 4NKOB 5F9OL 5MEOB 4IU3B 2MOVA 3KS0H 1FG2B 4OZGA 2VWEC 3W9EB 2ZOLA 3UP6A 4V11A 3VFGH 4X2UA 2YWYA 3DXAD 1T5XB 2YS4A 3ILEA 4JQIL 4P2OD 4PRDB 5JW4M 3E2HB 2VDPL 3VI4B 2YFNA 5J56B 3RWHA 5AVUB 4M6ML 2GJRA 4H1LH 4KHXL 4MMZB 4YGVB 4RSVA 2AXHA 3MRPA 3MI6A 2PXYC 2CUAA 3DROA 2FBJH 3VRJB 2FUTA 4I3RH 3L4YA 3OLPA 4IEFA 2F7PA 4WWID 1GC1H 1T21A 4EPSA 1I1YB 1IBYA 1MF2L 2J56A 5E6ZA 2H2SC 3EOBA 1NC4D 2DM2A 2EDLA 3QR1A 5C3TA 2YMXH 4X9FA 1CE6B 3WFBH 1GOFA 1KY6A 1OE2A 1BZ9B 2XTJE 4EIGB 1SXBA 2WXOA 1U93B 4ZFFA 3EDEA 2C9UA 4RCAA 5A40E 3FHEA 3B7UX 3N85H 3NYKA 1HZHL 3NZHH 1EDHA 1CGSL 3CX5J 2WINB 3U7YH 5D7LE 2LGNA 1DTUA 5JPMB 3VA6A 1QHQA 3NFSH 4FXLA 3QRGL 3G5YA 5I1DA 5DMGC 2DEWX 4P23A 4KZEL 3QXUA 4BH7A 4S0HA 3I9IA 5EU7C 4HD5A 4NM8H 1T3FA 2ICWJ 4AEIL 3QUZA 1KIUA 1LP9E 1THCA 4OZFB 5EU4A 3QUXD 5B7EA 5DQJA 3G6AA 2XWJA 2Y7SA 2X6MA 2EYSA 1GZPA 4NJAH 3EH4B 5J12B 4F15C 1NA8A 4PGZA 3FQRB 5EBLA 1A7RL 3CE1A 4NUJB 2ITEA 1HEZA 1SY6H 3NA4A 1HQRB 2XQBL 4PGDB 1EBPA 3CWTA 1VZIA 1FL5B 1LO0H 3K1KC 1CU4L 2VN3A 1ACCA 1DDHA 2V7NB 1M3HA 2WNWA 1QABA 2A6DB 3ARDD 4FNLH 3S34L 5EU3A 1CLVA 3GC3A 4UV7L 5AUMB 4JFDE 1Z3RA 1KIQB 2ICCA 4L4TE 4HKBA 5CR1A 3LAFA 3D3VE 2QGEA 4W1TA 2UZPA 2VR3A 1ZHBB 4IGBD 4ZW8A 4G7SB 2IAMD 1NLDL 2HKHL 3CSYB 1SXSA 4YIQB 1PKQE 1ZTXH 1QP1A 4XB3A 3ULVC 1I75A 1CBVH 2HJKA 2IH1B 1QBBA 1N12A 3F85A 4G1MB 3HEIB 2P9RA 4URTB 1MFEL 5C0GB 1KJ3L 4YBLB 1RV6X 3OKKA 2OCCB 3MGAA 1F4YL 1YQRA 1SRDA 1CGYA 4YWGL 4RZCA 3IRCA 3FOMB 4NN6B 5K93A 2EDYA 1JIBA 3M88A 4LLMB 3ECUA 4A7QA 3Q8EA 1ETJA 3PGCA 4XP6H 4AOFA 4R7DB 4NOFA 2IDTA 4UILH 2GITB 3LNIA 1MLCA 3ZJAA 2QT6A 7FABL 3PE9A 4UTAH 3BEVA 4L1BA 2G5UA 4AVIA 4PGCA 4MA1B 2WXIA 5DD1H 5D4QA 3U6RB 2JPIA 1CDUA 4DSYA 1VADB 1E6OH 3G6DL 4M7LL 4P23C 1JDAA 1BJMA 3D9AL 3ECQA 3MMEB 3NOIA 3RHWK 1PAZA 3GLZA 3VWJB 1T5WB 3QUZC 5EU5B 4KTDH 4NHUB 2A74B 2HFTA 5CSGA 1ZT4B 5CO1A 1HSBA 3SGEI 4X8CA 4PP1C 4TQHA 5C1MB 2ESVE 3NCWA 3Q48A 5HVGB 1JNJA 4E42B 1HYRC 5H37A 3U25A 4PB9H 4UT7H 1TF4A 1TVHA 1ADQA 2VQUA 2NNRA 4KRLB 3C87A 3ILPB 1NOAA 2FYYB 5I1GH 3LIZH 1ERNA 1HCYA 2WSPA 4ONFL 4ZD3L 3APDA 2FWOA 3QDJA 1H19A 2FEDC 5JHLA 1U8QB 2IC2A 2MPAH 1TQUA 1I8AA 5IB4A 3RGVD 2JKJA 4P3DB 1UM5L 1HDMA 4DT2A 1CJYA 1PAMA 2TSAA 2QQKH 1O5DT 3QZLA 4HWEH 2BC4B 2LFEA 3KWXA 2BSBA 5E2WL 3BXNA 4F7TA 2YGNA 1CFVH 3F3HA 4IJ3C 4QHMA 1ROWA 3OJDA 3UG3A 4DZ8A 4PJ9A 3TYFA 3RWJB 4CVZB 3TURA 3IAGC 2EDHA 4D94A 4UAOB 2HMIC 3IJHB 5JHDE 3J2PA 1EIBA 1F1AA 2F53D 2NY0D 4FEMA 2AK1L 2EYRA 1XR8B 4W81A 4WCYL 2VMJA 4X4ZA 4LEXL 1SDDB 1UURA 3MX0B 3HG4A 4N0UB 3R06B 3T6VA 3KH3A 1F58H 3IRPX 4PYGA 1IAIL 1QWNA 3CC5A 2B0SH 3JUYA 4OLWH 4QXWA 4DGIL 4YXHH 4IK7A 4PJEF 3WE6B 4GFXA 2HP4A 4MKMA 3OPUA 1ZLUK 3UJTL 4L9LB 6FABH 2XHIA 2DMKA 3HMXA 5IROA 5I18L 4WI2A 5B1BB 1ADQL 4ETQB 3C5XA 3ENCA 4OCYH 3SQOL 4IRSD 1BIIA 3M17A 5HHXH 2FT6A 1MJUL 2EE3A 1OHZA 1WZKA 2WWMD 3QUMB 2OCJA 3WEAA 4X4KA 1QLFA 1MAKA 4M5ZH 5HVFB 3ETSA 2VMCA 2V5YA 3OKNB 1UWEH 2VZUA 4JO2H 2XWXA 3IMVA 3TVMB 2QPDB 1AZUA 1X7QB 3CBRA 4P46A 1Z6JT 1JHLL 2DH3A 5F0PB 1XB3A 4O2EA 5K33A 3GD1C 5DEFB 5L2KB 4NNYB 1U58A 4KI1A 4WGKA 2B4CL 3K46A 5FFOA 2QQLH 3VJ6A 4Y4FD 5SWQB 2Y25A 3TX4A 3WFCL 3ATAA 1Z5LA 2VUOA 1TPXC 5JO5A 2CO6A 4MD4A 1KZYA 3X1NA 3VH8A 2FEEL 4F92B 1A21A 2JQAA 4AVKA 3H3KA 1I9RL 2RQEA 3G3LA 3T3PE 1HJCA 3AG2B 5I9QB 2HSIA 1O7DE 2V9QA 3LRGA 4J7RA 3HNVL 5D7LA 3T0AA 4NFDA 2O5YH 2XG5A 1AE6L 3MUHL 4D9RE 4RESB 3N9GH 4PJ9C 1AP2B 3WHXA 5DD0H 1UT7A 3VDBA 2O72A 1E4XL 1T66D 3G6JF 1QR1A 1JTOA 2P80A 1LP9A 1NAKH 1DYZA 2JQMA 2NNXA 4I9XA 4XVOA 3VXQB 4MJIB 3WTTA 5HHNB 4I1PA 2PXYB 3A67L 5AB1A 5FUZL 2YC1B 2F9BT 3AT8A 4AGOA 3WBDA 4FQLH 4Z7WE 2W92A 5IFHL 4ACTA 2DH2A 3LV3B 5L2JB 1XGRA 2WLIA 2P5WB 4K3GA 5LN8A 2P47B 5IROC 2FLRT 2HN7B 3FUKA 4OJEH 1L6XA 1WF5A 4WUKH 5MHSD 3FRUB 5E0FA 1C08B 2GK0B 1C5BH 4JFDA 2VLJD 2ZFDB 3IGKA 4IKLA 4KTYA 2BVUA 2EDQA 5KAQF 4HIIA 4L4TA 4N3TA 4DOHE 3D3VA 3QA3B 4MJ2A 1KYOK 1YPZE 4AQAA 2IXQB 4OKDA 1A1NA 1L0QA 2FE0A 3EF7A 5C0DB 1PKQA 5LCVA 4I18C 1GRWA 3FZUC 4UQ9A 2HVJB 4L1TA 3U9PL 1ZANH 3MA7B 4JPIA 4RAVA 4P46C 3S3CB 3KTUA 3S9DB 3VI3F 5IJCC 2DMHA 1U8JA 3S4SG 3WS6A 1A0QH 5ADOL 1KZQA 2VERN 5CXPA 2ADFL 1YRKA 5HHMB 4ATWA 2K7QA 1DQLH 3WLWD 3DPTA 3QQ9C 4LLYB 1PZ2A 4F15B 2XTJC 1K6QH 4LIQH 2H7WA 1DLFH 2WOBA 3H6JA 3UGEA 3WO3B 2COVD 1E5BA 1RLWA 4QCIB 1UM4H 3T8VA 1CFTA 1CG9B 3LEXB 4TLSA 5I0ZA 1N6QH 4M5TA 4BK5A 1TQVA 4NO3A 3WJLA 1PKOA 2G2NA 4B41A 3UCRA 3TO4A 4MJ4A 2YOCA 3B5TA 1TFPA 3RPJA 1QN6A 2KT6A 3L4XA 4OZGB 2EDBA 2ZOLB 4M3KB 1B0GA 4DGYL 3ZRCC 2EACA 2C3XA 2HKFH 1QSVA 4HU2A 4JVUA 4L1LA 1JDDA 2XIBA 3SE4A 1OLLA 1OM9A 2CO4A 1MCOH 2VC2L 1EVUA 1IBGH 4KKCD 1E9QB 2IEPA 3QWRD 35C8H 2DBLL 3MRPB 3VI4F 2ESVA 1NDMA 2NT0A 4ZMPA 1JWSA 1OAXL 4OFPA 5GZNA 4IEFB 2O93L 1I7ZB 1T21B 3S5YA 2C5DC 1G7MA 3AXIA 3ZTDC 3EOBB 1CD8A 2YUZA 2RH0A 4G7YL 4CSPA 3ZLQC 2Y2YA 4Z7NE 4XCEA 4GAJH 5IYBP 3PHSA 2VW7A 4HBCL 4NO0A 1FRGH 4S1QH 4ZAKD 1X5AA 1WAPA 4ZFFB 2JI2A 4I0CC 3WEOA 5FHAH 4XVSL 4L8BA 2FWUA 1IM9A 1KY7A 5CM1A 5CKAA 4KKQA 1PIGA 2P52A 3GXPA 3P30L 3A47A 5EB9A 5FWRA 1V7ML 2OMUB 1AQ8A 3FCUB 1ET7A 1DSYA 2BO0A 4W6XB 3MV9E 4F9PA 3KPNA 2W59A 3MLVL 3ELQA 3G5YB 4HJIA 4B0AA 3ARPA 4XVUC 3VD2A 3BMVA 3HE7A 4P23B 2D0FA 1JV5A 4BH7B 4EVNA 4I1RA 4H1LG 5EOTA 5C0NC 3CZNA 5FEBA 2ZWYA 3QUZB 1KIUB 5JHDA 5LDSA 2UX7A 3HS9A 3O2DA 3WS6C 3G6AB 2XWJB 5G4OA 4WFED 4BSJA 1OK8A 5A6IA 2EYSB 1GZPB 2HT3D 2IAAC 1GKEA 4J4PD 3VXUE 1A8JH 1XB6A 5EBLB 4K5MA 4TPRH 3N0AA 1HEZB 4YHLH 5AVYB 3TA3C 2IFFL 2HRHA 1DDHB 2A77L 2DEXX 3MODL 3F5WA 4NO2A 4BK5C 4CC1A 5MENE 3WJLC 3UAAA 4W9FC 5EU3B 3EH2A 3TO4C 4XPTL 5IESL 5CZVL 1GGIL 1VENA 1O9ZA 4HF5L 5DD3H 4HG4J 5JDSB 2Z7ZA 1TEGA 2NX5E 4M43H 3NK3A 5TDNA 1U3HA 5IREA 1RUPH 4IJ3B 2R1XA 1KDIA 2CO7A 1XZ0B 2AV1A 2D0GA 5FW8A 3SE4C 2FO1A 2ZUVA 3NJLA 4FLRA 3DIFA 4A38A 4IOSA 1FVDA 3ZE0E 5GZNC 1CFBA 3CTTA 4K23H 3QWNA 5IT2L 1I4FA 3FJTA 1ZK9A 3LS4H 5DHVA 2CO3A 2YPVH 4RZCB 5TFSL 1EFXD 3PDOA 1GGCL 4RGNC 5IGXL 2PTTA 5FYJD 3VO0A 5LKNA 2ZG3A 3GK8L 1YNKH 4YO0A 2LE9A 1LWWA 3PGCB 2G4EA 2APVA 2BP0A 5IVZA 3L7EA 1MLCB 1RERA 1HL5A 2GYSA 5EZOL 5T1LD 1E2WA 3KMDA 5EZJA 2C3GA 5F8RC 3W11C 3BEVB 1XGUA 4WI8A 3TXAA 4XZUA 2VDKL 4F9PC 1NC2A 4XMTA 2E0PA 3VXRD 1M7IB 1F90H 3HE7C 4M3HA 1Q72H 3K6NA 3DYPA 1FORL 1A6UL 2NDFA 2NVMA 4JO4H 4WY7H 3HI1B 3MGOA 4DUVA 3EJZD 1OAQL 3GI8L 3FUDA 4N25A 5FK9B 1HSBB 2ED8A 2H5AX 4CMHC 3CLFH 3IK2A 1NCWH 3NEEA 3HC2A 1GAFH 4PY8J 3NQKA 3S8WA 3IGUA 3VFRA 4C83A 1FA4A 1NLBH 4GW1A 1LEIA 1YEJL 1TVHB 4ONOA 1I3UA 5I6XC 3QJTB 4FQCH 3W1ZA 3FXIC 5HYSA 4Z7WA 3HMWL 4UT6A 1OGTA 3US0A 5C0CE 4HIHA 1RZ7L 1YY9C 1FLTX 4MAUH 1IGYA 2AP2A 2NYKA 1R24A 5J9PA 2QHRH 1UC6A 3QDJB 1IJNA 3SB3A 3UG5A 3WDJA 2WYTA 3QQDA 3W5MA 4GG8A 3SKJL 1PSKH 4XAWL 4HSAC 2PYEE 1TPXB 3AWGA 1HDMB 3ULAB 3QQXA 3A3YB 5IBUB 1W0VA 4W93A 1PCJX 4G6KH 1U3HC 2MFNA 1YPZA 3BXNB 3LOWA 1TIUA 4QHMB 4LPCA 3WMSA 3OJDB 3S48A 2ZSWA 1BJ8A 4LCCA 2B2XL 4DZ8B 4PJ9B 4KJPD 3TYFB 5KOMC 4W70A 4XBEH 2BZDA 3PFQA 4L2LA 1QLEH 4FZ8H 1VFUA 2VR9A 4CAGA 4W9GC 2AZUA 2EYRB 5I8EA 4K9EL 5TTRA 1WFOA 9PCYA 4A7GF 2OR9H 3OZ9H 1XFPA 4PSPA 4G7VH 1XBDA 3ZKSD 4EQ2A 2ZJSL 4JO1L 5ILTL 2I69A 2EIZA 3KL5A 4OY9A 3CW7A 4ZUTA 3QORD 4HT1L 4M5YL 1ZLEA 5CGYD 5HI4C 2G9HA 2Q10A 1P53A 4DULA 3Q2VA 3KBPA 3S35H 5LGJB 1QN4A 3VQ2C 4DJMA 3BWUC 3QIBC 4UAHA 3D25A 1O7DC 1QFWI 5KJRL 1RKRA 4RMWA 4J3OF 1OGAD 4K9EC 2WKOA 3WEXA 4CSZA 4QOKE 4HWBA 4AI7A 4XNYH 2J6EH 1BIIB 3M17B 1JGLL 4HIXL 3KXFD 1FG9C 5DJCA 4QRTA 3ISRA 1E7VA 1QLFB 4F37K 1PPIA 3SBRA 2D3NA 4I18B 4FQXA 1OTTC 3EGXA 3D1MC 3ZL4H 4AYFA 5DHXB 2AF2A 1VZGA 5J0BA 1KGIA 1G87A 5AW1B 4B7IA 3TT3L 4P46B 4ORGA 5ANME 3A24A 1EPFA 4G6JL 5KN5B 3UMNA 4O2EB 3V7AG 3AQYA 5T1DL 5ADPH 4XX1G 5K1VA 3CZFA 3LXBA 1GKOA 1OT2A 3VJ6B 5KWYC 2XTJB 3HHMA 2AXJA 1U95A 2DQHH 3DBSA 4L1HA 3KYAA 1Z5LB 4XP5L 2HH0H 5E1GA 2CO6B 3LH2L 2BHFA 4MD4B 1JFQL 4PREA 3VH8B 3PWNA 1AD0A 3VXME 2KBGA 1WEJL 4TUKL 1JPTH 4R5XA 1YUKB 5D7LB 3B83A 2E27L 1VGEH 3MV9A 4IYKA 3WHXB 2A6IB 3HNSH 4QXVA 1DBMH 1EA9C 4JX0A 3UC2A 3OKYA 1JHKH 3KCWA 3LNEA 1EXUA 3FF7A 5ISZD 1QR1B 2VSDA 1LP9B 2I24N 2QPEB 1BFVL 4OF0A 3D39E 3N41F 1XGPA 2DM7A 3MRMA 1RZQA 5E6IC 3F62A 3UJJH 1BQSA 4EKJA 1P7BA 2IQ9H 3VXUA 2YQGA 1N18A 1FNSL 2WXHA 4HCFA 2QPSA 5D1XE 4O9HL 5DVKA 2UUDK 1H9DA 1XGRB 2WLIB 3R7RA 1OANA 3AG4B 1MP9A 3Q5YA 1NEZG 5MENA 3WFDH 4KU1A 4FYQA 5IYCP 1ETA1 3PGFH 2YUWA 2DQEH 3KE0A 2DYPD 3P4OB 4JFDB 4HIIB 4L4TB 1EXGA 3BGFC 3D3VB 5E9AA 4KK8C 5BMNA 2X2HA 4AQAB 2MHAA 4LGRB 1A1NB 1E6JL 4J3VA 4J8QA 4KAQH 4RODB 2Y36L 5KVDH 4FQXC 3CFCH 1ZOXA 1DVTA 2Z3FA 1KBPA 1LO3L 3RBSA 1KLUB 1SVCP 5IK3A 2AMGA 3HRZA 4JPIB 4RAVB 2FWLB 2O1AA 1ZDQA 3ORJA 4E9SA 2HRGA 1U8JB 4G11A 3AJ7A 4DKTA 2R8SH 3OVUB 5JIHA 4KXBA 1JXGA 1KPRA 5GGQL 1VOKA 1I1CA 1R3IL 2Z4TA 1YEDA 4LDCA 4NZTH 3RX7A 3EYSL 4YUEH 4PGEA 2YEZA 3IDNA 4N68A 2OX5B 1N3NA 3PJNA 5I76A 3IDGB 1FCGA 3TA3B 2R29H 1L9MA 1CFTB 3NCEB 1X7TA 4DP7X 1BVOA 2V5SA 3D0AA 2XNAB 3V4PH 2E7HA 5FO8A 2XWRA 2YAMA 3TO4B 4G8IA 5B39A 1Q9KA 2J43A 3WCYA 2VMFA 4HHWA 4ODVL 4QAMB 4U6XA 1HHKA 3RI5F 3GHPA 1B0GB 4E0RB 1J3MA 3O0RL 3DBXB 2CKBB 2V3FA 4OZGF 3LKSA 4Q9QH 3BP5A 4HJEA 5JXEA 2X87A 1G94A 1J10A 5T5NG 3CD4A 1TMCB 2XT1B 1S7RA 1R6VA 4MHHG 1ZEAL 1CZ8H 2J1KA 5GS0C 4MRCA 4OU3A 1EEUA 2ESVB 3JV4B 3O6LH 1NDMB 3SYQA 5C3LD 1JWSB 3GZQA 4HGMA 2LLLA 5GZOD 1XL4A 1G7MB 4K5PA 4CFFA 1QLRA 5C0CA 1QN9A 3MLUH 3ZKXC 1AXTL 4RGNB 3DYOA 4KC3B 4XCEB 1KFGA 4P2CG 4NO0B 1L3NA 1HWWA 5G5DA 3UTSD 1UYWH 3V4UH 1GVIA 3IMUA 2PYEA 4IKNA 2J1XA 3IJ7A 4ZUWB 1IM9B 3CWSA 4L5FH 3DX7B 5HYEA 2F58H 4HH9A 3O11B 3OSVA 2WO2B 3KPNB 1S9VA 4BQCA 3IRZA 2OYPA 3HE7B 1JV5B 5EOTB 1QA9A 4TKWA 3HRZC 4X6FA 3PP4L 3OBAA 3R8QA 1J9TA 5JHDB 1MRFH 2UYLA 4X7CC 1RZKL 2VLMD 2XXMB 5T1KA 1NCUA 4CMHB 2G9KA 4XN7A 2RQ8A 1XF3A 2HTLC 4JM0A 4Y9BA 5TQ2L 3NPZB 1ZMYA 3IJ8A 5I6XB 3D0VA 3JWOL 5C0FA 3JZ7A 2IFGA 4ISVA 2B7DT 4Z0BH 1ROCA 1QACA 3NH7L 1JXFA 5JQ6H 4AUJA 3F5WB 4NO2B 1JI2A 2FO4A 3GRBA 4RETB 1JOIA 4D7PA 1RZKC 2ZYSA 1HQ4A 4NRYA 5D2NE 4BZ2L 1G7LA 4QOKA 4YZFF 1M6UA 2I25N 4DKFL 3KWTA 1JNLH 3HAEA 2IVFC 5KS9F 3FK3A 5TDNB 1U3HB 1MI5D 2JFCA 4D3CH 5JXEC 3FMGL 2R1XB 2CO7B 3H9SD 2AV1B 3MOBL 2OZ4H 3V0WL 4BELD 4KKAD 3WNKA 2BP5M 5EF2A 4JKPL 4QRUA 4QRFA 4FFYH 2GEEA 5IB5A 2EIJB 1FVDB 1KACB 1KT2A 1KXTA 1QI5A 1X5XA 5A1AA 1KBGL 2B08A 3OR7A 5ANMA 4GP4B 4Z77A 2GJ6E 3U0TB 1I4FB 1L7IH 3U4AA 5DHVB 4DETA 4DVRH 3PDOB 1MHEA 3OGCA 5EN2A 3SBPA 4CL7A 2PTTB 2KPNA 4YO0B 3MLSL 1UWXH 1YG9A 5FKAA 8PAZA 4WI3A 4PJGF 2BP0B 4Z3TA 5IVZB 3L7EB 2YA1A 3OG6B 3GJFA 4KXZH 4QXGL 5EZJB 2GUYA 5LWYH 3VXMA 3T3PB 2BM3A 3QIBB 1H15A 1XGUB 5BO0D 2JCCF 5I0WA 4FTVE 1NC2B 1CT8A 3B8SA 3PP3K 5L6YH 2HTKD 3MA9L 1NOFA 3ISWA 1I53A 4PN6A 4X4XA 1BJ1H 3F65A 4IL8A 2ZOOA 3D39A 4HOXA 2A9MH 5BV7C 4Z0XB 1OHQA 3VFRB 4C83B 1DJWA 1G9NH 1NCBH 4GW1B 1LEIB 2J2ZA 1QFWL 1KWKA 4I7ZC 4OF6A 5HYSB 4Z7WB 2EXTA 2FTAA 3LKNA 5D1XA 1GGYA 4HIHB 1C7TA 3SKOA 3Q6FA 2CRYA 2XZAL 3FTSA 4CA4A 5EO1B 1IGYB 5FHBL 4XP1L 1R24B 3K5SA 4XZ4A 5J9PB 1UACH 1WA1X 3QQDB 1M3IA 4LPWA 2WUCL 4GG8B 4XPGL 5ENWA 2GCYA 3MRLA 3QIWD 3UCQA 3ZR6A 4HAGA 3WFHA 3CN0A 2MPVA 4YSQA 1ZXQA 4XAKE 4DOHB 1LK2B 1W0VB 3S36L 4XNQA 2QJDA 4OZFH 1UGKA 4NKIL 3B7RL 5I1IL 2FX8L 2ZSWB 3CQQA 4FYSA 4Q7DA 5ITBH 4HEME 5CLZA 4JR9L 4PCKA 5CEXA 1T6AA 1DLHA 1UT1A 1DBKL 1XR9A 3CG8A 3FU7A 4O00A 2Y4SA 1J9SA 3NJHA 5DJ0A 2CXKA 3PAYA 5E4AA 2VSMB 3DXAE 2FECI 1MW1A 3LB6C 5E6IB 2FO8A 2AQPA 5CZXC 3NPSC 5KANG 1QNIA 3TJHC 1MG2C 2H5UA 4AUUA 2G9HB 2WN2A 1MRDH 4TVPD 2EEXA 5LBSA 3ROOA 4B0MM 3BAEH 4GQZA 1OWRM 4N3UA 3D25B 2VXVL 4NSKA 2BSRA 1OE1A 1KG0A 1AIFA 2AANA 3EZJB 3N2JA 4JRWA 1OP5K 1S7UA 2A73A 4ZW5A 3WEXB 1JCKA 3D2UD 4LOVA 2C7FA 2WANA 1S7XB 4JRYE 3BGFB 2YPLD 3GHEL 2OJZL 3O4OC 2OL3A 5DJCB 4QRTB 5GGTH 5TQ0H 3UBXG 3MZTA 5DVMA 4M1DH 2JK5A 2YQ2A 3EUDA 4Y2OA 5LHDA 4FQXB 3EGXB 4IM8A 4GOSA 3O81A 4HHAA 5FB8A 1E8YA 4KKPA 4ORGB 4GAGL 1AYRA 1AQMA 5ITFA 3I6KB 1CGXA 5DA0B 3L4CA 3WSQL 1HVXA 3CLWA 4O58L 3CX5K 3D5OF 3LPPA 1T0NA 3PWLA 3MHZA 3IDIA 4Z7NB 4LB8A 1FNHA 1DQQA 2ATPA 4KDVA 3ZL2A 3RNKA 1U95B 2N1KA 3QJOA 1XVSA 4NUMA 5D7SH 4PREB 2Q8BL 3IMWA 1SBSL 1SDYA 3PWNB 3TCXA 1AD0B 2RIKA 3UADA 1XGTB 2DWDA 4X8XA 1RPQA 2UXTA 5DWUH 2IDUA 3CVIH 3UO8B 1YECH 1CLZH 5SWSD 2NY1D 3MV9B 1UJ3A 2WBWB 3BDYH 4DNLA 4PVNA 4HJTA 4CJ1A 5HHVH 4X5XA 4U6YA 1WAEA 3ZZLA 1ESOA 3MACL 5LBSL 4HPHA 1G0XA 2LT9A 1EXUB 1OAZH 2RA1A 3KPOA 3FN9A 1XGYH 4RMVA 1LP9F 1MREL 1A6AA 4R7LA 3B7YA 4O4YH 1XGPB 4X7SL 1DANU 3T6QC 2OL3L 3CFKB 3MRMB 4W4OA 1VFAA 2LHAA 3B6SA 5IUSA 5J13C 3VXUB 4YS4A 3N1MC 5AW2B 1CR9H 4E5XA 4KJQC 3RIFK 3KR3L 5F44A 1M9SA 3W0WD 4XTRD 3ZKXB 1ETB1 4QPEA 5CAYB 5I19L 1MWAL 4MAZA 3WG7B 4E9RA 5MENB 5GRUL 5DJ8A 4I3GA 2E74C 3TU6A 4XWGL 2IQAA 2CCWA 4NBXB 4NPYB 4ODSL 1ILSA 2B39A 5I0VA 5D2NA 4QGTA 1H3PH 3L3JA 4JL2A 4C56D 2EKJA 4LKCA 3MCKA 5FDYA 3QEUA 1BSIA 2MHAB 2YR3A 5I1HL 2G60L 4MA3A 4ZMAT 3HS0A 3BRGC 1BAGA 5JN5A 3BESR 1XEDA 1LHZA 3SYAA 5IVOA 5IZ7A 5IK3B 3HRZB 3LRHA 2ZKYA 3ZE0B 1AS7A 4ZW6A 4NNPH 5I73C 3DSFH 2DW5A 3SO5A 2GJ6A 2ZQKA 5LQBH 2VRAA 1IEAA 5CEZD 3P1VA 3WY3A 2KDYA 5EU6D 3PWJA 4J3OH 5D7EA 4TPSA 1A5FL 2PN5A 4XMLL 1XCQB 2YD8A 2QRDA 1BVLB 1PFCA 1YEDB 4J27A 3FULA 2M83A 1ZIAA 5D2LB 4PGEB 5I76B 3IDNB 1N3NB 4N87A 4WIQA 3OAUL 1ASQA 4JK0D 1U8IB 2A5UA 1A6ZA 2E75C 2Y2WA 3P73A 1TJMA 4OLVL 4Y1AA 1WFMA 3MROA 5FO8B 4IBTA 4H8QA 2NY2D 4G8IB 4NYLA 1Q9KB 2V37A 2WVVA 4FTVA 3UPAA 1KUMA 5B39B 4JG5A 4U6XB 4XC1L 1HHKB 1Q9WA 3DOSA 3WN6A 4FFVC 4MASA 3QHZH 3VD3A 3QXVA 2EDTA 5HDLA 3LKSB 3BRDA 5DUBA 4A37A 1FNFA 3BP5B 3DI2B 4RBPK 2HVKA 2A9CA 1PCMX 2HLEB 4XO4A 1N68A 4LSVL 4Y4HD 1A6PA 3T65A 1XGZA 1EJOH 1TO4A 4QLRA 4W4OC 4N2IA 3ELAT 2C1PA 3DMMA 4N9GA 3IAPA 3GEWB 2CMRH 2Y06L 1DFBL 5FO7A 1QLRB 3FNKA 3HVNA 3QJUB 4JL1A 5C0CB 2F53E 4KJWC 2BIHA 2YK1H 5EFIA 4QRPB 4E9TA 4LGSB 3M7FB 4FCHA 2ZCKH 5G5DB 3K8LA 4JPSA 3B3IA 3KCPB 5D2NC 1A47A 5DFVC 3B2MA 1QOKA 2WUBH 1JZ5A 4LEBA 4MWFB 4HH9B 3SOBH 3JSSA 1FVCA 3HS0C 3U2JA 2Y1AA 1ILUA 1DL7L 1NFDE 1S9VB 1AKJD 1K3ZA 5C2BH 5JIPA 3WNOA 1XSOA 4Z7VE 3VMPA 4HEMA 1QA9B 3K6SB 4YDLC 1O6SA 4DGVH 1OW0A 2KH2B 2NXZD 5EEVA 3K8MA 2CJUL 4M6AA 2OBGA 2FD6H 2M26A 5F9OH 4PVBA 4KRPD 2UYLB 4TSBL 3DSNA 5T1KB 5DVPA 3LNGA 2OXGA 1RZGA 3DXAA 4FRWA 4P2OA 1XF3B 4AIEA 5BV7B 4AH2A 2QADC 1U8HA 1ACYL 4JQIH 3WTWA 1HHGB 4YHIA 1KNOA 2VDPH 3D0VB 3U30C 5C0FB 4MTMA 4ISVB 3OKDA 3CFNA 4M6MH 2BVYA 2W60A 4KHXH 4WENB 1QI4A 4O02L 4JANA 2X42A 1UXMA 2MKLC 2FO4B 1NC4A 4ALAL 1MF2H 2FQDA 4HFWA 3LS5L 4NRYB 1HQ4B 2BCMA 5F93C 1G7LB 4QOKB 3HB3C 2X4PA 4JRYA 3HAEB 3DO3A 4OGXL 2VSKB 3WKML 4KMLB 2CPCA 2ZXCA 1KENH 3KPTA 4QRUB 3WAKA 1HZHH 1R47A 2YKKA 3OZKA 4OZHE 1CGSH 5IB5B 3I9PA 2Q76A 3O45A 2UXFA 4TTGA 3DMMC 1KT2B 1KXTB 4ALAC 4OQTA 3NCXA 5ANMB 3WIHA 1TNMA 3QRGH 1MPAL 1A9BA 2OW7A 5E70A 5L4FA 3GSWB 5KAQG 1NH2A 3AG1B 5FO2A 4BRVA 2DL2A 4KZEH 1MHEB 4XVJL 5EN2B 3QUXA 2KLRA 1NPUA 4AEIH 4BUGA 5GS1A 5JTWA 2X4SA 5FKAB 4N86A 3SE8L 2OMZA 1DZBA 3NPSB 3UIZA 3HZYA 4Q6KA 5FGCE 5C71A 1G9EA 4CMMA 3GJFB 4FNRA 4U3XA 1SNRA 2V9RA 2RBLA 1OTUD 3VXMB 2F74A 2VJ8A 4JUSA 3SHSA 3VXPA 1H15B 4Y9EA 3GFUA 1A7RH 1YNTA 1KPVA 4L3CA 5ANHA 3W3BA 4XPAL 3T3PF 4DN3L 1CT8B 2IPTL 1KJ2A 2XQBH 3RPIA 1LDPL 2X1PA 3ARDA 5MHSE 1CU4H 2FECL 4U4IA 4XODA 2DWTA 1OW0C 3S34H 3TZVA 3O4OB 2VLJE 3DX0A 3RKPA 4UV7H 4AWJC 4ONHA 2C9RA 4OCRL 3VFTB 4UTBA 1NBYB 3C6LD 1RUAL 3F04A 4CGTA 1RUQL 2ROXA 1X44A 3D39B 4TYUA 1GCYA 2RTTA 4IGBA 2IAMA 4TRPL 4P2OC 5BPPA 5K39A 3FAWA 3GBEA 3Q8FA 3UG4A 2J2ZB 1CUOA 1BZ7A 1XSJA 2CBQA 1NLDH 2HKHH 3C2AL 4DEUA 3MJ9A 3LKNB 3SKOB 4FLOA 3Q6FB 5AVVB 1MFEH 2NOIA 1H8LA 1KJ3H 5IHUL 4OQTL 5ENWB 3WIHL 1F4YH 2GCYB 3MRLB 5SV3A 1KYAA 3D4CA 4GAAA 2ZONA 4I1NB 2N1TE 4WSGA 3APFA 4YWGH 3WFHB 4NBZB 4HALA 2D7OA 3ZQWA 4KO7A 1EQWA 1NUGA 3COOA 4XNQB 3R18A 3A4FA 3RVXD 4JZNB 3MOAL 4ZDHA 3TCLA 5AALA 1YPZF 3KG5A 4QRRD 7FABH 2GEQA 3IKCA 4K7FA 3WKPA 4KROD 4P9HL 5CEXB 3FU3A 1DLHB 3U7AA 5BO1L 1CD0A 1XR9B 2KL6A 1I8IA 4Z3JA 3GB7A 5DJ0B 3GMMA 1KJ2L 3CN1A 3G6DH 4M7LH 3D9AH 1T7ZA 3NRFA 3QC6X 5AW5B 3QUXC 4N8VG 2ZT9C 5EOCL 5GS1C 1XH0A 1MVUA 5C0BD 4ELDA 3KVDD 5J13B 5BUPA 1IZJA 4YNYA 4UTBL 4PLOB 2ZYRA 4QNPE 4U1GC 3DUHA 3FU5A 1MCQA 1JVOA 2YAQA 4P9HC 3ROOB 3UDWC 2CR6A 2CK2A 4K73A 1L7TL 2BSRB 1KG0B 4JGJA 4WW2A 1AIFB 5EUOE 2Y8QA 3N43F 4QI3A 1OQOA 1S7UB 2AEQL 2A73B 2KHAA 4OZFG 4NQDD 4Q58C 3MJ9L 3RB7A 9CGTA 2VMDA 3ARDC 4PRPD 3IJYA 4E2OA 2BRQA 4ONFH 4ZD3H 2WKOF 1RCYA 5LGYA 2Y07L 3PGDA 1UQSA 4FLQA 4PWFA 3RGVA 3I6LD 3BC9A 4IIQA 5KVEE 5CHNA 1XBRA 3IF1A 2JK5B 1OCZB 5HJDA 1MFNA 1UM5H 4Y2OB 4YDIL 4IGBC 2IAMC 4N2GA 1FO0A 2IALA 4PEEA 5E2WH 2V17L 3QJQB 1AZVA 4GINA 2NR6D 4IMKA 5FB8B 4R96A 4ESKA 2FR4A 4AIOA 5I73B 5ITFB 3MLYL 3VXNA 5I15L 2IAND 1B2YA 1T0NB 1J1OL 2F53A 3PWLB 4JFVA 3VSQA 3IDIB 4HW6A 4HUCA 1MCBA 1YNLL 1VTLE 1DQQB 2ATPB 4LCIL 2AK1H 2C9QA 2J73A 4Z7NF 3RNKB 4NKQB 4N2EA 4WCYH 4NAMA 5DYFA 4Y16D 3ZKND 1MZZA 1YYML 2Y7NA 5EIQA 1IAIH 2DWDB 4DGIH 1TBPA 2HKPA 3QEQD 4GT7A 4GXFA 2CKNA 3F58L 1B0RA 3SDDD 5M95B 5DC0A 1MW3A 1CLCA 4X5QA 3UJTH 4X5XB 4U6YB 2P49B 2RFXA 3V6OE 3VAEA 4Z7VA 1T83A 2YD0A 4U1IA 5I18H 3QDMD 3M1OA 1ADQH 4MMXC 4IRSA 3KPOB 1B0IA 4N1EA 3SQOH 3WNMA 4M5SA 5LJYH 1A6AB 3LEYL 3CDFA 1MJUH 2GIMA 2B8OT 2EE2A 3RNQA 1KLFA 3OAZH 1L6PA 1VFAB 4F80A 4KFZC 3H56A 4NNXA 3KWWA 2QVKA 1A02N 3DVGA 3U83A 4E5XB 1KBWA 4FULA 1S7VA 1YMME 5H2BA 2H1PL 3PAUA 1X7SA 3JTBA 4NB7A 2JHJA 1FO0L 2WZ0A 3I02A 1OD7A 4KI5D 5DJ8B 4WW2C 1JHLH 2IQAB 6PCYA 5IHWA 2Z7YA 5D2NB 3L3JB 2E9JA 2OMVB 4Y4FA 2MCG1 2B4CH 3GNML 5ABAA 3ZDZE 2OMXA 3B9AA 4LKCB 3MCKB 4WI6A 1NMBL 3RGVC 4JGNA 3QEUB 4IIQC 2WWKT 2Y9RT 4MZ3A 2DPKA 4MA3B 5IQNA 3WFCH 1BLIA 2OCFD 3RJDA 3HS0B 1J8HB 4BE6A 2WGNB 1J05A 1UD2A 1RUKL 1E9PA 1TCMA 4Y19D 2CUHA 3RE0A 3ZDYF 2VRKA 4KNUA 1I9RH 4OZHA 4XNUL 1AZRA 2ZX8A 4YDLB 4YHYC 2F8OA 3VXRE 4IMKC 3HNVH 2JJSA 1N67A 3UL4A 1ASPA 4OD2A 1AE6H 2GJ6B 4TM9A 2VITA 1JK8A 1Q0YL 5F6IB 1VERA 2NY0C 3PWJB 1E4XH 2JKXA 2Q87A 2QADB 5TPWL 4RFEA 5A2CA 5DGRA 1NAML 1VDGA 3T2PA 1JGVL 1HXMA 1N0LB 2XN9B 3DTXA 3QNYA 3U30B 3TN0D 4AUYA 2BVOA 4F3FA 3IFPA 1H3VA 2PCPA 1A6ZB 3A67H 1ET5A 4PJHF 3P73B 4M02A 5FUZH 1KLGA 2IDFA 3NJFA 4Y1AB 5F7LB 3QS3A 2AQ1A 2G0LA 5KEZA 3MROB 2E47A 5IFHH 2H2PD 3K74B 3NGBC 4NYLB 4Y5YA 2WVVB 3QCUL 4FTVB 1T2JA 4DFHA 3Q01A 1L0PA 1SMDA 1T83C 3HB3B 1Q9WB 1QQDA 1Z9OA 1IFRA 3DOSB 4ZOEA 2D2OA 4IRSC 4LXFA 4AJ0A 1MFCL 5DUBB 3ZYIA 4CDHA 2VLJA 5B21A 4NC1E 2HVKB 3N42B 1OXYA 2BY1A 4PTUA 4M93C 1X5MA 2EC9U 5BRPA 2WWMC 3T65B 5IP4A 4WEUD 3DUUA 4XN1A 2CNZA 5HVWA 4J3OG 4UF7C 2J8HA 2C1PB 1WGVA 3DMMB 4NZJA 4P2YA 3X3FL 4AITA 5FECA 3LQMA 5A2AA 1EANA 3U9PH 5EFIB 1V10A 4I48B 4Y9GA 4EMZA 2R4SL 2WWOA 1LQBC 5C2UB 1NCDL 5CFAA 1UCTA 5DR5L 4AW4A 3B3IB 5ADOH 3C8KB 4DFIA 4Y4FC 3G5XA 2ADFH 3RTLA 3MNZA 2Q86A 1JVKA 4RDQF 1QSED 5F7NC 3UMTA 2VZTA 1FVCB 2R4RL 3NCFB 3CX2A 3BLBA 4UQCA 4EEEA 1OGAE 1O6SB 1H3GA 2R1WA 2JJSC 2VDOL 3KXFE 1URZA 3DSNB 4NM4L 2DJSA 2OXGB 3IEAA 3IKKA 1RZGB 4DGYH 3DXAB 4P2RD 4P2OB 5E6RB 1C5CL 1HS6A 2Y0SA 4AH2B 4UIKL 1MCDA 1B2WL 1JL8A 1U8HB 2E9WA 2D03L 2NSXA 5C6WH 3HUJE 1H3TA 4EIZC 5JOEA 2X6VA 4YHIB 4J23A 2M8XA 1KNOB 2H47C 3IMSA 2PW1A 4M7ZC 3ESUF 2VC2H 3GO1L 3VYPA 1S9KC 5I1JH 4AC2A 2DBLH 4YOKA 1A4BA 4A2FA 1OAXH 3GXFA 3QS2A 5JYLA 3RYMA 4BCXA 3VD5A 2X4RB 3LHAA 4OLYL 5EUOA 3ZUNC 1NC4B 4Y5YC 1H3WM 4HFWB 1A2YA 2K78A 2VB5A 3MO1A 4JDZB 4XMWA 2A2QT 4B9PA 5EEYA 1CN4A 4G7YH 2J71A 4ODXA 1CI5A 3KPLA 5LGJA 2X4PB 1QNAA 4ZAKA 4P5KB 1A64A 4HBCH 3RVTD 2K9FB 1TLKA 4RVBA 1H9VA 1EHNA 4A2HA 4XVSH 1XF1A 4ZYKA 5B7MA 1MN4A 1WS8A 4R4FL 3P30H 1GIGL 2Q76B 1A7NL 3O45B 4U6HA 5GPRA 1V7MH 5TK4A 2L7JA 5IF0B 3MLVH 1A9BB 4ZW3A 5B3NA 5ISZE 1XAUA 3QUXB 1ANUA 1RZIA 5HP5A 5GS1B 1W9XA 4FA6A 2F8IA 1DIZA 3Q9QA 2X4SB 3DRTA 3ZL1A 3U0WL 3HZYB 4U1GB 3G5ZA 2WB1A 3WLWC 2BSDA 5F89A 4QDGA 2ZSVA 4J4PA 2PWDA 2ZNWA 2H0FA 2VAJA 1NGQL 2F74B 4L05A 4GO9A 2WK2A 3QRBA 3H8NA 3LZPA 4GNKB 4M9OA 2JB6A 3VXPB 4A7VA 5F71A 2CLRA 4HGWB 1YNTB 1KPVB 2H0EA 5B1AB 5CKGA 2GJZA 2WLHA 5F2FA 3RPIB 2IFFH 5J6SA 3TFBA 2AAVA 2KLSA 3V6OA 2A77H 3MODH 5CBAA 1BM7A 3OB8A 3C5JA 3EG9A 5F7BA 3Q06A 3LNFA 4DN4L 4XPTH 5IESH 5CZVH 1GGIH 4ONHB 4K3HA 3P0GB 3SGEH 2VR4A 4HF5H 1FIEA 3NJGA 1CE1L 4IGBB 2IAMB 4GI6A 4WU7A 4OCSL 5K39B 1BF5A 1BZ7B 4BK4A 4EDWL 2WY3B 4LVOC 4KKCC 4N90D 5F7FA 5AW7B 4F24A 2GPZA 3S3JA 4Y2LA 2X1XR 2HFEA 4N2KA 1X5FA 2DD8L 3Q8BA 4U0RC 1KO9A 2CE6A 2J3SA 1OE3A 2CBOA 3DX8B 3O2WL 4JFWA 2BXZA 4WTXA 3SKNA 4G80A 5BVPL 2DM3A 1NUNB 1GW0A 2F5BL 5IT2H 4JM2F 3N6YA 3MKGA 4OF7A 1EFXA 3C12A 5EPCA 2AAAA 5D5ME 4YDZA 3M45A 5TFSH 3L5JA 1QO3A 1GGCH 5IGXH 1GYWA 4ZAKC 2NZ1A 4K94C 1GJIA 1Q0XL 3EZ8A 3GK8H 3SKMB 5T1LA 1XF4A 2OI9C 2D0AA 2LU3A 4ZDHB 3TCLB 4KGLA 5EZOH 1JV2A 3D7PA 3IKCB 3S8FB 4U05A 1S7SA 3D4VA 3CSTA 3APNA 3IDUA 1UA7A 3VXRA 4BDVA 4MMXB 1A1MA 1I8IB 2VDKH 3GB7B 3ZHLA 3KBEA 2JCWA 2OJEA 3GMMB 3CHOA 1FAIL 4IBUA 1I1FA 1B9KA 1FORH 2FJGA 4K15A 1V8HA 4ES9A 1PY0A 2X28A 1MVUB 3BKJL 3QPKA 4JKWA 1OAQH 3GI8H 4K9JA 4YNYB 3I75A 2HT3C 4CRPA 3F64A 4J4PC 2JJUA 2MQGA 5CP7A 1JPGA 4NCC2 3WDHA 1YEJH 4DO6A 3RRQA 4KUCF 2J8OA 4WW2B 2DOCA 5SX5K 3HMWH 2XY2A 1RZ7H 5TJWK 2XKUA 3V6OC 4HPYL 2GG1A 2VZ1A 4DAGL 2BW5A 1F8TL 3NESA 3UYOD 3SQRA 3PGDB 1I82A 1UQSB 1QD0A 4N2DA 3RGVB 4IIQB 3SKJH 5A16A 5CHNB 4ONGL 3IF1B 2YZ8A 4TUOA 4XAWH 2F61A 4H0IA 3E9UA 5DHVH 3C60C 2JIXD 2OP4L 1CQYA 5F7KC 4A7TA 1GYAA 1FO0B 2IALB 2W8CA 4YHYB 3TV3L 4Z3HA 3AT9A 5H94A 3VXNB 4ZBJA 2B2XH 4X6EA 4ZG1A 3SY0A 1JG9A 2ID5A 1DSWA 2NY0B 3UZEA 4YSCA 3DRQA 1GCFA 4I8DA 2P44B 3EO0A 5DJDA 4DP6X 4ANWA 2VLME 1KFQA 3B34A 2FYVA 3Q7JA 5KTEL 4K9EH 4HMCA 2YUVA 1ZCRA 1SHWA 4MKTA 4N28A 4XCFL 5A6LA 5CN3A 1PDKB 2ZJSH 4JO1H 2WPGA 3QORA 5ILTH 1UM6L 1KB9J 1EAOA 1ZA3B 4HT1H 4M5YH 3NGBB 3E1ZA 1B0RB 2ZNXA 3BDBA 5DLML 4PV1C 2BH0A 1ONQA 4AGNA 2RFXB 1TZAA 4Z7VB 3ABKB 2EADA 4U1IB 1OGAA 4NPJA 5KJRH 3OC5A 4FABL 4IRSB 5JMVD 3WO4C 4NC2B 5G4MA 3KXFA 3B37A 1UL7A 4M93B 1QTSA 4HIXH 1JGLH 2W88A 1MI5E 1P1ZA 4YLQT 4R8WL 3EJZC 3AAZA 5ES4B 3H9SE 3RNQB 1S4IA 4FOMA 1KLFB 4Q2ZA 1TZOA 3HUJA 2XJLA 3KWWB 4NNXB 3U1QA 12E8L 1SXAA 5F7EL 1S7VB 1CYWA 2RACA 5H2BB 5LB1A 5IHLB 3DPBA 3W5NA 1R33A 3HOGA 3NJMA 2F7LA 3ME0A 1AMYA 5E03A 3TT3H 1AI1L 3I02B 2Y7QA 1G1OA 4KJYA 5CCGE 3S2CA 3DVNB 3N3EA 4G6JH 2EDMA 4OFDA 5T1DH 1J8KA 4A04A 1MCJA 3KGSA 4YEEA 4Y4FB 6TAAA 2OMXB 3BVVA 1HN1A 1INDL 1WQVT 3BSGA 1T03L 4PD4J 2E6QA 3LH2H 3NA5A 1JFQH 4OZ4A 5ALCL 1J05B 1E9PB 5C92A 1WEJH 4PPTA 4OZHB 1E7UA 4TUKH 1V3LA 5LNDA 2BPBA 4F27A 1ZD6A 2E27H 3FTZA 3HJ0A 2A38A 4OD2B 1N19A 4S1SL 3TBYA 5F1IB 1JK8B 4MD5A 5ISZA 4CSSA 3UZEC 1L9PA 1KULA 1KMGA 4RFEB 1SN0A 4P5MA 3LRLA 1BFVH 1BG9A 1INQA 1HXMB 3DTXB 3QNYB 4M7ZB 5FR3A 2QELA 2Z9TA 2BVOB 5FGCB 1MFAL 4LBAA 1IEHA 3GEFA 3IFPB 4BJLA 4G82A 2AGJL 2PCPB 3QORC 1IL1A 4XH2A 5CGYC 5DF0A 2VDOB 3ZE2E 1E4WL 1RPKA 1J1PL 3VU2A 4HUNB 1FNSH 2WW8A 3UBGA 5GJTL 4O9HH 1YMHB 1I9IL 2HPTA 4A6YA 4CU6A 5CSZA 1VEPA 1PIFA 1XMWA 2DLGA 1QQDB 2CA4A 3LH9A 4QLWA 3S35X 2DYPA 2VLJB 3KZ8A 2Y1VA 3AMKA 1P4UA 4HAFA 4OH2A 1J5OL 4PTUB 3EJPA 5D7IF 5FA4A 3PPEA 1TZGL 4FYTA 4M1CD 3DUUB 3FU9A 2C26A 4XBGA 4R4BA 5B1CA 2ICWI 1E6JH 5FECB 1JWMB 5DI8A 3GLDA 4GXVL 2IGTA 4J5VA 3QFJD 1F00I 1Z32X 2Y36H 5EBMA 2VE6A 3EO1B 1RP9A 2JJWA 1LO3H 1VZHA 2QSTA 4UQIM 2EE6A 1MW2A 1T1XA 1TYRA 3VCLA 1BJ1J 1CF1A 2O5XL 4F5CE 1QVOA 5I28A 2JJVA 4N4YB 5D5MA 3G5XB 2XZZA 1SJVA 3QZPA 4H88L 2PO6D 2MSPA 3MNZB 2Q86B 3KGTA 1R3IH 3BVDB 1LDSA 1IKFL 3OPZL 5KSBF 2X40A 3EYSH 4CJ0A 4TVPE 1BG1A 3FCSA 4ZUUB 4U6VL 3IGFA 3IM1A 4DIXA 5KVFE 2A9BA 1BDYA 3BZFA 2R1WB 4OCLC 1MCKA 1P6WA 4YJZL 5IVNA 2R2HA 5BQDA 2XXFA 4IDJL 3QEHA 4MQ7A 3W38A 4ODVH 1K35A 1IGTB 1UT2A 1FBIL 2Z8UA 1OAYL 2AKRA 5CSBA 4EXPX 5ICXB 3O0RH 3ULVD 4H40A 4NO5A 5LAXA 3GMPA 4LVOB 5CNHA 3JV0A 3BI9X 2PW1B 3IGAA 1DHKA 1ZEAH 3JTTA 3VFNB 2R5XA 4HUWA 4U0RB 3C6EA 3OXRA 5BXFA 3MRBA 5GZOA 1JPSL 2XQYG 1DQKA 4PBXA 4Q4EA 1ZHKA 1ACZA 5EUOB 4MB1A 3Q8CA 1A2YB 2AXWA 4HWUA 2GHWB 4PRAB 2O5ZL 4JQVA 3HI6L 1AXTH 1AR1D 1VCBC 3KPLB 3KEHA 4GAYA 4ODXB 4YDJA 3U46B 3WFEL 2HLFD 1YDPB 4ZAKB 4B9ZA 1OP3K 3UTSA 5E5UB 1MEXL 3ML8A 1YAIA 1OEZW 5E00A 3REWA 2PYFA 4PJAE 2OI9B 2G30A 1YAZA 5DTFA 1EAQA 4EAEA 3MSPA 2ZUSA 4ZO7A 4ZYKB 5E5MA 2R7EA 4FNQA 5SWSE 2XZQL 3L3OA 4IQHA 2P5ED 2X05A 5B22A 5ECGA 4EI0A 2JH2A 3MFFA 5A6MA 4C7PA 1CDIA 3F01A 4IW4C 1R3KA 4Y5XC 3VMNA 1J9CT 3ES6A 1KGCD 3V5KA 3PP4H 4JFUA 3OJ2C 3K7UA 1ZLWK 3VX0A 5PCYA 3ZDXB 2X10A 4LL1A 1S7WA 3BHBB 1PFOA 1RZKH 3DRTB 3OC3C 3G5ZB 1E5UI 4GS7C 1K72A 5F89B 2VDRL 2ZSVB 4D0DA 1KCUL 1SYSA 2OOXA 5CIPH 4OD1L 5TQ2H 5K1NA 1HH6A 3UJIL 2JB6B 3JWOH 1BD2B 2CLRB 3W0WE 4GMTL 4DKEL 3DX9A 2GJZB 3RHWF 3NN8A 1MPGA 3NH7H 3AXHA 4KXCA 5CBAB 2AK4D 3DOHA 1G7QA 1OD9A 3C5JB 3EG9B 3Q9PA 1HXKA 2XKSA 4C56E 1ZPUA 3IGLA 2F1EA 4HPOL 4TVUA 1MCWW 4BZ2H 4DKFH 5C08D 3BMWA 2FHFA 3C60B 4WLCA 2CQVA 3OJMB 5DMIL 1MI5A 2G4GA 1VTOA 2HRPL 2AQNA 3IETA 4WU7B 3H9SA 4BJUA 2JV6A 3O6ML 2MQ3A 2XRAL 1NMAL 3FMGH 3US1A 3B43A 3BWZA 3MOBH 3V0WH 4Q8BA 1UA6L 3HBQA 3HLAA 4FDWA 4MGXA 3L3KA 3VFVA 4JKPH 2HFEB 4OM1L 4AQEA 3SKNB 3RY5A 2OYLA 2B3RA 5GZOC 4G80B 3M6DA 4ZMOA 1FZOB 3FAXA 2WBKA 5E5RB 1FSKC 1KBGH 2YAEA 5CEZE 1AFVL 2JQZA 5G55A 3WLBA 1IX2A 1EFXB 4ZNEE 1N0XL 2A6KA 2OXHA 5AVQB 4DHLA 1QO3B 2XV6B 4OJDH 2HL9A 2WQSA 4U4BA 4PG9B 5F9CA 1BQHA 2OMWA 3MLSH 2DYSB 2YXVA 5T1LB 1XF4B 7TAAA 2FIRT 2KZBA 3LH8A 1TZIA 4QXGH 1JV2B 3PDKA 5H4YA 1U4FA 3ZTCC 4CVUA 2KC0A 4RNRA 3E9TA 1IRAY 4FFZL 3L3OC 1LO4L 2C1OA 3VXRB 4BDVB 1BYNA 4YDKL 3E7JA 4DP2X 5MI0C 3WO4B 1T22A 4Z7OE 3ESNA 1JZDC 4HS3B 3EDKA 3I6GB 1FFPA 3GXTA 5DVNA 4XNXL 3GMNA 3RIAK 1I1FB 1LWHA 2DLFL 3MA9H 4YSDA 4HAKA 2FJGB 1FVEA 1OSEA 1SVZA 2EH8L 3BH8A 3ERXA 4IHOA 4A66A 1ZSHA 3CQPA 2CJSA 3I75B 5J1AA 1PG7W 3RWEA 1UZ6E 5I75C 5JW4N 2Y7MA 3SCMD 1A22B 4CVXA 3WV0A 4BQ8A 4LDOB 2JTDA 4BFBD 1R0AL 2RGSA 1QFWH 2CIIA 1M6OA 3NSYA 4O5LL 3BZDA 3GBML 4WW2F 2XZAH 4N2AA 5J3HD 3KJ6L 2BIIA 5FHBH 4XP1H 1CC3A 4NQCD 3QIWA 4XPGH 2WUCH 4QHNA 1PLAA 5A16B 2VZ3A 4TUOB 3O3AA 3VFWB 1QBLL 5JYMA 1AY1L 4AGLA 4K71C 3S36H 2YBGA 3PJSA 3B2UD 3GS4A 2UWEE 4KKAC 2ENQA 4NKIH 4FQPA 1L6ZA 5I1IH 1F41A 2FX8H 5H94B 4ZX3A 3V55A 4JKNA 3GSQB 4JR9H 3HG1D 3MPCA 3DRQB 3EO0B 1DBKH 1NM4A 1S8DA 2ICWA 3HI5L 5DJDB 4E9LA 3LMJL 3CU7A 3H42L 1Z3GL 1WH0A 3FO2A 3KVQA 2AJZA 1P9MA 5I30L 3QJHA 3V0AC 3FUNA 3QORB 2ADGA 2UZIL 4L29A 4BFGA 1G7HA 1DQIA 3SGDI 2FJSA 2J12B 5BOPA 1CXLA 4EUPA 3AUVA 1RZJL 4APQD 5I17A 3WIIL 1ONQB 4P05A 2ZWNA 2BIOA 4J3SA 1NFDF 2L7QA 4GRWE 1OGAB 4WU5A 2VXVH 1IB5A 5E8EA 2DY2A 2QPFA 3OQ3B 2WLLA 3D2UA 5PAZA 3QO0A 2HTKC 4K7PL 2YPLA 5I5MA 1JZGA 1P1ZB 4CGUB 4TVSa 3GHEH 3AAZB 2IPUG 2OJZH 3PRZA 4JFED 5F7WC 5AOIA 2NNAA 1F4XL 1YEHH 2H0PA 2ITFA 4PJ8D 1UT9A 4Q2ZB 4PW4A 1P7KA 4M7LT 2X2IA 4UMGA 1ZE3C 1RZJC 2EIBA 3NIDE 4LESA 2NPLX 1AC0A 3DPBB 4JY5L 4BINA 5JIMA 3ESMA 3ME0B 1ZHNA 3AMLA 2Y7QB 4KJYB 4GAGH 4OR1A 2FQEA 2JELL 3QJSB 4JJHA 5K9KA 3QAZC 3FCBA 5C09D 3WSQH 4O58H 1A6TA 3DKHA 3HNTL 5DGQA 4N24A 3QDGD 2CBMA 3INUL 4N8PA 3QIWC 5MEQA 2XICA 3P11L 3T9WA 2XJKA 1FCCA 2IOMA 5FS5A 4PJAA 1TU2A 4JVWA 5HYSG 2G75A 5TD4A 4OZ4B 2Q8BH 5CJXA 1MCPL 1SBSH 2WLZA 2Q1EA 2VLRD 2EJ1A 1W6LA 1T7WA 5GGRA 4JGUA 5SWSA 5IB2A 3UROR 2E76C 2HXAA 4OZHF 5E4EC 2GY5A 4TVPL 3TBYB 2L04A 2Q3ZA 3H1ZA 4HUKB 4NC0B 4MD5B 3MACH 3MR9A 3O4LD 5LBSH 5ISZB 2ZKHL 1FPTL 1TGHA 4CUCA 1GZHA 5KUMA 1LTXA 1INQB 1A7BA 3DO7A 3U1PA 4L48A 4L2YA 8CGTA 4DQOL 1MREH 1P9MC 3FB5A 1LE5A 5AW0B 4DW2L 4X7SH 1IL1B 1DDTA 1JHTB 2OL3H 2ZX6A 3KPQA 3KYKL 4XH2B 3ZRFC 3C5SA 3JVGA 1UB6A 5FM8A 3VW3L 4U2ZA 1K2YX 2DRUA 3BD4A 3W0WA 5EIIA 3VG0L 3KR3H 3N1QC 5AN4A 4R90L 3WFZA 4A6YB 3L8QA 3UTZA 1E5AA 4S1RH 5CSZB 5I19H 4ANXA 1MWAH 1HEHC 5GRUH 2GI7A 4JCMA 2DYPB 3T4AA 4MAYD 4NQXA 4XWGH 3O9WC 4ODSH 5F9WC 1CXHA 4YR6A 3UAFA 3W82A 4C56A 4Q9RL 5FA4B 3KPRD 3UZVA 2WLYA 3SZKC 2VZSA 4LHUB 4PV8A 5FIEA 5FM5O 4IHBA 4XBGB 2BHZA 4R4BB 2MRYA 4H7VA 2G60H 5I1HH 2N59A 4QRRE 3KPSE 4UOJA 5DI8B 3DJTA 2OMTA 3PDDA 5EBMB 4JFQA 4HCGA 4K7PY 4Y5XB 1VPOL 4PJDB 2KKQA 2H6UA 4N20A 1CMOA 5E9DB 1T1XB 4G71B 4TUJA 3EBGA 4ODBD 1QVOB 5EU6A 4ZNEA 3LZLA 1EJ8A 5D5MB 1RAMA 4PJ7B 1F6AA 4GS7B 5C0BE 2OYMA 1A5FH 4PVMA 4XMLH 3V4VB 1EZSA 4OKVA 1AZZC 3JWNE 4WHDA 3UAEA 5EO0A 5F97E 2DQIL 4HKJA 3FCSB 1RJLA 4H8WL 4HUXB 3OAUH 5CJXC 5BZWA 4K8RD 3NEXA 5HI5D 3ZVVA 1VB9A 4OLVH 3DC0A 3BZFB 4NQDE 1TUPA 4PRPE 2R0KL 1TNNA 2X6BA 4S11A 3QEHB 4MQ7B 2NTSP 1K5NA 4XC1H 2QZ5A 3BKYL 2AKRB 3FF8A 1WCQA 2VDRB 3LRSA 3I6SA 4FP8L 4NO5B 3ZZSA 3GMPB 5KSAD 4H8WC 4Y4HA 3IGAB 3R1GL 4OCMC 3ZTEA 4LSVH 4FNTA 4HUWB 1E43A 2BS71 2CH8A 1I7UB 3OXRB 3LD8C 3MRBB 4QNPF 5EMYA 5BXFB 1QPKA 1BLNA 4UBDD 1ZHKB 3JVGC 2IANE 4RGND 1FSKB 4HJGA 2D31A 4HCIA 2X38A 4XTRC 2Y06H 1KEGL 1DFBH 4J39A 4XCYB 5AVRB 4GAYB 5DJXB 3VVWA 5FX3A 5AW8B 4YDJB 4LCUA 3UTSB 3T4AC 1FNLA 3F7LA 3EDFA 3FUMA 4FMKA 5E00B 2PYFB 3REWB 5CEZL 1RFDL 1TENA 2VGLM 3DJ9A 3IDYC 3MUZ1 1NCNA 2O26U 5DTFB 3EFDL 4JJ5A 5E5MB 2R7EB 3QEQE 2X7LA 3ATDA 3F10A 2R2CA 3L3OB 4F9LA 2UWEA 1AKJA 4MLSA 4KK9D 1KJMA 4IBWA 1Z66A 5MI0B 4B9YA 1DL7H 1N6UA 1SXZA 1K3IA 3IT8D 3MRHA 3O3EA 5D8JL 3MV11 3MFFB 4K55A 3QDME 3ZE1F 1KXHA 1CDBA 2OM5A 4OGQC 4PY8I 1M7XA 3ES6B 1R46A 3O8XD 2CJUH 2V7HA 3BZ4A 1KN4L 1S7WB 2OK0L 4TSBH 1LNUA 2A9DA 2OSLA 1LILA 3FTYA 3LPWA 4GB9A 3S98A 5BMFL 5I75B 2F7OA 3EOAA 2WYIA 4D0DB 4PLKC 1SYSB 2G2RA 5M94B 1ACYH 1HH6B 4JHUA 2IIJA 2VR7A 3BZEA 1DFXA 5GGRY 3UXFA 3DX9B 4O02H 1PNCA 4KI5E 3NN8B 3OSTA 3FRPA 3IPBA 2WXMA 3NCCB 2NY2C 1OPGL 1G7QB 4XBMA 3ARVA 1RIUL 4ALAH 3LS5H 4KV5F 5HSHA 5FV2A 2EE9A 1MI5B 5DUPL 2NOLA 2V2XA 4K71B 3PLYA 3IETB 3H9SB 1Z9SA 3EDJA 4DPCX 4OGXH 3WKMH 1IT9L 3HLAB 4Y4HC 1YTFA 3L3KB 5B39G 4PGBA 3VFVB 2A7BA 4MYWB 4AYID 4LL9A 1GS8A 3CXHK 2DIBA 1FFNA 5CJBA 2GC7C 5DYOA 1R17A 3WLBB 2A6KB 2OXHB 2D7NA 4L8SA 2JJTA 4MBOA 4XVJH 4XR8C 5E8OA 3WUWA 4QY8A 1BQHB 1WJ3A 2E86A 2OMWB 3BIBX 1S78D 2FJHA 3ZDZF 3B5GA 3SE8H 2C3VA 5B4MC 1YO4A 1MRCL 4PRHB 1TZIB 1NM9A 2JKRM 3PL6D 1F13A 1LO5A 1DQDL 2BDNL 3QHFL 4RNRB 3MLZL 4F9LC 1SJXA 2C1OB 3B7SA 5F3BA 3PV6B 1T22B 4XPAH 4DN3H 4FD0A 1CL7L 2IPTH 1LDPH 1FFPB 1IAIM 4MJHA 2NXZC 4MDRA 4RDQG 2X89D 1LD9A 4KRPC 2VNCA 1FVEB 1S9WA 1MZYA 3C6LA 3BH8B 5HDQL 4OCRH 3RWCA 4IHOB 3UEQA 3U4KA 5J1AB 1RUAH 4EZLA 1RUQH 2CU9A 1E9OA 1EHAA 1NIAA 5E1HB 4CVXB 3KGRA 2GQHA 4RZKA 4TRPH 2AABL 3ROLA 3QZOA 2QR0A 5HHQA 2CIIB 3C2AH 2NT1A 5DZPA 1M6OB 4DP8X 1BPLB 3QAZB 1S7QA 2AERT 2E59A 5DXWA 4CC0A 3T6ZA 2GAZA 2F2HA 3OB0K 4K3EL 2YAHA 3S0PA 4F37F 1GGUA 4OFYD 4Q9CA 3QIWB 4QHNB 3JVFC 5IHUH 3TT1L 3WIHH 4M3JA 2WXLA 4UT9L 1T6BX 1SYVA 3O3AB 4AIXA 1QSEE 1QW9A 1WP6A 3ENEA 3CU1A 1X5LA 3PJSB 1YCSA 4YHNA 3L54A 2A4ZA 4Z7QF 2XKNA 3MOAH 1YN6A 5E4EB 4QRRA 1QSFD 5TDPA 3DNKA 5I1EL 1IC4L 4ZFOA 5E7FA 2N0KA 2X4NA 4P9HH 4TSAL 1M56B 2V5RA 3FT0A 2I32A 2Z93A 1QFPA 1IGML 5BO1H 1S8DB 1JMZA 2PCFB 3ZYOA 4WXAA 1KJ2H 3FO2B 4P2RE 5E6ID 1FL6A 3RVUD 4L8SC 2JJTC 5EEUA 4UANA 3B1UA 1PZDA 3US9A 3STBA 3D50A 1AS8A 4AL8L 5EOCH 5C0BA 4IKIA