3H1ZA

Molecular basis for the association of pipkigamma -p90 with the clathrin adaptor ap-2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords AP-2 complex subunit beta-1
publication title Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 51
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h1zA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3h1zA02
1QNBA 1KYUA 3OC3C 1QN4A 2D0AA 1QN8A 1NVPA 1QNEA 1E42A 1QN5A 1QTPA 5IYBP 4ROEB 1JFIC 2IV9A 1QN7A 3ASMA 1QN3A 3HS9A 1MP9A 1TGHA 3H1ZA 3EIKA 2D0BA 2MJ7A 1R4XA 1D3UA 3VN5A 1AISA 1YTBA 1QN9A 2Z8UA 3OCIA 1YTFA 3HS8A 1VOLB 1NH2A 2G30A 1KYDA 4ROCB 1PCZA 4RODB 1QN6A 2D0CA 1KYFA 1W80A 1QNCA 1QTSA 1RM1A 1C9BB 1KY7A 1TBPA 1PZDA 4PY5A 1NGMA 4B0AA 2VJ0A 1TBAB 1VOKA 2IV8A 1QNAA 4WZSD 1CDWA 5IYDP 1VTLE 1B9KA 1VTOA 5IYCP 1KY6A
chains in the Genus database with same CATH superfamily
3TURA 1QN8A 2VYRE 2BOCA 1UXLA 2H1XA 4P06A 2VLJE 3QUML 5E00A 4PREB 2FZ3B 1JTPA 4OAWB 4A2MA 4QNPF 4AM0B 1DR9A 1JAEA 4KAQL 1S3KL 2UYLA 5ISZB 4EAGA 2X44D 5E5MB 1DBJH 1RUKH 3U2SA 3BPOC 4FKKA 3ZUCA 4X4MA 4N2NA 3F7VB 5AOLA 1DANU 3MUJA 4Y2OA 2FGWL 3MXVH 3CU7A 4MHHG 3V0VB 5L88L 2ATKA 2I60H 4NO0B 2D31B 5EU3B 3U36A 3K71B 1EHXA 4F8PA 3ARFD 4J3VA 4J1UB 1FO0L 3QWRD 4FQIL 4XMVA 5I6MA 1W0WA 2P5WA 1OK0A 2L4OA 3VD9A 2ZP9A 2WBJD 3MYJA 3VGFA 3VSVA 4DUVA 5KS9E 4DKFL 4WK4B 2WWOA 2HFGH 2PWGA 4K3GA 4JKPL 3VDCA 2H1PL 5J6SA 3V4VA 4W68A 2EIZA 1N0XL 1M42A 1RZGB 4X50A 1DJYA 4G1MA 4PM1A 3FO0L 1XR9B 1I1CA 4G7VH 3RDTA 3STBA 5GIRB 1LP9F 1J5CA 2F5BH 4LPXA 1IX2A 3MRDB 5E1AB 2APSA 3B5GA 3CZFA 2WGNB 1V7NL 4IGBC 4F27A 1F3JA 2BWDA 4R5XA 2K78A 3QFJD 3FU3A 1HH9B 3TU6A 2E56A 3HG5A 3B5TA 4NC1C 4UI2A 3E1ZA 2FIRT 1S9YB 3GKWH 4M4PA 4PJGA 4MYWB 1TQVA 4JRYD 1J8KA 1AZVA 2NY1D 1MY5A 4MMZC 5E8EB 5HTSA 1ODUA 3S5YA 3DX0A 1K9TA 5HHQA 3RZCD 2EE9A 4M61B 4CMHB 2XN0A 2L7JA 1QNAA 3VXOA 3C87A 1A7OL 1IBGL 1UZ6E 2VDMB 3NDYE 3DPBA 4APQA 4NM4H 1XEDA 3Q5TA 4U1MB 1HH6A 3SIKA 4KPHH 5T3XD 3JUYA 1OAXH 3CDGB 4EZLA 5FYJH 1J0KA 1F4WL 1OANA 4WUUB 4JLRB 5B1CA 2PO6C 2BSSB 3P4NB 2AJXH 1ZA3B 4XCFL 1GIGL 5FHBL 25C8H 5TH2B 2XVBA 3SE9L 3N04A 3JTSA 4JM4L 2OMYB 4QXGH 3B2DC 4PV9B 1UACL 3EZ8A 3LEYL 3RY6C 5D1ZB 3TZVB 1E4XL 2XC8A 3BKYH 5HD8D 4F7CA 2JELH 3WLBA 3QR2A 3I6SA 4HWZA 4MD4A 4WI4A 8CGTA 2Y36L 2VDOL 3FSVA 3KLKA 4LCIH 5AL8A 3S7GA 3BRFA 4JPVL 4Y9BA 3EHBD 3VU1A 1YEWA 4OCXL 2JB5L 2VLJA 3MLXH 4C56A 2VDKH 4HIEA 3HPLA 3D0VB 3EG9B 3QZNA 2OK0L 5CM1A 3RSMA 3QEQE 4C57C 2CQVA 5KSAD 4FKHA 1S5IL 4G7YH 1BLNB 3RFZC 4WO4D 3FSAA 4PGCA 2FX7H 6FABH 1AXTL 2HH0L 4YSOA 1QTYT 4ATWA 3L5IA 1ZIBA 1JXGA 5F7KC 1OO2A 2IGFL 3VWJD 4HSAC 3U0PA 4URTB 1BF5A 3B9KB 1JWSB 1T89A 3VCLA 1PD6A 1Z9SA 1HKLH 3PGDA 2ALAA 1RMFL 1WTLA 4LOUD 4WU7A 2A74B 4R7LA 4X7CC 4P5TB 3UROR 1HI6A 1QWHA 1KC5H 1R24B 1REIA 4OT1L 4HP5A 1QNZH 4PJ5E 2GTZB 5HVHC 5E08H 4KZ0A 2O3OA 4BE5A 1JERA 2VMEA 5DR5L 2OJZH 5KYWA 3ASMA 4OIFA 2ZWSA 4P2OA 1GYVA 1VFBB 2VLRA 1GGBL 5FM5O 4OLVL 1MQ8A 4HKXB 2YC1A 3V52H 4W9DC 4PMFA 2G75A 1TBPA 3AUWB 2IMNA 1JK9A 2UZYB 4NO3A 5D1QB 3QDHA 4X8JB 1H3PH 3P11L 3VRJA 3WKML 5EBLB 1Z2KA 5F9WB 5JHLL 3TCXA 4FQ2L 2R2CA 3GEWB 3K6IA 1JHTA 1MW0A 5F1NA 4F37K 1Q0EA 1XGTB 4RQQA 1G9MH 1R5IA 2B0SL 3A22A 3D5OF 2Q0ZX 4BWTA 3LIZA 1UCTA 5KUMA 5CEZD 3FZUC 2UUDK 2YXFA 3N1MC 5DHVA 5D96B 1JGLL 1MN4A 5G4NA 1RUQH 1IC5L 4JFSA 1CK0H 5IG7A 1KJ2A 1YAZA 1IZJA 2OMTA 3CSPA 3ZZLA 1FORH 4CMHC 3G6AA 2FDBP 2Z8RA 3BFWA 2N3JA 2PCXA 4EN3A 4OZFB 4GSQA 2FSEA 4MNQE 3QAZB 4HH9B 3P3UA 2HA1A 4L3AA 3ZBMA 4N6RA 4NENB 3IYLW 5IMLB 2OSWA 5IMKB 4XPAL 2HKFL 2B7DT 2J6WA 1TVHA 3C5ZA 3V4PL 5FECB 4P59L 4XMXA 4F20A 5E6SB 3NABH 3VDAA 1ACCA 4AENA 3PJSB 3MN8A 4ONHA 3ESMA 5TDPA 1BBJB 4RX4A 5AW3B 2CKBB 4XPHH 2YA3A 3DNKA 4LSTH 4JZOB 3UYPB 1BPVA 2F7QA 1MY7A 4RZKA 3CXHK 5I1GH 5TF1L 1ZHLA 2NDFA 4WTZA 4IU2A 2JJWA 4XMZA 5E1HB 3REVA 1JP5A 2DM3A 4XN8A 5LQBL 5D1ZC 1IQWH 3OGOE 4LSRL 2LTQC 3BISA 1PKQB 3PDKA 2KPWA 1KBGH 2FBOJ 5EU7E 1IILE 4YUEL 5GQBA 1TQUA 4IDJL 3CX5J 4LCCB 1KB9J 2VIRA 2VKXA 1BREA 4FP8H 4PHXA 5F21B 2HG0A 1KIQA 5C09D 4A2EA 2VZ1A 2OPCA 4TQEH 4UM9A 3C8KA 3A23A 1FGNH 3QEQA 4BK4A 4PJDF 4DVBB 1MFUA 1P9MC 4TL4A 3VYOA 3QIUB 3N89A 3DXAE 3MO1A 1DVFD 1B3JA 4LDEB 4N26A 4NX0A 2BZDA 2BSRB 5EZPA 1RURL 4W9JC 4LPWA 1I3RA 1MHHA 2HVBA 2J5WA 3FU0A 3EYQD 1RUPL 4MD5B 5EUKA 2WYZA 5GRVK 1NFDE 3ARDD 3RWJA 4UT7H 4GBXD 5IESH 2EE2A 4YBHA 1BVZA 4QXVA 1JHKH 3VFRB 1N0LB 4P2YA 3KVPA 1FL6B 3B34A 3H9SA 2A6DB 4MZ2A 4BFGA 4IRJD 5AZUA 1CLZH 5I2IA 4EVNA 5DJAB 2MKLC 1QSEA 2H1LM 2A6IA 4NPKA 2VR7A 3PAZA 3TEXA 4JPKL 5EEWA 3KYMA 1BHGA 4YXHH 2WTOA 3EBIA 2NOFA 1KN2L 3QHFH 4YHKL 3DO4A 2OSLB 3HCVB 4LLUB 4O4YH 1MUJA 4WWNA 2CR0A 3UTPE 1XVSA 5KN5B 3FU6A 2RA1A 5AEAA 3RIAF 5FS5A 5J5EA 3K81A 1ZS8A 4H0HB 3E6FB 4FQQB 1QZ1A 4MCMA 3WUWG 2W91A 1YZZA 5A6IA 1AP2B 3DTUB 1AIFB 4L0ZA 3LZPA 3PGFH 4TQPA 4R2GB 1CT8A 4G9FD 1IM3D 3RTQD 2DD8L 4P99A 1V55B 3DX9A 3TS8A 2VLLB 5DHMC 3MCLL 2MHAA 2WKOA 4TYUA 4PJEE 4U6VH 1AC0A 4DUWA 3UZQA 3HHSA 4ODSH 2E9GA 4XN9A 3QIWD 1IC7L 4YZFE 2H6PB 1MCIA 3NZSA 3DBXA 1BYPA 2XIIA 4UV7L 2TRHA 4MNQA 1S7XB 4PWGA 1NDGB 3KM1A 2CHNA 4PGEA 5EPCA 4NZTL 3BHBB 1E9OA 1OAQH 1T66D 4Z76A 1BZDA 5FKPB 3CDCA 1MCFA 3QA3A 2E46A 4MJ5B 1RPKA 1Q94A 4OZHF 3Q48A 3MLRL 4UAOC 1SXZA 2CZNA 4DK5A 4ZNEE 2ENPA 1IC4L 3LAFA 1J5OL 4OJYA 1UB6B 5I24A 2E7MA 2YD0A 1FAIH 3IJYB 4PJAF 5BRZB 2O61A 5FFGA 1MRCH 3IDIB 4PYGA 3HS8A 2Q86A 3S36L 1WTGT 2WNWA 1JZ2A 4UOZA 4HGWB 1TFPA 4XOEA 3QQDA 1PD1A 1DIZA 4Q0XH 1KT2A 5D7IE 4M48H 3CLEL 4W4NA 3QQ4B 4ZO6A 3GIZL 3VW3H 1S7TB 2WVSA 1KDJA 1OPOA 2CRZA 3GNML 2PWHA 3IMTA 3MRNA 4Q9RL 2QHRL 5BMNA 4LCCC 4TUJA 1N59B 4WGVB 3ARBB 5T1LA 2CHWA 2RQEA 1KCUH 4O58L 1BQLL 4KY1H 4XNYL 1YEKL 2GSGA 5L9DL 3DXAA 3JV4A 3PL6D 4ZAKA 4CU7A 3BPNB 4M9PA 4G8IB 1RV6X 3AMLA 4L4VA 1JNNL 3L2LA 1E4HA 3JV6A 2APWA 1MHCA 5DHYA 1J87A 3WL9A 2Z0BA 3NAAL 3WS3A 1J05B 3HRZB 1NFDA 2CWRA 4PJIB 3U1SH 3WAJA 3MCKB 1SHXA 3OXSB 4XR8C 1GW6A 1E42A 4M8QA 1PG7X 3WIHH 4NO2B 2KZWA 5LNEA 4HH8A 1RZ8B 3X1GA 2CCLA 3F12A 3KLSA 1DQLH 3C60C 4KZEH 1BOGA 3L6FB 1C1EH 2V2XA 3HZVA 3GS7A 4K8RC 4NQUA 4XRCB 1V54B 35C8L 4B7LA 4C83A 3CXDH 3KLHD 3OGCB 1LEKA 2JIXA 3SYAA 3DVNA 4JY4B 3UH8A 3ABGA 1NGYA 3BEVA 5EWIL 3IGAB 5D7JA 3ULVL 3HKZA 5DD5L 1FZMA 4ZDHA 1B9KA 1JGUL 1AFVH 1MKFA 3LN5B 4L29B 4M43H 1F1AA 3GEFA 2PW1A 4LKXB 3FAWA 1WJWA 2D0GA 1QFWH 1FNEB 2Q20A 2JKNA 3MRFB 5T3XE 1J0HA 3L5XL 4GKZA 5JHDD 1NMAH 5IFHH 2YAEA 2JI3A 2J1XA 1QA9B 2BVEA 4UTBA 4PJ7B 3RWFB 1E8XA 1USQA 1U2YA 5IVNA 1W80A 4DN4H 3LKNA 2G0KA 4XOCA 4YHYB 1YLBB 3HE6D 4HJTA 3PV6B 1SZNA 2Z93B 3N91A 4PY8J 2JKXA 2WC7A 5F1OB 3ZE1E 1X5YA 2F61A 3MACL 3Q13A 3S5LG 5J9PB 5B7FA 4K3JH 4MAYB 1OP3H 2B3RA 2H45A 5CR1A 4NN6B 1RZ7H 1HEJC 1MG2C 2I5YL 2W80C 2YXVA 2XWBA 1IVLA 3O2DA 1J1PL 1JV2B 2HX7A 3F10A 2DWDB 2OMWB 4IRZH 4ALAL 3QORC 1FFNA 5C0ND 1FE8L 5JQHC 2HX8A 4FABL 2NWVA 3FCUB 4BK8A 4LHUD 3U4EB 3L3OC 4FXKA 4MCZB 2D3VA 4XO5A 3UCQA 3TT1H 3TBYB 1M5Q1 5B8CB 3GXTA 3C5SB 3CFTA 1E4WL 2BM3A 4M6AA 3UDWA 1D5BB 5J57B 2VXVL 3BH9A 4NUJB 3W38A 1MI5B 2NDGA 3IPEA 4YIQB 1KF9B 1H6TA 4QHMA 3MV01 1DVSA 3D85D 1UKQA 4GI9A 1A9EA 1I9JL 3TBTB 2EVIA 2NXYB 4NDMB 5KZCD 2WLYA 1BD2D 1C12B 3ARFA 4J4PD 1AZNA 2HRPL 3V0DA 3L1FA 3QWRA 4JGMA 5CSGA 4R26H 5D6DC 2K70A 2E7LC 2XBZA 3CPUA 1PZ2A 2WBJA 4G6FD 4JR9L 1ACXA 1T1WB 4H8WC 4NQDE 2W65A 3NA9H 3SDXA 2NRDA 1FVDA 1HILB 1U8HB 4G8EB 3QO1A 3ECVA 3LIUA 3QCUL 2GSIB 3K0YA 3ULUH 3A47A 3N55A 4IKKA 4ORGB 5CBAB 4DGWC 4MFHA 4PY7B 1EEQA 3F2LA 4P2QE 1N5AB 4MAUH 3BH8A 4N2IA 4EIUA 1L7TH 1NAMH 4NN7B 3QFJA 3BD4A 4UV4L 2DKMA 2YN5A 3D4YA 4Y5VC 3QNZA 5ECJE 2B15A 4ZUTB 1OSZA 3FQWB 5GGSY 1E65A 5CJQL 2A9CA 4S0TD 1FLRH 1OTUD 3B7UX 4WK2B 5HGBA 4MDIA 5IB1A 3BESR 4PVMA 3QULB 1KIPB 2C4XA 4JRYA 2GAZB 4TNVF 3HE7D 4KTEH 5DI8A 3SDDC 1LK3L 4NJ9L 3DX8B 3RZCA 1LO0L 5C0GA 1A2YB 4MA1B 1LGVA 3P54A 4FXGB 4K9EH 5IIEA 4IKIA 2E27L 2B4CH 3NJMA 4L0YA 4OLZH 5DQDH 3ZR6A 4WTWA 4AMXA 5A6MA 3QH3A 3WDIA 2A38A 2XA8H 1IAIH 1E8WA 1UADC 3GMOB 1M3JA 1U30A 5E56A 1IV8A 3RVWD 5I18L 1KV3A 2YJLA 3KL5A 4HEME 5T33L 5HGDB 1G7IA 3BAYA 4X7SH 5HI5D 3ZE2E 4E0RB 2F74B 5B1AB 1OAYH 4D0CA 1KELH 4PD4J 4HWBH 1E8YA 1PL3A 4ERSL 3OMZA 2CLZA 1HOEA 3LZLA 3U82B 1KYFA 2Y3AA 5T1KD 4BSVB 4ZFFA 5DYFA 2AEPL 4JFOB 1N2RB 3PDOB 3NFSL 1NBVL 4R0LA 4W9FC 5L8LB 1OALA 5CINL 3PQYE 1LP9E 2IFFL 3OX8A 1O75A 1J1XL 3BZ4A 3JSSA 2KMWA 5I76A 4O2FA 2EE0A 2V3FA 4F7MA 1S7UA 1BM3H 3FULA 2JWYA 1RK1B 5CGYD 5C09E 4HALA 1DSFH 3ARRA 2BZ7A 4KJPC 1T1YA 3HAEB 1F4HA 5KSAA 5LNGA 2PETA 5I1EH 3QQ9D 4DN3L 5HDBF 1UH3A 4WO4A 4H44C 4C4KO 4DULA 1P5VB 3NA5A 3NSCA 3OSMA 4NWUH 5FGRA 3CWUA 5FDWA 2NXZB 4UTAL 1ET5A 1SBSL 3M17A 4R8WL 3VWJA 4A7UA 4AGOA 4A7VA 4LARH 3HI1B 4TRPH 1JK8A 1JI2A 1UA6H 4K3DH 4OZ4B 5GXBB 1JD9A 2YOAA 2QTEA 3VRIA 3ZDWA 4CADA 3N41B 1MEXL 4G5ZL 3ZL2A 4YXLH 1S7QB 4XN4A 3Q6FB 5JW4M 43C9B 3ISRA 2V2WA 4N24A 5F96L 2RJMA 3AREC 1KB5B 5HDOA 4AI7A 5FB8A 4G7QB 4HCRL 5EO0A 5JMRA 4ZUSA 4RGMB 4PJFB 4U6YA 4J8QA 4P5RA 4CSZA 3NIFE 4BA0A 1AMXA 4WO0A 3QIBD 3GLEA 3T2NL 5DD6B 2VAAA 3CGTA 3QDJB 3GWJA 3OC8A 1LWHA 1QBAA 3NZUA 1QLFA 4YFDB 1F4AA 4AGNA 1MWAA 2MRYA 4OCRL 1XMWA 3F7LA 3VD3A 3TYFB 3LEVL 5DMJB 4EI0A 1K6QL 5FW8A 3O8XD 1PLGH 2OR8A 3VXNB 5DJ2A 5C6WH 1FL5A 2B2XL 1OGPA 4XNUL 5IB3B 1ANUA 1F2XK 1LDPH 1H3TA 5IF0B 1DDHA 1QPPA 2YN3A 3EF4A 4W81A 5B38G 1FJ1A 5C71A 1WEJH 4E68A 2NW2A 1FCCA 1NOAA 4MJ2A 4QRFA 2ZE0A 5IM7A 4RRPM 4WGKA 4HAFA 2XVLA 3S0PA 4XNAA 4CKVX 2CIIA 1MXGA 4H8QA 3TCLA 1NFIA 3PWNB 1T1XB 1Z1WA 4KXDA 4BZ1A 1A6WL 4WF7A 2CDGA 2IPKB 4NKDB 3D2UB 1E4JA 4XZUA 2P8LA 3N1QC 5I1HH 1QSZA 3IVKB 3O4LD 4FFZL 1CJYA 5E23A 5H37A 1MQKH 4OGAC 2GUYA 4LAQH 1ACYL 2R51A 1P4BH 4IIZA 1LMKA 1MJJA 4NQXA 4AGPA 3WV0A 2BWIA 4GAAA 5TE4L 1N7MH 4LVOC 1BQHG 1R17A 1CXKA 3MRRA 4OJDH 4IHOA 1CFTA 2AQNA 2WY3B 2C1OA 3I6LE 5D70H 4Y89A 2VL4A 4GP8B 2NUTA 5IFAL 4JKNA 1ZWIA 4QF1A 1I1FA 1LP9A 3L3IA 4EDWL 4M1DH 1ZEAL 3IE9A 3DDFA 1NWOA 4TPRL 4LSVH 1YQVL 4PFEA 2VABB 3A5VA 4G82A 2VH5H 2ARWA 5I8OH 1P5DX 5C09A 4Y16C 5KVDH 4CA4A 2VXTH 3AG4B 1QEWB 2Q5BA 3AWEA 4GPVA 3UJTH 3RVVC 1GAFL 5DLML 4L8BB 4M5YH 3C5XA 1DVFA 5I1IL 3JWOH 1A8JH 2K45A 3ENOC 3HG0A 2A9MH 5SWSB 3OKEB 3MDJA 5I0VA 2Y6TE 4JO5A 3Q8BA 2ICEA 4YXKH 3GZKA 2EDJA 3VACA 5F93C 2IAND 3ARDA 1J5DA 1IBYA 4GBXA 4WWKD 1FYTE 4AQAA 2OJEA 5FGCE 4ONGL 1WT5A 2BVUA 4M7JL 1M71B 3D08A 4PGBA 4WUKH 3S3JA 3ARSA 2NOIA 3QUZC 2JV6A 5ESVB 4IRJA 3RIFK 5K9OB 1KLFA 2DTSA 1PZ3A 5H35B 1G4RA 4QYOA 1S9KC 3CFDB 2DMCA 4NIYE 3GPSA 3NFPA 5F72S 1HHKB 5IBTH 4UBDC 1RFDL 4HFUH 2O5YH 4DOHB 1I7ZA 1KPUA 4GLRI 2DS4A 2X1OA 4QRUB 2XZCH 1WITA 3ZTEA 4XBPB 5FO9A 1E6JH 3F7PC 1GR7A 1BZ9B 2VM9A 4WY7L 2PYEE 1G9NL 1P5UA 2R7EA 1EAPA 2X2UA 4WFEE 1PS3A 1EA9C 3KJ4C 3QUYC 4P23C 3FQ4A 3MU3A 4XC1L 1U3NA 3NJNA 4PIRF 2KERA 3E38A 1SXSA 4NSKB 4YHOL 2E47A 3TIDB 2GEQA 4L1TA 1B0RB 4XO9A 5AB0A 1SYVA 5M95B 3FUIA 3ULVF 3D3VE 1D2PA 4P4RB 3RPIA 3RJDA 1A65A 2VDKB 1I7TB 3JWDL 1EZVX 3ESNA 1IM3A 1ZANL 2ENYA 4G9FA 4PJHE 4NOBA 3RTQA 1JMXA 3LQMA 4DH2A 5K39A 4K7PL 1WC7A 1PSKH 3KEDA 3OKKA 3RYMA 1QMUA 3KLQA 4N4YB 1T6WA 5EU7C 3ZSSA 1A6UH 2UXTA 2DMBA 1Y0LB 3QIWA 3MTXA 2ATAA 4LGSB 1N70A 4Z0BL 4I2XE 3ECBA 3MGTA 4HK0A 3CFMA 4JRFA 3IWUA 2EIDA 5IMMA 5F7FA 4KNUA 3SBWA 3V4VH 4UILH 1LK2B 1AHWB 4HDIA 2EYSA 1EPFA 5EZIL 4KK5C 2NY5H 4MMXA 2C3WA 4D7PA 5J4MA 3W0WB 1KFGA 4AGLA 1NCCL 3QUKB 4YPJA 1CGSL 2FT6A 1S7WA 7CGTA 5F0PB 5ALCH 1U3HC 3B8SA 1ORSB 3MXWH 3H9ZA 4XC3L 3TVMB 4QLRA 4RETB 5B4MC 2OTPA 2EVFA 3FQ2A 1Z9LA 2AJUH 4KI5F 4FYSA 5DEGA 2DWSA 3DJ9A 4F9LC 2VMCA 2X2HA 5E2WL 3LMJH 4FQCH 4JFZL 2X40A 1TF4A 4KZDL 5DD3H 1OY3B 1LO3L 4DCQB 5HYSG 1KCSL 3KGRA 1G6RL 2FHBA 4Z5RA 3NUKA 2DQGH 2A5UA 1KTLB 2WO4A 3AT0A 4X4YA 4LEOB 3ALXA 1JF6A 4OCWL 5DZ9A 4LOFA 1THAA 3R19A 4Z7OE 3EO0B 3DLQR 4HFWA 3BE1H 3GI8H 2Z0FA 2ZOLA 4NWTH 5LXGL 4P2AA 5KVFE 3GSXA 2ZWNA 3UBXI 2J2ZA 1TJHL 2VC2B 3PL6A 2WNGA 5L0QB 3TPUB 3I9PA 1NGPL 1VGKB 1WBZA 1JWMB 4PJCF 2CUAA 2F1AA 2AAVA 1R4XA 5IHUH 3BDXA 3BDBA 5TE7L 2VZOA 1OARH 2OI9B 1AGFB 5J12B 1DLHA 4TKWA 1T4KB 3RY5A 3ULAB 2QKIC 2X4TA 3RWGA 2HFFA 1VACB 2BNQE 4J2XA 2YK1H 1ZLSH 1AJ7H 3DETC 2N0MA 3V0FA 1P7KB 4JDEB 3FFDA 3U2JA 1AGCB 3SQBB 1ZSHA 4BM7A 3X14B 3VUAA 3M1OA 3T4YB 2R0KH 2H3KA 3MRIA 2Y69B 3NH7L 1AR2A 5JHMA 2QGCA 1YJDH 3IU4L 4B5EA 3HI5L 3PHOB 3RGVB 2KUTA 3CN4A 3D30A 1PW3A 3GBNH 3LJ3A 2AZUA 2ZCZA 3RPJA 2PYEA 2N01B 1RERA 3GIVA 5TFSL 1ZK9A 4NQTA 3VSQA 4BCYA 4X5XB 5HYJE 5C6TH 5T1JA 3EDEA 5KBLA 3MFFA 4G72B 2EYTA 3JWNG 2AK4E 1JRHL 1UB5B 4KOCA 2EO7A 2PP9A 5JHDA 4HJGB 5E03A 3BRGC 3UP6A 4MXVF 3PWVA 5CLYA 5MEQB 2BS8A 3KLDA 1O9ZA 2K8MA 4GIAA 2FLMA 3FU8A 3K2UL 5JIQA 4MQTB 1A6AA 3UG3A 4PJDA 4NXKA 1YTBA 3ILEA 3O6FC 4Y9FA 4L4TB 5C8JB 1P1ZA 5T1DH 2PCPB 1IEAA 2R69A 1D7FA 3H53A 4UAHA 4HS8L 5KJ7E 4H4NA 1J9TA 3VAEA 4U7MA 3QI9D 4I2XA 2NY3D 4FNLH 5INDA 3WSQL 3PHQB 1DLFL 5LGHL 1G7MB 1MELA 3AVEA 4TXVB 5A2LH 2J1KA 4HBCL 3Q9QA 4RGOH 3VH8B 1UXWA 1URZA 4HC1A 4MNGA 2DQHH 4LCYA 3FOLB 2C3VB 1Z0NA 2YPLB 4DP8X 2EH7H 4PJ9D 4X7FC 1AO7D 3B4NA 1E28B 3CBRA 3EUDA 2XN2A 4RFEA 2MPAL 4ZS7H 4FJZA 4WI7A 3ARGD 1CXIA 5T5FL 1X9QA 4LL4A 4TQHA 2L7UA 1IKNA 1VENA 2NNAB 3DSFL 3I9GH 1KCRL 4RMBA 2UX7A 3P0YL 4BFIB 4CW1B 3D85A 1GYAA 1JD7A 2NY6D 3M6DA 3LIZH 1A7NL 1TTAA 4S2SB 4B9JA 4ZMYA 1PZUB 4OF6A 5DHVH 1G4MA 1QSVA 2COQA 4IBWA 4J3OD 5HHOE 1MCKA 2XVKA 4J4PA 2LAAA 2E9WA 1HQ4B 1KJ2H 3TTYA 1U9KA 3ULVD 3ZKXB 4LCWB 3OB0K 4GUPB 1WCBA 3OL2A 3WTUA 4RWYH 4PRPD 4Z7QF 4BFEA 3ZGIA 2MJWA 3O45B 3WXWL 3EAYA 2B59A 2XWEA 5DD1H 3DURA 2JPIA 4CILA 4MWFA 3LZFH 1T4WA 1T7YA 3IJEA 4U2ZA 1DFBL 4U1HB 1IO4C 2OR9L 2LT9A 1IT9L 4JHBA 3A4DA 1WJ3A 4U2YA 3ZTNH 2YLHA 4FGMA 5KG9B 3K5SA 4JDZA 1T7VA 3WFEL 2MEJB 4UT6A 1QKZL 5I71B 5JW4R 2Z1PA 5J12C 5CLZA 1J48A 4X6CB 1CDCA 3SKOA 2OOXA 5E2JA 2HLFD 4I89A 4JM2B 3FH7A 3PU7A 2BY3A 2XLLA 5DT1L 3U0TB 4FG6C 1NBZA 5D7HA 5L2JB 1ASQA 2EO1A 3HE7A 3ML9A 2H4LX 4OZHA 1RP9A 2DWEA 3L45A 1JFQH 5CMAA 2PW2B 4KI5D 5B39B 3O0RH 5DVOA 4AGQA 4GUQA 2E75C 2AJYL 1EXUA 4YVNA 2BPBA 4XP5L 1G7JA 2FEEL 1QQDA 2UWEE 2OL3A 4NNYB 4PJAA 1CZ8L 5C0CB 3SQRA 3IGKA 1MCDA 4B53A 4W4OC 4OCSL 5GJSH 3DGCR 1CF8L 4M8VA 4ACPA 4HXAL 3EO9H 4S0SD 1OW0A 1NGZA 1NSNL 3F00A 1N19A 43CAB 4W93A 2DH3A 4CDGC 4MBRA 2Y7LA 1XR8A 2KZKA 4D9RE 3QPXH 4QHNB 1O5DT 2JLPA 4KROD 3BPCB 3MGAA 4C4UA 1ZHNA 3EDDA 3OMIB 3IRZA 3E2HC 1IBDA 5EO9A 3LNFA 4HJ1A 1FO0A 2W9EL 5T1KA 4NKOA 1A7QH 4H40A 3D09A 4XH2A 4WEMB 1GTFA 2V3DA 1NUGA 3UTZB 3VFUA 1KJMB 3KPNA 4XP9H 3RUGE 5C86A 4P2RE 4QJ4B 2GTWA 1T21B 4ZYKA 1FFPA 5F6IC 1GRWA 5HGGS 4QTIL 1IKFH 2DI9A 4PRDA 1WZ1H 2XY1A 3L2NA 2E7HA 1PCXA 2EACA 1LO5A 4KK6C 4XCEA 4I8OA 4MJID 5TJWK 3UP1A 3LQAH 2GT9A 4ABUA 1RIVL 2DWTA 3KR3H 1ZPUA 1HNFA 3FO9A 4IBTA 1PQZB 4ELKA 2GPZA 1TKWB 5LAPA 1AG6A 4QR7A 2JI1A 1YMMB 1C08B 2R4RL 3OJDB 2FWLB 1E4XI 3BIKA 2M8XA 3ARVA 2CMRH 4UM8B 1BFVH 4XCCL 1RULH 1U8QA 4X8XA 1FV1A 1U8KB 1U8LA 1S8DA 1PVHA 3F83A 4ZUVA 4EDXB 5DQJB 1JV5A 1MLBB 1MREL 2V7NA 3PHAA 3T4AA 2YFOA 2CLVB 1M1XB 2ZCKH 4PJ8C 5LAXB 5I6OA 3BMVA 4M1CC 2XN9B 3DOHA 3SY0A 2IADA 2QQLL 5JLZB 3PP4H 3ZTJG 1JUFA 4KQ3H 1ZGLA 2I07B 2EDYA 3BO8A 4ZX3A 3PFQA 4CC4A 3GSVB 4XB7A 1OKEA 1FZOB 2DL2A 1XEUA 5JQ6H 4XPTL 4GG6F 1K8DB 2ZT9C 3KXFD 5BZZA 4Q52A 1YN7B 1JF1A 4N0UE 3DYPA 1H0DA 4JUSA 4UNTA 1RPQA 4L8DB 5DURD 1YMHB 1RPUA 3VGAB 4L0PB 1ONQB 4S1RH 1SHSA 5JNYA 2NY2D 4HYTB 2XVGA 3QIBA 1N64H 1T2XA 1XB6A 3BC9A 4XO3A 3TEUA 2DQEL 4AUUA 3OMNB 12E8H 1NCWH 4FQHA 3U9UA 4YSAA 5E5LA 4CSSA 1ET7A 3TCTA 2D03L 2UY7A 1NGQH 3H2QA 2J25A 4P4KD 2BOBB 1AGDA 3NJKA 3MJ7B 1T0PB 4PV8B 1QRNB 3OJVC 2WK2A 3EYUH 3O8XA 4MASA 1OF2A 3HUJF 5EF1A 3VXSB 3KE0A 5D4JA 5F7UA 4X8CA 4PGDB 1FNLA 3I50L 1LE5A 5I6PA 2ZKMX 1FQ9C 2QV2A 2O1AA 2BZCA 4APXA 1D5XA 3QB7C 1ILSA 2QDVA 1HS6A 4FZEH 4KK9D 2BCKA 5JOPE 4B50A 3UPRB 5GSRB 1G9HA 5EEUA 2NR6D 4HUXA 2A6JB 1CYXA 4NBYB 4YSUA 2X4PA 4I18C 1N26A 3QDME 3G6DL 1CLVA 3S98A 1SVBA 2ZZUT 3NJFA 1WS8A 3QVAA 4OKVB 4U1KB 1IGYB 1L0YA 2UVFA 4HV8A 2HZSA 1OV8A 2ATPB 3L08A 3IFLH 5AQ0A 3T3PB 2GFBB 1V27A 3O4LA 1WWCA 5C0DB 4TTDD 2V9TA 3VQMA 5IZ7A 1I8KB 3FFCD 4PI0A 4YE4H 3ZDXB 4CJ1A 1RK0B 1EFXD 4CVXA 4NZ8A 4PVBA 3ZO0A 4PRID 3GXFA 1HEHC 5IB2B 3I02B 1ZT4B 5DRXA 4AG4L 2XQYG 4A55A 4F1ZA 3O3EA 4XP4H 1M3HA 5IGXL 2XRAH 1CU4L 1JYWA 4WW2F 4Y2DC 2XACC 5EUOE 2RFXA 2WGXA 4P2RA 1MF2L 1ILUA 1RVFL 4LBAA 5A16B 1D5RA 4XPFL 1UCBH 2CJSA 5TDOA 2YQ2A 2AERT 1QSFB 4FLOA 1S5HA 3S3BB 1FC1A 1E7UA 3FTSA 1INQB 4TLKA 5HGHA 1XF4A 3WN5A 2O5XH 5ADPL 4LRIC 5IROD 3MRHA 5FLVA 5CZKA 1D5ZB 4U05A 4U3HA 3HG1E 1GZQB 4I0PB 2QHLA 5DJCB 5JHLA 3U46B 2F7LA 4AH2B 4MYPA 4MA3A 4N9OB 3RIAK 4OLYL 3CHRA 3GQFA 4X6DF 4UTBH 5IOPA 3TA3B 4G83A 4RMTA 2BO0A 1XWVA 5EOQH 4R4NC 3BAWA 2CR6A 3ZE0B 4M1GL 4WWKA 5E8DL 1F00I 4QT5A 2Y1ZA 1T22A 4Z77B 2DL9A 1IGIL 5D8JH 3W11D 5DLLA 1JZ6A 4FYQA 4BSWA 4NNPL 3L1OL 5EBWA 5HDQH 5SWQA 4NQSA 4A7TA 2W8CA 1HHHB 5FCUL 3IJHB 2C9XA 2KZ1B 4M7KL 2QVIA 4NUPA 4ZS6D 5I16A 1JPSL 3LZNA 3O2DH 5AKRA 1LLAA 4CVZB 2F5AH 3KG5A 3VFTB 1OTTC 1EEZB 1SDDB 3A67H 4ANXA 4NERA 3UZEA 1IFHH 2H9GB 3V4PA 4N2HA 5FXCH 2NY0C 3LH8A 2FWOB 1U3YA 3P77B 1J8HB 1CUOA 2OSXA 2VQ1B 1SYSB 2ADGB 3C08H 4DVRH 4JN1L 1SM3L 4BFJA 2EXWD 1A0QL 2YR3A 4NQCE 1JZEA 2ENSA 2YD3A 1KJ3H 2RQ8A 4KNQA 1KZYA 1XF5B 1AXSB 4F33A 3MBEB 2X4OB 3CIAA 3QJFA 4U31A 3H3PL 1ZVSB 4N86A 2HRGA 2YKLH 5AAMA 2HJKA 4OIIH 1HE8A 3WFBH 2E4TA 4YHLH 1UZ8A 1V8HA 1NIFA 3Q1SH 3FQ1A 2GUOB 4GKSA 2BP8B 1KGCE 1KLUA 3GK8H 1FNAA 4IU3B 3MNZB 3TNNA 3V0WH 3ZZQA 4K4KA 1GTNA 4ZFQA 4ISVB 3JZYA 3VXUE 4D3CH 5HI3D 3S96A 4NCC2 5AW5B 4DP4X 4R2GD 1MIEH 3L3KB 3RFRA 1TZIA 4K2UL 1I1AD 3SGDH 1HNGA 2W9DH 2AQ2A 4KKLD 2SEBB 4M5SA 5J6GB 3ESPA 4ODBD 4GRMB 4DO6A 3ZXAC 2QQNH 2P49B 3P4MA 5E94A 3H9HB 5FK9A 4RFNB 3CU1A 1MCNA 2FK9A 2EDKA 3CCHB 4WFGE 4WFHD 3EYVA 4JFYA 3M46A 1AKJD 7PCYA 3DX6B 1ZXKA 4P9ML 4PR5B 1TTRA 5DK0B 3GJEA 1WSST 4BINA 4P5SA 5HSHA 2WTRB 4Q6IA 4NYLB 1MFVA 2FQEA 1LE9A 1QBMH 3MV8D 2BIPA 4PCTA 1DTUA 3DYOA 4YEFA 4BQCA 4DGVH 3ZHLA 2A6KA 5TE6L 1I7UA 5AOJA 3WO4B 3BVTA 4H8HA 3GHEH 1MHEA 2PPFA 1INEH 1B6DA 1AR1D 1HL5A 4JG5A 3UTSB 3DSNA 2RCSH 3L3DB 2O4EA 4BKLB 1KG0B 3AROA 4M62L 3LRHA 4HF5L 2R59A 1R75A 5EF2A 2ZUYA 4O02L 3CC5B 3SCMD 3OCIA 2YQ3A 2OMZB 4OQTL 5T3XH 1XF1A 2CM5A 3GXDA 4I85A 5D7LE 3VSTA 3HW7A 3N0AA 3OPZL 1CFSB 4Y9EA 4O9HL 4UF7C 4BRVA 1OWRM 1MCCA 3QJOA 5B1JA 4TVSa 1R6VA 5MERA 4FTVD 1MLCA 2BP0B 2WWKO 2QSTA 1MH5A 3KVDD 3C2AL 2E7CA 4TULL 1DCLA 4DETA 3TA3C 1BZ7B 1OQXA 5ALBL 4RMRA 5IEKB 5KSVA 4YBQD 4XAWH 4XOBA 1KEMH 2DYRB 5JMOC 3EBHA 1VOLB 3IMSA 5HVGB 2YEZB 2QT6A 2ITEA 3EDFA 3JXAA 2HB0A 3ZKNC 2R5XA 4WI3A 2C9QA 3KYOA 5BJTA 5D5MB 5I1LB 3GMMA 4WEBH 5FYKE 4X6FB 3CZGA 1OM9A 4C47A 4TSBH 4XVTH 5IWLA 1ZLDA 1UD2A 3VXMB 4Y4HB 1VKXB 3EOAA 3Q06A 1AQHA 5K59F 5J6HB 2C3XA 3RU8L 3BVVA 5EZJA 4E9LA 2E8ZA 1QABA 5TGBA 2C9VA 3KS0J 4NQCA 1BGXL 5HJ3A 5CGTA 3MV11 1P7QD 1FL3B 3DJSA 2IFGA 1KXVA 4CUCA 2JJVA 4F93B 1BQUA 3QW9A 3SODB 4Z8FL 1PIGA 5IJVB 4GFTB 3FH8A 4WLCA 4PRHD 1FGVL 3AQYA 1TENA 5IVOA 4HCGA 3BKJL 3T2PA 3VDBA 4R7DA 3SO3C 5JPNA 1X6LA 3D8MA 3ZRCC 4I5BB 3LH2H 3NOIA 1X7QB 4KTDH 2DQIL 5BV7C 5DDHB 2ZAGA 1EHAA 4ZSOB 3QI9A 1XH3B 2I32A 2DIBA 4PJCE 1MFDL 3CWGA 4H0IA 3TNMA 4GUCA 4WJG3 3OTTA 4DP1X 4AL8L 3GTNA 4TPSA 5GGTL 3CD4A 1T04A 4EJZA 3VQ1C 3FN0H 3FU7B 4UIMA 4KVNL 5F7EL 2UY6B 1MHPL 2IALA 4PJ9A 4HUCA 1AO7A 2EIKB 2DLFH 5D2LF 5MEPB 4RFNC 1ZVHA 2DBLH 1IZKA 3ARGA 1QHQA 4FJYA 1CD9B 3O6LL 1IGFH 1C8QA 5FWQA 2BW5A 1I8AA 4GI8A 4N3TA 1MWAH 1EEYB 5BW7C 2W92A 4KMQA 1KGYE 1T5WB 3THMH 3MA9L 2NLJB 2HAZA 2F53D 5IJCC 2VUOA 2BOCB 5LG1A 5CD5C 3DKHA 2QPDB 5E00B 5CEZH 3HNVL 4JPSA 4FEMA 4OIBA 5I1KL 3EGDA 1YNKH 2UYLB 4LSPL 3PG2A 5IYCP 5EF0A 3G5VB 3L9YA 4TNVK 1B2WH 2WOBA 5DFTA 5ANMA 1TIUA 3U2SB 1BQ5A 4O5LH 5LG6A 4Y4KD 5HHXH 3JVFC 1HZHH 4Y2OB 1GHFH 2FYYA 3SE8H 2ATKB 4PRPA 1HU0A 3H6JA 3ILPA 4ODUA 3LXBA 5D7LA 3U36B 2FL5A 1WAAF 3BKQX 2ORBH 3QPQC 2NOEA 1AISA 4BZ1H 2H0EA 3D4VA 5AL0A 3M1BA 4KKBD 3T2OA 3OXRA 4YK4C 1YEFH 3PS6A 5J3HD 4P3WA 4PIBA 1W0WB 1YSOA 2P5WB 5H37H 1FA4A 4DP6X 3MYJB 4EN2A 4AQ8A 2BJMH 3C6EA 5I28A 5A40E 5J11B 3IU3A 3FL7A 3V4VB 2MOGA 2EIZB 5F88B 1NH6A 1LM8V 4GRWF 3A4AA 3WJLC 3K6SA 4JQVA 3TN0C 5B3SB 1NFKA 1P4IL 1BP3B 5CNHA 4N0CD 3KWTA 3RDTB 4P46C 3B1UA 4Z7IA 1CMOA 5AAWC 2QBWA 4H1LB 4OVVA 3U7YL 4RVBA 3CZFB 5IREA 1P7HL 1BVNT 1F3JB 4OSUH 4YLQT 3OKDA 3ZR5A 2QSCL 4Q4EA 2R83A 4LQFH 3O3DB 2QR1A 1WAPA 4H26A 2O93L 2LABA 4IBLT 5EO1A 3VG0H 4PJGB 5F3BA 1Q9KA 1YC7A 4XE0A 4E42A 4C7PA 3FUHA 2ZPKH 5HHQB 5A6LA 2DQTH 2Z34A 3KLLA 2Q8AL 4L2YA 1QLRA 3F7KA 4G6KL 4XMKL 3VXOB 2R4SL 1F58H 4HOWA 1K3ZA 4JO3L 5C0BE 3DPBB 4APQB 1EGJL 1BJ1J 3RKPA 4N9GB 3ML8A 1HH6B 4PLOB 3X13A 4GH7B 4IMKA 4Z7VF 3FONB 2VZVA 3ALWA 1CDWA 1OGAE 2DJMA 3BPLC 3WJJC 4BV1A 2GHWB 1HINH 2ZG2A 4HPOL 1XIWC 2XG5B 3PJNA 4PJCA 3BQVA 4QPEA 4XBGA 3E1F1 3S5ZA 1YNTF 1NJ9A 3MV7E 4KRPC 1YHPA 3GXMA 4M5ZL 4P9HC 3JTSB 5FUOH 3BZ5A 2L7EA 2KLTA 3CMOH 3K80A 3K8LA 3L5HA 3MYZA 3TXAA 2LU4A 5ID1A 4ONOA 3MX0A 2MTAA 2D0CA 2J5LC 3CBJB 4MCYA 3WDHA 3BGAA 3FTUA 1SF5A 4F7CB 4MJIA 3NCBB 3WLBB 4HWZB 4MD4B 3U4BL 5E24E 4NRYA 5JW3H 2CGRL 1KFAL 3ZTDC 4YFEA 1NCBH 4LMQI 5CCHE 3QRGL 2YD5A 1G0DA 5F97E 4KFZC 4D0BB 3RWDA 2X5PA 1J1OH 1DQVA 2VLJB 4C56B 4HIEB 3MNWA 4HHAA 3E8UL 4V11A 2BY2A 1ZAGA 2J1ZA 3NSDA 4M8RA 5E9DE 5B3NA 5BVPL 3VD4A 5AYUH 3BAEL 3CAFA 2IBGA 32C2A 1DJHA 3QNXA 4PGCB 1QFUH 5EU5A 2OA9A 3V5KA 4K94C 1BMZA 1Y1UA 3PPEA 1GGTA 5C07E 3U0PB 3KXFA 2Y4SA 1TYRA 4M02A 3VCLB 1KULA 4LIQL 1KACB 1Z9SB 3WYRA 3PGDB 3SDYH 4WU7B 3UTTD 4FHJA 1K5NA 2ZG3A 4HIJA 1HI6B 4PW9A 3QHTC 1OD7A 3LZOA 1I9RL 1WA2X 3ECUA 4QAMB 1J8RA 3LH9A 3IFNL 4CSPA 3LNIA 5KYWB 4G70B 4BA8A 4UT9A 2WZ0A 4P4KA 3AY2A 4P2OB 4PJBE 3SPVA 3VGBA 4ZTOL 4KO5A 2VLRB 1P84J 3KGTA 1U4EA 1WS7A 3MRBA 3JTBA 5E7FA 3KPRE 2YC1B 4L5FH 2G75B 1DJZA 1JK9B 1A1OA 4K3HA 4NO3B 5HHPB 1X5AA 2VWEC 2LHAA 3KPSE 2P46B 4YDLC 3VRJB 1VKLA 1IARB 1XSKA 4KU1A 4ONFL 3VNZA 1JHTB 3HMXL 5F1NB 3TJEL 3WY4A 3UBGA 3TIEA 4RQQB 1R5IB 4PLKC 4ANUA 5HYQA 4JFEE 2ROXA 2NR6A 2B1HH 4WNJA 3VD0A 1SLWA 3ZRFC 3NDZE 5DHVB 4MDJB 4GXFA 2EADA 4L3CA 4WGWB 2ZCHL 4FNPA 4YHMH 1WCQA 3N44F 3QRBA 5SWZD 4UMGA 3C6LD 4WVRA 5FUZL 4DGYH 5ICZA 5IG7B 1KJ2B 4WWID 1CLYL 2RD0A 2OMTB 5JXEC 3LPGA 2X42A 3G6AB 5CGBA 1XL4A 1SLUA 2NNXA 3NZHL 1YYML 4I3RL 4MZ3A 4EN3B 3C5JB 2FSEB 1EFXA 4JL1A 5EPMA 2NZ9C 4Y5XC 4PWEA 4PRIA 3VM5A 4N6RB 4WW1A 3F65A 5D72L 3RVUC 5L2KE 2IDSA 4GG6E 4BUGA 1EO8H 4OZFG 3C5ZB 5DRZA 3MRJA 4UB0L 4XVSL 4OI9A 4UDTA 1KXTA 4AQEB 4W9GC 1HEZA 3OMAB 2R0WL 2XICA 3BT2H 4MQ7A 4AENB 4ONHB 3RWEA 1NOLA 1L7IH 3BWUF 4GINA 4MCNA 5TDPB 1S2EA 1CR9L 3EDKA 4JO4L 5C0RH 1FF5A 1GSKA 1I4FA 3BWAA 4HCRA 3LRKA 4ZMZA 1BSIA 1ZHLB 5GS0D 1A4CA 1IGMH 3JVGA 4IU2B 4KJQD 1T1ZB 3REVB 3NP4A 4U1LA 3QYMA 1P4UA 3WE6A 5IROA 3OH6A 1UG9A 1YQKA 1YEJH 2WPGA 3HUJE 3FB8A 3T0EB 5H4ZA 4OF8A 1TNNA 5DJXA 2DWYA 2VIRB 4YWGL 2PPDA 3L4ZA 4TQ8A 2EKSA 1KIQB 4BXVA 2DQJL 4WI0A 1VCAA 4KVPA 3MHZA 4ODVL 1FAKT 4NC0B 4UM9B 2H0JA 1U3ZA 1WWWX 3C8KB 3QEUB 3QEQB 5C97A 3S88H 2JK5A 1ID5I 3VTMA 4LU5H 2HT3C 4HCFA 4Y7OC 3MO1B 5GGRA 2R69H 5CJ5A 5JW5A 3FTXA 1MHHB 3VI4F 4JGNA 1RY7B 2H41A 5EUKB 3Q01A 5D1XE 1GGCH 1VLXA 3RWJB 1KGJA 3LPPA 1BF2A 4HC1H 4RZCB 1M9WA 3D4ZA 3TWYA 3QJRB 4L3EB 1PTZA 1SN5A 2LE9A 2DPKA 3I75B 4EE2A 3H9SB 3DI3B 5I2IB 2I7SA 2CUIA 2LOEA 3UABA 2QV4A 4EVNB 1QSEB 2A6IB 5BS0D 2GJ6D 4DZBA 3CK0L 4XNXL 3AQZA 4F7EA 1CDUA 3GXPA 3JT2A 4YHZH 3NT0A 1TQSA 3KYMB 3T0XA 4NJAH 2CXGA 1JTTA 2PTTA 4KHTL 4XMLH 3TOPA 2CIKA 4HS6A 1YEDA 4U6HA 4Z7NF 3KPRA 1R9FA 3JV5A 4LQ1A 5ITBL 2EDHA 5CN2A 1MUJB 2HKAA 2F54D 3CTTA 3VFOA 5IW6A 1DBAL 1EO5A 5EA0L 2FO1A 2WYTA 4X8GA 2ZSVA 3DVFA 4QHLA 4RISH 4W9KC 4YGVA 1ZS8B 2J8UF 3F3HA 5KW9L 2IQ9H 4L9LA 3R1GH 4LSSL 1HAWA 4KJWD 5KOMC 5DZJA 3EBGA 3QJZA 1V7MH 4H25A 4JFEA 3GO1L 4R4FH 4RH4A 2EUZA 1CT8B 1F13A 1Q1JL 3S4SA 1I1AA 2J1YA 3EH5B 4EBQH 1H6FA 1WHPA 4Q6KA 3DX9B 4FFVD 4AVKA 1BAWA 2ZKYA 2MHAB 1IQDA 4IBVA 3LHPL 1EERB 1NMBL 3UZQB 3HHSB 1U8MA 3MQIA 3WIFA 1AKJA 3DBXB 1HIML 4BK5A 2HKPA 3FUFA 4GT0A 4MNQB 4QRPB 5JDJA 2F18A 3MOQA 4UT6H 5FM8A 4D8PA 3LNDA 2P80D 1CICD 1NL0L 4GG6A 4PGEB 3MV8A 4RGNC 2KDGA 4FAAB 2VQUA 2G5BA 4LGRB 3MBXL 5T3ZE 1E9OB 1MCOL 4DKEH 4F5CE 4ZFGH 4Z76B 3DHPA 1L4IA 3QA3B 1Q94B 3UBFA 4IDLA 1BQSA 5B38A 4HJIA 2O61B 2DYPD 2KZBA 2OL3H 2IWGA 2Q86B 1C5BL 2DJ4A 3SCMA 5BPPA 2ADFL 4UQ3A 4ROEB 3HUJA 1KT2B 4QCIA 5F89A 2VMDA 1SUJA 2OZ4L 3OKOB 2NYYC 5EZLB 1UOWA 1S3KH 1UYWL 2BSDA 2DM2A 2EZ0C 3CV5A 1FNHA 4N2LA 3PF2A 3T0EC 3MRNB 1PJ9A 1A4JA 4TUJB 4FTVA 3SBRA 2FUTA 4YPGB 5T1LB 2AVFA 1K8IA 5MEOA 1X5XA 2FGWH 4YSPA 5L88H 1EHNA 4AZ8B 4JHVA 1NBCA 2GSGB 4GSUA 3JV4B 5E9NA 4GRLD 4ZAKB 2ITFA 2XSKA 4EUPA 4K8RL 5E6IC 2W59A 1FO0H 1E5UI 1GZHC 4L4VB 3JV6B 1CC3A 3OWRA 1HTYA 2OLDA 1MHCB 5DHYB 5GZOC 3WL9B 4DO4A 1K85A 2BIMA 3WS3B 4CBZA 4DKFH 4Z9KB 7TAAA 4A2HA 1KN4L 4JKPH 2CE6A 4N3UA 2H1PH 5HHME 2B39A 1N0XH 1VZIA 4OFYA 3BOVA 3KCPA 4WQOA 5DO2D 2BNRD 4JFFD 4M8QB 5AWNL 5BO1L 3FO0H 4OM0L 1HWGB 2D3JA 3FYIB 3F12B 5C9JA 4AUJA 1BOGB 4WW2A 1WIUA 2HFTA 2V2XB 3HZVB 5DSCA 4TSAL 1CTMA 4ODTL 2YJQA 4AVIA 3NIDF 1V7NH 4WI8A 4C83B 1LEKB 2JIXB 1P7QA 1F3DJ 3DVNB 2P24B 3ZDZF 2FB4L 3FBQA 4MNHB 1NGYB 3BEVB 5A7EA 5LDSA 5D7JB 3IBOA 2DAVA 4NHUB 4GXUN 5L4JA 4ZDHB 1FZMB 1RAMA 5IR1A 3MLVL 2B16A 2E5EA 4PRHA 4UQ9A 1R5WA 2PW1B 1G6RA 5FYLL 4MGXA 3ROOA 2MWCA 5DVLA 2QPFA 4Z0XA 4GKZB 3VGHA 1H3WM 2D7QA 5IBLD 4B9ZA 2WJ7A 1GC1C 4X6DA 4N0FA 1A7OH 1IBGH 4XVJL 1G7PA 1H8OA 1SMOA 1L3NA 1UJ3A 3HEIB 3LKNB 2HG5B 4KO9A 2EICA 2FEJA 5DUML 3UOAB 1J11A 4KI1A 1I8LC 4N6QA 4RNRA 4RAVB 2JFCA 3QUHA 1JPGA 2PR4L 4IOIB 2KHAA 5K9JL 4XCFH 1GIGH 5FHBH 2XWBB 3V0IA 2DMHA 4ENEC 1GKEA 3ZKQD 3V5DA 3B2UD 3FB6A 5DGQA 4WK0B 3SE9H 1FFNB 3TO4D 5DMYA 1LWWA 3JWNE 4JM4H 3VWKD 3MRGA 4FE9A 1UACH 3LEYH 4F5CA 2R23A 4B95C 2D3NA 2ERJC 1E4XH 3HRPA 2VLKD 5K59E 2IPTL 4FXKB 2YPVA 2YZ8A 3CDFA 4LASL 4B60A 3T3MF 1A1NA 5C3IA 2VDOH 1KCWA 3QXWA 3BH9B 3VQLA 4ZMLA 4JPVH 3H54A 4QHMB 4NZJA 1M57B 4MS6A 2EH8L 1KWKA 4Y4KA 4ALAC 2AMUA 2Z8VC 5IQ9A 2OR7A 3G5ZA 3NZ8A 1I9IL 1XO8A 4PW4A 4X7TA 5H2BA 4CJ0A 2C9PA 2VKWA 1W91A 2NTSP 5CP3A 3ARFB 1CPUA 1X5HA 4LP8A 5I19L 1EQWA 4K3EL 3F62A 1A14L 2KQNA 2GK2A 1QPKA 1WPCA 3S48A 4IRSC 4IMLA 2EDBA 2WBJB 5GSVA 4MZRA 4KKCC 1EXHA 2IGFH 5K1NA 4JAMB 2YSSA 4JNXA 2JJSC 2W65B 5F9OL 2O26U 3SDXB 1FVDB 4IOSD 3N9GH 1MJ7L 2ZX9A 3QO1B 4XTRC 2IG2L 3RKDD 1RMFH 2AABL 4L48A 5DEZA 1H3UA 4NHCL 4Y1AE 3SGEI 4K71C 1Z0MA 4NXSA 4PJXE 3VMPA 2GVYA 5HYSA 2KYIA 4OT1H 5I1DA 4X5RA 4CN4A 3L9RA 3D87B 3BH8B 3IK2A 2H6UA 3T0VA 2DOCA 3QFJB 3QNZB 1OSZB 1YY9C 4QG5A 5FO8A 3QNYA 1GGBH 3D4CA 4OLVH 1N39A 2WMPA 5HGBB 4YDZA 3SYPA 4TVPL 2YEVB 4MDIB 3TBVA 5IB1B 5EEYA 3L9EA 4RODB 4NUQA 1M7DA 5IJBC 1W0VA 4JRYB 4X0NA 2NY1B 5DI8B 5T5FA 1NANI 3P11H 3WKMH 3F7YA 1MCPL 5JHLH 3RZCB 4FQ2H 5EC2A 5C0GB 2X70A 4NI3A 2OMXA 5SWZE 4FULA 5IIEB 1ZSDA 1YEHL 3BQUC 2UZXA 4Z7UE 1UD8A 3II2A 3IPFA 3QH3B 4C55A 1F02I 2F7IA 5CEYA 4HIQA 3EAKA 1JGLH 1JPTL 4PTTA 1WAAE 3C2SA 1IC5H 3IJ7A 4DNLA 1OSEA 1G7IB 1KB9K 2X4NA 1RZFL 1PF3A 2VXUL 3NJLA 4I1RA 4D0CB 1OCWL 3BUPA 3L3JA 1CE6A 1F3RB 1U21A 2HZMA 2CLZB 5JPMA 3BSZL 5SX4I 3ZO9A 2J8OA 1TTBA 4HULB 2WQXA 1ZE3H 2JJTC 4IGBD 5E8PB 1CL7L 3GKZA 2VUKA 1TLKA 4ZFFB 4XPAH 5DS2A 4KVCL 2HKFH 3VI3E 1SLVA 4R0LB 3V4PH 1Q9LA 4P59H 4GW4A 3A6CL 1Z9MA 4XP6H 5KVGE 5GRXG 3OX8B 1QN6A 1L9NA 1TJXA 3PWPE 3ZMRA 1BVLA 3BZ4B 3FTVA 1SFHA 3MRMA 2UXVA 4F7MB 5TF1H 1S7UB 4E9YA 4XXWA 2IF7A 3EHBB 4JB9L 1MAKA 2OXHA 3DIFA 3ELAT 1AGBA 1TNMA 5KWYC 1FCGA 5LQBH 1QNBA 4G5AA 4LSRH 2GIXA 3CLFH 2BVPA 5I17A 5KSAB 3A4EA 4FL4B 1R5VA 3M45A 1J12A 4WO4B 1X5MA 4KO6A 3HAEG 3A6OA 1HCZA 5FDWB 2H7WA 1BMGA 2PO6D 3M17B 5C0AD 3VWJB 3OZ9L 4YC2C 3H0TA 3WJMA 4CL7A 1BIHA 1JK8B 1OE2A 2KLSA 3EH3B 3T6ZA 1DBKL 2XDHA 2XN9D 5I6KA 4LT7A 4YJZL 3VRIB 4PU2A 4CADB 4OV5A 4LZKA 5AVSB 3UTTA 1RURH 3FF8A 1WFIA 3HS0C 4JDVA 3RZWA 2BIOA 2BFGA 1RZKC 1Q9OA 4BJUA 1RUPH 1IFRA 1LEGA 1S7SA 4LF3A 5FB8B 3VNYA 3KWXA 2ZXWB 4H13C 4PLNC 3MLZH 2JMRA 3BVDB 5EO0B 2IAMD 2EIEA 4ZUSB 3D25A 5LBSA 2RGSA 1LTXA 3QYNA 3ZYOA 3DO7A 4BQ9A 4U6YB 4Y7MA 2G2PA 5D2LA 1M4KA 1KPRA 4PPTA 1CURA 4UINL 2VAAB 1INDH 2VDPH 2IV8A 4YDIL 1GGYA 1IGJA 4Y5YA 5KJRH 1QLFB 4JPKH 5CN1A 1W8EA 5I5IA 1QUNB 1MWAB 1L9OA 4LVNB 2IH9A 1KN2H 3WEXA 5H4YA 4YHKH 4AYBA 5AN4A 3FHQA 3VGEA 4DIXA 3IH7A 5AVWB 2CJUL 8PAZA 1PG7W 2P5EE 4JQXA 3ABMB 5DJ2B 4ADGA 1FL5B 2WLIA 1SEBA 4JW3A 3ZK0A 4A67A 4DF9A 1DDHB 1JZ8A 2FH8A 1MCJA 5EU6D 1BBDL 4IW4C 3BP4B 2ZD0A 1AQKL 1FJ1B 3C6LA 5SWZA 4J2QA 3IETA 3AQDA 5IM7B 1Z3GL 3OQRA 1UWEH 4PG9A 4TUKL 2O6CA 1DQML 3ZMEA 3EXLA 2BDNL 3VA6A 3TCLB 1L9RA 3DBSA 1NFIB 3V95A 2I5WA 3WI9A 2CHDA 1WAAA 3TA4D 4N2FA 2CDGB 4JO2L 3MCLH 1F86A 3KBEA 3LD8C 2P8LB 4QOKD 1RHHB 1OPGH 4MLSA 4EI5A 4A6YL 3RURA 3ZZSA 1IC7H 4HKJA 4BHUI 3DOIA 3GJFA 3BVXA 2Z3FA 3L4UA 4R7XA 4UV7H 4OGXL 2CJ3A 5AZEL 1MJJB 8FABA 4F7TA 4NQXB 5FOJA 3BN3B 3CFJA 1M05A 3MRRB 3ESUF 4IHOB 1CFTB 2B1AH 5FO7A 5JR1H 2C1OB 4PSPA 1MJ8H 2E7DA 2NUTB 3IMUA 5DVKA 4LOVA 4NUGL 1ZWIB 1NC4D 4QF1B 4C4KT 3G04A 3FRPA 3L3IB 3LCYA 5TQ2L 5KYYA 4HEPA 4R0LC 3SDCA 1WZMA 4J5VA 4OZIF 4BUHA 1CE1L 2DTMH 2ZICA 3MLRH 2XIBA 2EIMB 1SVZA 2GTQA 2DQDH 1IC4H 1NEZA 3LKSA 3MSPA 3FZUD 1J5OH 2I26N 2XTJE 4FEIA 3O6KL 3CUPA 4JRXE 1A64A 1NCTA 2DEYX 1RP8A 4HBQA 4RFOL 3WD5L 3S36H 3Q3GB 2XV6B 2VM3A 5C09B 3NQKA 4K23L 3I0XA 2W0PA 3LQZA 4U3XA 5TPWL 1MVYA 4GEIA 5T1MB 3CH1A 3POCA 1AKPA 1H8LA 4OD1L 1A4AA 4X5LA 1JXJA 2XQBL 1Z3RA 5GS1B 1S9WA 3GIZH 1DVFB 1QN4A 2GSMB 5HJBA 3GNMH 4FL4C 2HYMA 3FO2A 5MHSE 2QHRH 1KB5L 2OMVA 4Q9RH 1QLEL 3QFGA 5DZAA 4G11A 2ICEB 5LGYA 3SSGA 4OLXL 4O58H 1BQLH 4XNYH 5CSZA 5ACMA 1YEKH 3ARDB 3NG5A 4GBXB 5L9DH 4JRWA 1KCVL 4OZGF 2CBQA 4AQAB 4PGBB 2C26A 4Z7VA 4HGKC 3AXIA 3PFUA 4AJWA 2OXGA 4KFMA 1YECL 4UQEA 5T5NG 2VOTA 2XWXA 3IFPA 3NCMA 2F1BA 4AVHA 4IRJB 4PH8A 3MKKA 1KLFB 2ROYA 1OHZA 2X28A 3ARPA 3NAAH 4I3SH 4OD3L 2HUEA 5FO2A 5BS0A 2GJ6A 1YNTA 3MUY1 3NFPB 3D0LA 2Q7YA 1R3LA 4QEGA 3CZKA 5F6HI 3WGUB 3F84A 2Y07L 5DJZA 1I7ZB 4NKIL 1KPUB 1ZDQA 2XX0A 4HK3N 2L04A 3TTSA 5FO9B 3M88A 2M1KA 5BZDB 5I73C 4MVBC 1AD9A 2F54A 3UC0L 1A6TA 5BUAA 3OWEA 1GYUA 1EAPB 1JDDA 4WHTA 1JDCA 1OTSC 4G43A 1ADWA 1K72A 3BAXA 1SYVB 5LNDA 3P40A 1HL4A 3BVNA 3SDAC 1HYRC 2I60L 4KKNA 5EWIH 4ZBJA 2D7OA 3ZT6A 4KO7A 3ULVH 3CQPA 2FJHA 3RPIB 1IC0A 3EJYD 2FNBA 3DRQA 1JGUH 1WFTA 1BVKA 2Y5TA 4G9FB 5DD5H 1IM3B 5F70A 4BE6A 3RTQB 4F3FB 5FGBA 4FFTA 1JDAA 1OQOA 1Y18A 5DRNA 5K39B 3QZWA 3W39B 3CSTA 1WC7B 4R97C 5D7KD 3OKKB 1R0AH 3B6SA 3L5XH 3CDZA 1NGWA 4RESB 3POHA 5D71H 2K3TA 3QIWB 1FH2A 2WBXA 3VFVB 3ECBB 3MGTB 3VI4E 2ISDA 5IMMB 4ABQA 3BCFA 2EYSB 4HDIB 1U6AH 2P80A 4JCMA 2YARA 5KUKA 4MMXB 2EEXA 3L4VA 2AF2A 3JWDC 1D9KC 3L3GB 3SGKC 4FD0A 1DUYA 1S7WB 2MNUA 3OH9A 3ZDYE 2CK2A 2N59A 2YWZA 3IS1X 2EDFA 1J1PH 1JVOA 1QUPA 1DQJA 5TQ0L 3QQ3A 4FNSA 5DEGB 5HI4D 1TEGA 1FE8H 2FAUA 3GKWL 2DEWX 2DYPA 5D1XC 1I9EA 4FABH 1GVIA 3HLKA 3V7AG 3VXRD 3DX7A 4GB9A 5ICUA 2LLGA 5B7EA 4HK3J 1XGRA 3CN2A 3GHBL 3WTXA 3EFFA 3CHQA 1E4WH 1X5ZA 4OUOA 5I82A 2VXVH 3F7QA 3UEQA 4BWWA 2A4EA 4NM4L 3HIZA 4L05A 2J8UE 2QRCA 2ICWI 3QUXD 2WQVA 2Q2EB 4AK1A 1OAXL 4HFWB 3NPSC 5FYJL 1XTMA 1X6NA 2ZOLB 5FOBA 1RZPA 4K9JA 5F9JA 3GSXB 1I9JH 3OLEA 4HUKB 1TQCC 2R39A 2NYKA 2J2ZB 3HC4L 3PL6B 5C2BL 1CDHA 4IJ3C 3D7PA 1AH1A 1WBZB 5GS1C 3DMMC 4MA7L 4I88A 4NM8H 3GMNA 1MWOA 4WHYH 4L1BA 2YS4A 2ZONA 4YAQA 4JR9H 1G7HA 4AIXA 1DLHB 5FGCB 5HPOA 5AG8A 1BEYL 2X4TB 2XXMB 1OB1B 2HFFB 2VISA 4PG2A 2RTTA 1PX3A 3CFCH 5D2NA 3RWGB 4ESKA 4AXWB 2BNRA 3G6JF 3QCUH 3FFDB 5LDUA 3GTTA 5GGVL 3AXLA 3I6KA 1F11A 2JCCF 1T2QL 5GRYA 1JSYA 3MRIB 2XUWA 1ZCRA 2YAQA 3C04A 4PD4K 2OV0A 3MLXL 2VDKL 4UV4H 1RJYA 4KTGA 3I74A 2D7PA 5CJQH 2EEDA 4LP5A 2PYEB 2O5ZL 1XB8A 2YD4A 2G9KA 3GIVB 1WWBX 3PPSA 2CO4A 3BD3A 1LJMA 3O3AA 3MFFB 1ZT7B 2EYTB 3UAJA 1LK3H 4YE0A 4NJ9H 1BQKA 2PPEA 5JHDB 3CXFA 1LO0H 4J39A 1SJXA 3DGDA 3PWVB 4HU8A 3ECWA 2CPCA 3BCDA 4ZW8A 2E27H 4MJJA 3BYTA 2W07A 2ZUTA 1E5ZA 1DJXA 1A6AB 4PJDB 3OHXC 4LNRA 3RTQC 1W9XA 3DYMA 3HE6B 4OQTA 1FFOA 3GC3A 3NFNA 3ZKSD 1BF8A 1KC5L 5KANI 2DB8A 3QZOA 1P1ZB 5K9KA 1IEAB 2JKTM 4JZJC 4LOEA 4AIEA 5I18H 5KS9F 5E08L 3DJZA 3MJGX 3MRPA 5T33H 1IEBA 3WAKA 3GSNL 3K0WA 3PE9A 5INDB 3VI4A 3VD5A 1KTBA 1UXSA 2ZF9A 1D3CA 3EIKA 2XWZA 2ZOOA 3C60D 4OJEH 3TBCA 4D94A 1UXWB 3GJFK 4MNGB 3TO4A 4LCYB 3SBWC 5TTRA 4K8RD 3X1BA 4GSDL 2Y22A 5F7WC 4Q4IA 1U8JA 3VWKA 3KPLA 4BFKA 1HJCA 3UZVA 4LPYA 1IM9D 3VH8G 3OKNA 4W9LC 4J6RH 4RFEB 3NFSH 1NBVH 5F7YC 1SRDA 2DV6A 5DMKB 4JUTA 1Z5YD 5CINH 3K6FA 2IFFH 1SVCP 3DV6A 4XXCC 5DZNA 1EBPA 2PWFA 3AJ7A 2QPSA 3M8OL 3NACL 2JJUA 4H88H 5G5DA 3SE4C 1PFOA 3OC5A 1J1XH 3BZEA 3NIDE 1QTPA 4DK6A 1MCBA 5MEND 1B2YA 1PZAA 3H1ZA 1J5IA 3APDA 3C9NA 2IO5A 1DQQB 2VC2L 1X4XA 3D85B 1BDYA 4QHKI 2Z7WA 3LS4L 4P3CH 2BCMA 4X9HA 1AI1L 2EE6A 4N90E 2CDEA 5C0AE 4FN0A 2H4EA 5KZCB 4AQZA 1BD2B 2DIAA 3WKPA 2J8UA 4DN3H 5CZXC 3FCGA 1MFBL 3GMLA 3DUSA 4HISA 4M29A 2IOMA 4KKQA 4G6FB 5ELIA 3WS6C 1SBSH 2FHFA 1FHGA 3F6IA 4D7QA 5FFOA 1UOKA 3G9VA 1AE6H 4IOSA 2FECI 2B59B 2FTAA 4U1NA 4YO0A 3DURB 3GRWL 5DFWH 1KNOA 3QJVB 3NABL 4MWFB 3QORD 2FIKA 5KSBE 3QXAA 1LWRA 4XPHL 4Y4FC 2NY7L 4MD0A 1Q0XL 3AB0B 2RALA 2FBRA 1UKSA 4AJ0A 5F96H 1IAOA 3KPMB 1M9SA 2HMIC 7FABH 4HCRH 3SKOB 4XN5A 1KBGL 1K4DB 3D39D 3ZN6A 3HNSL 3GRGA 3HR6A 2FYVA 4X80L 5HYFA 4AYID 1TU2A 1NBZB 2E86A 5KAQG 1KIUA 1UEMA 2EXYC 3HE7B 5ISZE 4OZHB 2D73A 2DWEB 5GZNC 5CMAB 2Y7QA 1RIUH 4IIQC 2O6EA 2SODB 4OCRH 3NJHA 2HPOA 1EXUB 5EU6E 3TX4A 1G7JB 4PJAB 1QQDB 3LEVH 2OL3B 4QKXB 2BNUA 1WIPA 2BIIA 5JTWA 4Y19D 4ZXBC 5B39G 1K6QH 4TQIA 4YDJA 1AY1L 3W81A 2B2XH 4XNUH 3SEPA 4BXSV 2G5UA 3BP5A 2WIIA 3WELA 1NGZB 4HUNB 1ZXQA 1JGDA 4XVOA 1YEEL 1BA9A 2WXPA 1NICA 1FFQA 4QOKE 4XNZB 2ID5A 5IHBA 4ZMVA 1X9LA 1XR8B 3CVIL 3CXHJ 1QFWI 2F7OA 5JA9A 4HG4J 1ZHNB 1SHMA 3F01A 3OR7A 2R2HA 1A6WH 5EO9B 4G80A 4HHGA 3O41A 4IGBA 1FO0B 3HE6C 4NFBA 5T1KB 4NKOB 4WZSD 4XH2B 4YXHL 5JOFA 2P9RA 1P4LA 1ACYH 3EGXB 3VFUB 3KPNB 4JCLA 3SOBL 4QI3A 4DSYA 1ZHBA 2GTWB 4JMXA 4ZYKB 1FFPB 5TE4H 1UT4A 2WP3O 2NVMA 4MMZA 3SDDD 1UEYA 2CGYA 4I77L 2AQQA 1ETJA 4PRDB 4MLIA 2H32A 2NY4C 5C0NC 4L8SC 1TPXB 3DK2A 5IFAH 4LLVB 4LVEA 4XCEB 1LO5B 2EDNA 3IDYC 4B0MB 1CFMA 2GT9B 1RM1A 3PAYA 1GS7A 3EYOA 4Q89A 1XZ0B 2R9HD 2LR4A 3FO9B 4ELKB 1ZEAH 3QUGA 1U0QA 2Y2WA 2YD9A 1YQVH 3AAZA 3S37L 3D33A 2VLJD 3HR5A 3BIKB 3C09B 1FV1B 1U8LB 2PO6A 5C0AA 2H2SC 1LQSR 5I1AA 4ZUVB 2N7SA 1CN4A 3OPUA 2V7NB 1GAFH 4WUUE 3T4AB 2AVGA 5DFVC 1E8ZA 1SQ2N 1WA0X 4UCFA 5HBBA 3DUHA 3SY0B 3O11A 2IADB 5I1IH 1QO3A 1JUFB 4XI5C 1ZGLB 2DDQL 2LFGA 4LLDA 3BO8B 3FT0A 5I0WA 1EGJA 4UILL 3RY6A 4HQQL 5BZDA 4WX8A 4OJFL 1KCBA 4NB7A 4MB3A 1HCVA 5DJ8B 1JF1B 2GK0A 1AHKA 4ONGH 2JI2A 1H0DB 2IAMA 1JNJA 2V9JA 2J88L 4Q56A 2YGNA 3RHWF 5JNYB 4WDIB 1BFOA 3QIBB 4CNIA 1UM5H 4WSKA 1T0NA 3VG9B 4FQHB 3U9UB 2BS71 2Q10A 1RFDH 2VL5A 2ZX5A 4OLWH 3RWCA 1E4KC 1GZPA 3GZPA 4KJPD 5DJYA 2PXYC 2NOZA 4HUUA 4AQOA 1MW1A 4N87A 3RB5A 2E8YA 5M7QA 15C8L 3QWOA 4JG9A 2DIEA 3O8XB 4WY7H 3RFZA 3VW3L 5I15L 1OF2B 1E2WA 5K5YA 2Q3ZA 1G9NH 3ARWA 3P2TA 1HDMA 1BV8A 4J8RA 4J3XA 4ZPVA 2G3ZA 1X7TA 2VDOB 4XC1H 5EU6A 4KMTH 1LE5B 3GHPA 5AG9A 1DE4B 1QVOA 2IDQA 1ERNA 4KY1L 4APXB 4NO0A 4NZUH 4EQ2A 3K71A 4QXTA 4Q2ZA 2BCKB 3INOA 4HUXB 3U30B 2WIMA 2W95A 1QTSA 4LLQA 2R0ZL 1AYOA 3D51A 3KLAA 4EUPH 2HKHL 4K7PH 1MFCL 4AVJA 3TEYA 3VMNA 4LDOB 4JPWH 1R19A 3O6MH 4NT6A 4HV8B 3K91A 3ARED 3U1SL 5BCAA 4QOKA 2AI0H 1JZDC 4LLMA 4P5MA 3ZL4L 3O4LB 3HB3C 2OOYA 2IBZY 2VR5A 2FLRT 2Z7UA 3DTXA 1H5BA 4K73A 2FQDA 4XNZC 4EN3D 4XZ4A 3ESVF 5BMFH 2HN7A 1T7ZA 1W16A 4CVXB 4N8UA 4HJEA 2I69A 4N2OA 4W6WB 3VA2C 3HS9A 1LO2L 5E8OA 5E95B 3NESA 5J13C 2YGOA 1C1EL 5DRXB 3NCYS 3O3EB 4L3FA 5IW3A 2C7UA 3S36X 4G1EA 1KLGB 3Q6GL 1CGSH 5D1QE 1NC4A 2W9LA 4RX4D 3JT0A 4G6AC 4XC3H 2QLVA 2CO7B 4FFWC 2WLNA 5TDOB 1EUVA 2GJZA 1S5HB 5E2WH 2AQPA 4JFZH 3PXJA 2WXLA 4KHXH 3VGDA 5IJKC 3MCG1 4KZDH 1XF4B 3WN5B 1BM7A 4OCLC 1U8OA 4PGZA 5IFHL 3MRHB 1KCSH 4DPBX 1G6RH 2E9BA 3X2QB 1F6AA 1JGEB 1JFHA 1UHVA 3ARTA 4P48A 4NN5B 4J12A 4MA3B 5A2KH 4OCWH 1ESOA 4U1MA 3ZX1A 5IOPB 3B2VL 2M83A 1TTGA 1PY9A 3MUHL 3U6XA 3D4GA 1NCAL 1BAGA 2PN5A 4FI7A 4OGAD 3C09C 1Q1PA 4PJEF 4K3JL 1KWGA 5K69A 4WWKB 4QT5B 2BERA 1T22B 4ZMOA 1TJHH 3P4NA 1RZ7L 4YZFF 3WEAA 5IOKA 1WF5A 3RIKA 4XMPL 1MAJA 5TH2A 1JPST 4BSWB 1UVQA 4ZFZA 3HG4A 5IT2L 5EBWB 5SWQB 4NQSB 5TE7H 4GKNA 5I16B 1NGXA 1GKOA 5JYLA 3GM0A 1V3LA 4YLCA 5DZLA 1RZIA 5D1ZA 3NCJL 3I0WA 5C7ZA 3TM6A 1PY0A 2Z64C 4XCYA 4WWPA 3K6NA 4LPUA 3U9WA 4PJ5D 3X3FL 3V4PB 1PKQE 1BX2A 1OOWA 1QRKA 2BOLA 2X38A 2YPVH 1G1YA 4Y2NA 5EEXA 4BH7B 3NH7H 3TBWA 4Y16D 5HDWA 3IU4H 3TF4A 1TGHA 1P9MA 2P44B 3T08A 3RVVD 4OVUA 4F33B 4PWHA 3QJFB 4R4BA 2YA2A 3EJQA 1FN7A 3WIAA 2FH6A 2DZEA 3Q2CA 5D7IF 2HJKB 5TFSH 4GQPH 1KGWA 1TQBC 2XWCA 1UZ8B 3UXFA 5JW4N 3ETBJ 1KLUB 1UC6A 3TNNB 5CP3H 2GB2A 3ABLB 2AEOA 1JRHH 2QQQA 4K15A 5E5RB 1JZ7A 1UT2A 1EXGA 2CR3A 3S96B 1I7RA 5HDBB 4QRQA 1EHLL 3QUZD 1CGYA 2FQGA 2AKRA 1F4YH 3ULSA 1TZIB 1TITA 2XTJC 2QTVA 2ZAHA 3K2UH 1QG3A 4QRTA 3HZMA 4N22A 2DMGA 2QZQA 3DX3A 9CGTA 4BZYA 4X99A 1NCDL 4UBDD 3P4MB 5E94B 5FK9B 4CBPA 4HS8H 4JFQA 1WQAA 1JZJA 1WBYB 2VJXA 3MRLA 4QGTA 1SXAA 2VW4A 3EYVB 4JFYB 3ZW3A 1SOKA 5LGHH 1DLFH 1MPAL 3U7WH 1ZTXL 3F8UB 4HBCH 1FLRL 3GJEB 2EXSA 4Q6IB 1A21A 4Y2LA 1LE9B 2VSMB 4P23D 2OCFD 3QUYD 1FWXA 3CVHA 1YUKB 3R7QA 2F68X 4KTEL 4EQ3A 4UUJA 3VXRA 2A6KB 5JR1L 1I7UB 2MPAH 4KKPA 2VDPB 4GS7B 1ZA6A 1MHEB 1QI5A 4V2BA 5T5FH 2Z31C 2B4CL 2WQSA 3DSNB 5DQDL 4FMKA 4LHJB 2FE0A 3P9LA 1QD0A 2KC0A 3DSFH 2XA8L 1KXHA 1KCRH 3HJEA 3P0YH 2WHVA 2HRHA 3QJQB 1XDTT 3Q1EA 3WFDH 4F92B 1H19A 1RJCA 2WSKA 4FNRA 1A7NH 2WXIA 4RDQF 4X7SL 3M07A 2J8HA 1O9WA 5FYLE 2FGZA 1OAYL 2PWDA 1T6BX 1WDAA 1A6ZB 2I25N 4L8CA 2BP5M 5MERB 1D7BA 2EEAA 4KK5D 4NN5C 1MLCB 3ZQXA 4A7GF 4Z3JA 1N5YH 1MH5B 2NX5E 5DMGC 4G9DA 2P47B 3B3BA 2QADC 5CCJA 5C0FA 3DXAD 3ZE1F 1U3HD 2G3NA 2PP8A 3LHAA 3WXWH 4LSUL 5HPMA 1Q0YL 5FECA 4J6IA 3HOGA 5KSVB 4HWEL 5B4MD 1SBBA 3QO0A 1AD0A 5ENWA 1BBJA 2OR9H 3LXCA 3KYOB 5BJTB 1IT9H 2DM4A 1OP3K 3CLWA 4L4JA 1QI4A 1S6NA 3GMMB 4UU9B 3VD1A 4DAGL 2ZUXA 3WFEH 1MAMH 3JWNH 2RH0A 4Y9CA 5BRZE 1NANH 1QKZH 3QS3A 3VD7A 4LFHG 4NBXB 5CIPA 4CVWA 1M3IA 3SD5A 3N6YA 4PB9H 3REWA 4DQAA 1UXMA 3DARA 3B8YA 1C9BB 1C47A 2WLJA 1BPLB 4ZW6A 3Q05A 5EZJB 5DT1H 3GDCA 4LCCA 5TGBB 3SYQA 4NQCB 5DZVA 1EMTL 2W1NA 2CCVA 4XNQA 3HBQA 5HJ3B 4A68A 4OZIA 1QFPA 3BIBX 1X5GA 2AJYH 4WXAA 4XP5H 3AM8A 4DVBA 2MSPA 2LAGB 3UTPD 4F9PC 4Q14A 1CZ8H 1IFGA 1RLBA 1QX1A 4DP7X 4OCSH 1CF8H 1U93A 4R7DB 3MRCA 3TJHC 1JNLL 5JPNB 4HXAH 2OZ4A 3E6HA 1CDBA 1BZQK 3V5HA 1NSNH 4B9CA 2VW6A 3A6BH 3T77B 3GSOA 5FW6A 3DETD 1A3LL 2QR0A 4U1SA 3QI9B 2NY3B 5D6CA 3B2XA 3VFRA 5AKTA 3X11A 4OD2A 1JHLL 3TNMB 3C60A 5JUEL 1OZUA 1T04B 4CC0A 4OZGA 2YA0A 4UIMB 1CFVL 2OBGA 3R0MA 1QN7A 2CG9X 5LBSH 2IALB 4PJ9B 2A9BA 4BFBD 1IM9A 1AO7B 1R46A 3RQ3A 1UL7A 2DQUH 3DRTA 1XSIA 4FQLH 3ARGB 4DJMA 5C92A 2PP7A 1IE5A 3BAJA 4Z7WF 1JYNA 3MLWL 3KDMA 3ES6B 5MENA 1LDPL 1CLCA 2D0HA 3V6OC 2G5RA 3GBML 2C9RA 3ZY7A 5IFJA 2HVJA 4AL8C 3NJGA 2NY6B 5SV4A 1D5MA 5AW4B 1U41A 1NM4A 4TVPE 3P30H 1RIVH 1QFWM 1WEJL 2XZQL 3QPKA 2EE3A 5ICYB 1AZCA 1JNHA 3EGDB 1D6EA 5EEVA 2AAAA 4PJ7E 1D3UA 5ANMB 2XG4A 1JS4A 2R4RH 3O6FD 3ZQ9A 4ROCB 2R8SL 4XCCH 4ZO9A 1CI3M 2FYYB 2DI7A 3HZKA 2G3MA 2WOYA 3ILPB 4I9WE 3GMRA 4JQIL 4PRPB 2FL5B 3HTLX 3VFSA 3QE5A 1MREH 5AYQA 1MQKL 3M1BB 3LKQA 5DK3A 3ZE2F 3OXRB 1P4BL 2L7QA 3FN3A 3QORA 2QQLH 5TD4A 2IDUA 2NX5A 3PDGA 4DKAA 1HC1A 1BEXA 1OCOB 3GJFH 2D9CA 4QGYA 3MUGA 3NTCL 4NIKB 3L3OA 3IU3B 4XPTH 4DPRA 3DUUA 4PS8A 3IRCA 2ZOTA 3SE3C 3CC1A 3K6SB 4GRWH 4TSCL 5GS0H 1NIDA 2LGNA 3WMSA 3SYOA 1Z9NA 3D39A 3DA0A 1FI8C 2GY5A 4PBXA 4LSVL 3LDBC 3L4WA 5IYDP 3NJJA 2DQEH 4PTUA 1MI5E 3UAFA 1GYCA 3IDIA 2VH5L 3H4HA 3OKDB 1F42A 1MJUL 3EFDL 2D03H 1LYQA 4H1LG 1EZVY 5D7SH 2AJ3A 4H26B 4RAUA 2YRLA 4Y19A 4M5YL 5EO1B 5F3BB 1UENA 1H9VA 5IQOA 2CO6A 5D6DA 2E7LA 3MTRA 5F3HA 3JWOL 1Q9KB 3JQOB 4PRAA 4FFYA 4JX0A 4E42B 2DLGA 4FQXC 3CFNA 1XTLA 3I50H 2X6AA 3IEAA 1JZ5A 4P9HL 2ZXDA 1QLRB 4LBEB 4MA8H 5LWYL 2K6ZA 2MNWA 5BNXD 1LEIA 4WUKL 1BOYA 2FJFA 4HS3A 4KROB 5DWPA 3K4DA 3MLSL 5ERWA 3X13B 5IYBP 4Y8AA 3G6DH 5E2UL 2XV2A 4JEGB 2X05A 3MCKA 2UXGA 4OI7A 1U91A 4Y5VA 2XZAH 1I8IA 3LS5L 2O5YL 2DQ6A 4AKPA 3S8WA 4XBGB 3B7RL 2X53A 2X0WA 4OCYL 2BS9A 2NY3C 1NJ9B 2KBGA 3V4UL 4HVBA 2LW3A 3IPBA 3W37A 4S1QL 4FG6D 2MCG1 1FZJA 5EIIA 5ID1B 3IAGC 3NIFF 3IKCA 3SDDA 4AG4H 3FPYA 3G6JA 3BUIA 2B5IB 2IIJA 3MX0B 5IGXH 3ZHNA 2XJKA 1U58A 1J3MA 4MCYB 1CU4H 2WKGA 3WLWC 2P3YA 4F8OA 2JCCA 4MJIB 4AEFA 4N0RA 1EDHA 1WQVT 3CG8A 3STZA 4NRYB 4TLTA 1MF2H 2GC7C 3OB8A 3PY9A 3O2WH 1RVFH 4K94L 3ARXA 5EG6C 4XPFH 4BD4A 5I23A 3ISYA 3VTAA 1CL7I 4Q8BA 3WNOA 4DUXA 1F0LA 2YBGA 3BVUA 2WWNA 4AQ1C 3RWDB 3O9WC 1H6EA 4QRSA 3GXNA 1PSKL 3H85A 3HA0A 2AEQL 3MRFA 4HHAB 1IAIM 4BCXA 1NUFA 1X4YA 5ADPH 4GJTB 4HXBL 4MXWL 4FA7B 1BCIA 2ZOKA 3LRLA 5GRVL 1GA2A 3GBLA 3MV9D 4UANA 1U8PA 1IJNA 1AQ8A 4J3OC 32C2B 3QNXB 4OLYH 3V4VL 1MCHA 5EU5B 1OOAA 3ASNB 5J1AA 1WISA 2JCWA 3V5KB 3OAYK 1N9PA