1QNEA

Crystal structure of the adenovirus major late promoter tata box bound to wild-type tbp (arabidopsis thaliana tbp isoform 2).
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
187
structure length
187
Chain Sequence
VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tata box-binding protein (tbp)
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 44
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qneA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qneA02
3EIKA 3HS8A 1MP9A 1JFIC 3OCIA 1TBAB 4ROEB 2IV8A 1QNBA 1KY6A 1D3UA 1QN3A 1NH2A 1YTFA 4WZSD 3OC3C 1KYFA 1PZDA 2Z8UA 1PCZA 1QN7A 3HS9A 3H1ZA 4RODB 1QNCA 1TGHA 1RM1A 1VOLB 1VOKA 2VJ0A 1NVPA 1TBPA 1QN8A 1E42A 1KYUA 1VTLE 3ASMA 1QTPA 1KYDA 2G30A 4B0AA 1QN9A 1QN5A 1QTSA 1QNAA 1QN4A 2D0AA 1VTOA 1NGMA 1W80A 1KY7A 2D0CA 1YTBA 2MJ7A 5IYBP 5IYCP 4PY5A 1QN6A 3VN5A 4ROCB 1R4XA 5IYDP 2D0BA 1QNEA 1CDWA 1C9BB 1B9KA 1AISA 2IV9A
chains in the Genus database with same CATH superfamily
2OOYA 2I5WA 3PMGA 3CWSA 1C4GA 3OCIA 1TBAB 2HKPA 2QRCA 3DPTA 1M3QA 1QNBA 1MPGA 3CW7A 1N3AA 3OGDA 1PCZA 1LWYA 1FN7A 1QN7A 3H1ZA 1VOLB 1RM1A 5KL0A 1UT7A 4BJUA 1TBPA 3OLPA 1EBMA 4WX8A 4CFFA 1QN5A 1KFQA 4B0AA 3BKQX 2QRDA 1QTSA 1QNAA 1QN4A 1VTOA 1YQMA 1M3HA 2NVMA 3TDHA 1P5GX 4EALA 5BMPA 1N39A 4TPSA 4ROCB 4I8OA 1QNEA 1EUVA 1B9KA 3I0WA 2NOIA 1P5DX 2JOIA 1LWWA 3CWUA 1K2YX 2PWWA 4Q11A 3I3WA 2YH5A 1C47A 1J3MA 1PCJX 1PVSA 2Z0FA 1NH2A 3OC3C 3CVSA 1M5Q1 4WXAA 1TGHA 1T6AA 4D7QA 2H4LX 1YQLA 1NVPA 3CWAA 3OSTA 3OSEA 4D7RA 2H5AX 3D4VA 2NOEA 3I0XA 3ENOC 1VTLE 3ASMA 1KYDA 5AN4A 2NOHA 2HZMA 3RPJA 1YTBA 4EAIA 2MJ7A 1JDYA 3TE5A 5IYBP 2LAEA 1QN6A 3KTUA 3VN5A 3CWTA 5IYDP 4EJZA 1C9BB 2HZSA 2HL9A 2IV9A 3EIKA 1N3CA 2EHBD 2Y8LA 1MP9A 1WJWA 1LWVA 3F10A 4HJHA 2JPIA 1QN3A 1YTFA 2NOBA 2NOLA 2FGTA 1PZDA 3OH6A 2DKDA 1KFIA 2QLVA 2V92A 2Z8UA 3IH7A 1YQKA 4RODB 3PDKA 1TUOA 2V8QA 2O3OA 2XHIA 2MZ8A 2NOFA 3UW2A 4IL8A 1XSZA 2ZFDB 1E42A 5F9CA 3N89A 4C7PA 1QTPA 2G30A 3C04A 3RSMA 1QN9A 4MRQA 1KY7A 2DKAA 3OSMA 4EJYA 2R5XA 4QG5A 3SNSA 3T4NA 1WQAA 2V9JA 3DPUA 2QR1A 3ENCA 2D0AA 1AISA 3HS8A 2DKCA 2HL8A 1JFIC 4ROEB 1Q9UA 1V5SA 2IV8A 1KY6A 1D3UA 1UL7A 1VKLA 2YA3A 4WZSD 1KYFA 3D7QA 3EAYA 2F7LA 3NA5A 3HS9A 4EAKA 3CVTA 5HSHA 1QNCA 2FKFA 4EAGA 1PCMX 1VOKA 2FUVA 2JHNA 2VJ0A 1K35A 1KYUA 1KO9A 2NOZA 2Y8QA 3F0ZA 2NWVA 3KRMA 5EPCA 4EAJA 3ULXA 1NGMA 2QREA 1W80A 2NLVA 2D0CA 5JN5A 1UT4A 5BMNA 5JMVD 2FKMX 2OOXA 1LXTA 5IYCP 3OH9A 4PY5A 4DULA 1HU0A 1YQRA 1DIZA 1R4XA 2D0BA 1CDWA 2JHJA 1QN8A
chains in the Genus database with same CATH topology
2I5WA 3OCIA 1TBAB 3DPTA 1M3QA 1QNBA 1N3AA 1PCZA 1LWYA 1FN7A 1QN7A 3H1ZA 1VOLB 1RM1A 1UT7A 1TBPA 1EBMA 1QN5A 4B0AA 1QTSA 1QNAA 1QN4A 1VTOA 1YQMA 1M3HA 1N39A 4TPSA 4ROCB 4I8OA 1QNEA 3I0WA 1B9KA 2NOIA 2JOIA 1LWWA 4Q11A 2YH5A 1NH2A 3OC3C 1TGHA 1YQLA 1NVPA 3OSTA 2NOEA 3I0XA 1VTLE 3ASMA 1KYDA 5AN4A 2NOHA 2HZMA 3RPJA 1YTBA 2MJ7A 5IYBP 2LAEA 1QN6A 3KTUA 3VN5A 5IYDP 4EJZA 1C9BB 2HZSA 2IV9A 3EIKA 1N3CA 1MP9A 1LWVA 3F10A 1QN3A 1YTFA 2NOBA 2NOLA 2FGTA 1PZDA 2Z8UA 1YQKA 3IH7A 4RODB 2NOFA 2O3OA 2XHIA 2MZ8A 1E42A 3N89A 1QTPA 2G30A 1QN9A 1KY7A 3OSMA 4EJYA 3SNSA 3DPUA 2D0AA 1AISA 3HS8A 1JFIC 4ROEB 2IV8A 1KY6A 1D3UA 4WZSD 1KYFA 3HS9A 1QNCA 1VOKA 2VJ0A 1KYUA 1KO9A 2NOZA 3F0ZA 3KRMA 3ULXA 1NGMA 1W80A 2D0CA 1UT4A 5IYCP 4PY5A 4DULA 1HU0A 1YQRA 1R4XA 2D0BA 1CDWA 1QN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIK A;  3HS8 A;  1MP9 A;  1JFI C;  3OCI A;  1TBA B;  4ROE B;  2IV8 A;  1QNB A;  1KY6 A;  1D3U A;  1QN3 A;  1NH2 A;  1YTF A;  4WZS D;  3OC3 C;  1KYF A;  1PZD A;  2Z8U A;  1PCZ A;  1QN7 A;  3HS9 A;  3H1Z A;  4ROD B;  1QNC A;  1TGH A;  1RM1 A;  1VOL B;  1VOK A;  2VJ0 A;  1NVP A;  1TBP A;  1QN8 A;  1E42 A;  1KYU A;  1VTL E;  3ASM A;  1QTP A;  1KYD A;  2G30 A;  4B0A A;  1QN9 A;  1QN5 A;  1QTS A;  1QNA A;  1QN4 A;  2D0A A;  1VTO A;  1NGM A;  1W80 A;  1KY7 A;  2D0C A;  1YTB A;  2MJ7 A;  5IYB P;  5IYC P;  4PY5 A;  1QN6 A;  3VN5 A;  4ROC B;  1R4X A;  5IYD P;  2D0B A;  1QNE A;  1CDW A;  1C9B B;  1B9K A;  1AIS A;  2IV9 A; 
#chains in the Genus database with same CATH topology
 2OOY A;  2I5W A;  3PMG A;  3CWS A;  1C4G A;  3OCI A;  1TBA B;  2HKP A;  2QRC A;  3DPT A;  1M3Q A;  1QNB A;  1MPG A;  3CW7 A;  1N3A A;  3OGD A;  1PCZ A;  1LWY A;  1FN7 A;  1QN7 A;  3H1Z A;  1VOL B;  1RM1 A;  5KL0 A;  1UT7 A;  4BJU A;  1TBP A;  3OLP A;  1EBM A;  4WX8 A;  4CFF A;  1QN5 A;  1KFQ A;  4B0A A;  3BKQ X;  2QRD A;  1QTS A;  1QNA A;  1QN4 A;  1VTO A;  1YQM A;  1M3H A;  2NVM A;  3TDH A;  1P5G X;  4EAL A;  5BMP A;  1N39 A;  4TPS A;  4ROC B;  4I8O A;  1QNE A;  1EUV A;  1B9K A;  3I0W A;  2NOI A;  1P5D X;  2JOI A;  1LWW A;  3CWU A;  1K2Y X;  2PWW A;  4Q11 A;  3I3W A;  2YH5 A;  1C47 A;  1J3M A;  1PCJ X;  1PVS A;  2Z0F A;  1NH2 A;  3OC3 C;  3CVS A;  1M5Q 1;  4WXA A;  1TGH A;  1T6A A;  4D7Q A;  2H4L X;  1YQL A;  1NVP A;  3CWA A;  3OST A;  3OSE A;  4D7R A;  2H5A X;  3D4V A;  2NOE A;  3I0X A;  3ENO C;  1VTL E;  3ASM A;  1KYD A;  5AN4 A;  2NOH A;  2HZM A;  3RPJ A;  1YTB A;  4EAI A;  2MJ7 A;  1JDY A;  3TE5 A;  5IYB P;  2LAE A;  1QN6 A;  3KTU A;  3VN5 A;  3CWT A;  5IYD P;  4EJZ A;  1C9B B;  2HZS A;  2HL9 A;  2IV9 A;  3EIK A;  1N3C A;  2EHB D;  2Y8L A;  1MP9 A;  1WJW A;  1LWV A;  3F10 A;  4HJH A;  2JPI A;  1QN3 A;  1YTF A;  2NOB A;  2NOL A;  2FGT A;  1PZD A;  3OH6 A;  2DKD A;  1KFI A;  2QLV A;  2V92 A;  2Z8U A;  3IH7 A;  1YQK A;  4ROD B;  3PDK A;  1TUO A;  2V8Q A;  2O3O A;  2XHI A;  2MZ8 A;  2NOF A;  3UW2 A;  4IL8 A;  1XSZ A;  2ZFD B;  1E42 A;  5F9C A;  3N89 A;  4C7P A;  1QTP A;  2G30 A;  3C04 A;  3RSM A;  1QN9 A;  4MRQ A;  1KY7 A;  2DKA A;  3OSM A;  4EJY A;  2R5X A;  4QG5 A;  3SNS A;  3T4N A;  1WQA A;  2V9J A;  3DPU A;  2QR1 A;  3ENC A;  2D0A A;  1AIS A;  3HS8 A;  2DKC A;  2HL8 A;  1JFI C;  4ROE B;  1Q9U A;  1V5S A;  2IV8 A;  1KY6 A;  1D3U A;  1UL7 A;  1VKL A;  2YA3 A;  4WZS D;  1KYF A;  3D7Q A;  3EAY A;  2F7L A;  3NA5 A;  3HS9 A;  4EAK A;  3CVT A;  5HSH A;  1QNC A;  2FKF A;  4EAG A;  1PCM X;  1VOK A;  2FUV A;  2JHN A;  2VJ0 A;  1K35 A;  1KYU A;  1KO9 A;  2NOZ A;  2Y8Q A;  3F0Z A;  2NWV A;  3KRM A;  5EPC A;  4EAJ A;  3ULX A;  1NGM A;  2QRE A;  1W80 A;  2NLV A;  2D0C A;  5JN5 A;  1UT4 A;  5BMN A;  5JMV D;  2FKM X;  2OOX A;  1LXT A;  5IYC P;  3OH9 A;  4PY5 A;  4DUL A;  1HU0 A;  1YQR A;  1DIZ A;  1R4X A;  2D0B A;  1CDW A;  2JHJ A;  1QN8 A; 
#chains in the Genus database with same CATH homology
 2I5W A;  3OCI A;  1TBA B;  3DPT A;  1M3Q A;  1QNB A;  1N3A A;  1PCZ A;  1LWY A;  1FN7 A;  1QN7 A;  3H1Z A;  1VOL B;  1RM1 A;  1UT7 A;  1TBP A;  1EBM A;  1QN5 A;  4B0A A;  1QTS A;  1QNA A;  1QN4 A;  1VTO A;  1YQM A;  1M3H A;  1N39 A;  4TPS A;  4ROC B;  4I8O A;  1QNE A;  3I0W A;  1B9K A;  2NOI A;  2JOI A;  1LWW A;  4Q11 A;  2YH5 A;  1NH2 A;  3OC3 C;  1TGH A;  1YQL A;  1NVP A;  3OST A;  2NOE A;  3I0X A;  1VTL E;  3ASM A;  1KYD A;  5AN4 A;  2NOH A;  2HZM A;  3RPJ A;  1YTB A;  2MJ7 A;  5IYB P;  2LAE A;  1QN6 A;  3KTU A;  3VN5 A;  5IYD P;  4EJZ A;  1C9B B;  2HZS A;  2IV9 A;  3EIK A;  1N3C A;  1MP9 A;  1LWV A;  3F10 A;  1QN3 A;  1YTF A;  2NOB A;  2NOL A;  2FGT A;  1PZD A;  2Z8U A;  1YQK A;  3IH7 A;  4ROD B;  2NOF A;  2O3O A;  2XHI A;  2MZ8 A;  1E42 A;  3N89 A;  1QTP A;  2G30 A;  1QN9 A;  1KY7 A;  3OSM A;  4EJY A;  3SNS A;  3DPU A;  2D0A A;  1AIS A;  3HS8 A;  1JFI C;  4ROE B;  2IV8 A;  1KY6 A;  1D3U A;  4WZS D;  1KYF A;  3HS9 A;  1QNC A;  1VOK A;  2VJ0 A;  1KYU A;  1KO9 A;  2NOZ A;  3F0Z A;  3KRM A;  3ULX A;  1NGM A;  1W80 A;  2D0C A;  1UT4 A;  5IYC P;  4PY5 A;  4DUL A;  1HU0 A;  1YQR A;  1R4X A;  2D0B A;  1CDW A;  1QN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...