1QNEA

Crystal structure of the adenovirus major late promoter tata box bound to wild-type tbp (arabidopsis thaliana tbp isoform 2).
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
187
structure length
187
Chain Sequence
VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 44
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qneA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qneA02
1B9KA 1E42A 2VJ0A 1QN7A 5IYBP 1TGHA 1QTSA 1KYDA 3HS8A 1NGMA 1QN9A 1QN5A 2D0AA 2G30A 1JFIC 1QN8A 5IYDP 1PCZA 3OC3C 1MP9A 2D0CA 3VN5A 1QNEA 1QN3A 1AISA 1D3UA 1TBPA 1QTPA 1RM1A 3OCIA 1CDWA 1R4XA 2Z8UA 1C9BB 3H1ZA 1W80A 3EIKA 1YTFA 4ROCB 4RODB 2D0BA 1KYUA 1NH2A 3ASMA 1QN6A 4B0AA 1NVPA 1QNBA 1YTBA 4PY5A 4WZSD 1QN4A 2IV9A 1VTOA 4ROEB 1TBAB 2IV8A 5IYCP 1QNCA 1VOLB 1KY6A 1KYFA 1VOKA 2MJ7A 1KY7A 1QNAA 1VTLE 3HS9A 1PZDA
chains in the Genus database with same CATH superfamily
3OSEA 1E42A 1B9KA 2HZSA 1QN7A 3DPUA 3UW2A 5IYBP 1KYDA 3I0WA 1XSZA 1JFIC 1YQKA 2D0CA 3I0XA 3DPTA 1C4GA 4D7RA 1MPGA 2Y8QA 2NOBA 3ENOC 5BMPA 4WXAA 2V92A 1FN7A 1QTPA 2NOZA 2DKCA 2Z8UA 2HL8A 2YH5A 3EIKA 1LWWA 4ROCB 3CWUA 4EAJA 4PY5A 4WZSD 1VTOA 1WQAA 4QG5A 2IV8A 1K35A 2H4LX 1UL7A 1VOLB 1KYFA 3OLPA 2NOLA 1QNAA 3OSMA 1N3AA 3ENCA 3CW7A 2VJ0A 3CWAA 2I5WA 1QTSA 2NOEA 1QN9A 1Q9UA 3F10A 1QN5A 1N3CA 5JMVD 5IYDP 2HKPA 3SNSA 1PVSA 1KO9A 1LXTA 1P5GX 2LAEA 4EALA 3VN5A 1QNEA 2QLVA 2ZFDB 3OH9A 1AISA 3CWTA 2NOHA 1TBPA 1RM1A 2FGTA 1CDWA 3OSTA 3I3WA 3TE5A 4EJZA 1R4XA 2Z0FA 2FUVA 1YTFA 1KFQA 1NH2A 3BKQX 2DKAA 4EAGA 3T4NA 3NA5A 2NVMA 2QR1A 4DULA 3PDKA 1QN4A 2YA3A 1TBAB 5IYCP 4D7QA 2JHNA 1QNCA 1N39A 2XHIA 5HSHA 4EAIA 1VOKA 2V8QA 2FKFA 1LWVA 5KL0A 3D4VA 3HS8A 2OOYA 1J3MA 2H5AX 1PCZA 2OOXA 3OC3C 3RSMA 3IH7A 3PMGA 1QN3A 2MZ8A 2Y8LA 3ULXA 1P5DX 1DIZA 1EUVA 1T6AA 3F0ZA 3D7QA 1UT4A 4WX8A 3C04A 5EPCA 4MRQA 4RODB 2D0BA 1JDYA 1WJWA 1QN6A 4C7PA 1YTBA 1QNBA 3KTUA 2NLVA 3N89A 4Q11A 2IV9A 1TUOA 4BJUA 3CWSA 2JHJA 2NWVA 4IL8A 1KY6A 5F9CA 1M5Q1 1K2YX 1PZDA 3RPJA 4EAKA 3EAYA 1KFIA 2PWWA 4I8OA 1UT7A 1M3HA 1TGHA 1HU0A 5JN5A 1NGMA 2QRCA 2EHBD 2D0AA 1C47A 2HZMA 2G30A 1YQMA 1PCJX 2QRDA 1MP9A 2F7LA 3KRMA 1M3QA 1VKLA 2FKMX 4HJHA 1D3UA 2NOIA 3OCIA 2JPIA 2JOIA 4TPSA 3OGDA 2V9JA 2O3OA 1LWYA 1C9BB 4EJYA 3CVSA 2QREA 1W80A 2R5XA 3H1ZA 2NOFA 1KYUA 3HS9A 3ASMA 5AN4A 4B0AA 1NVPA 3CVTA 2HL9A 1YQLA 1PCMX 1V5SA 4ROEB 5BMNA 3OH6A 3TDHA 2MJ7A 1KY7A 1YQRA 1EBMA 1VTLE 2DKDA 1QN8A 4CFFA
chains in the Genus database with same CATH topology
1B9KA 1E42A 2HZSA 1QN7A 3DPUA 5IYBP 1KYDA 3I0WA 1JFIC 1YQKA 2D0CA 3I0XA 3DPTA 2NOBA 1FN7A 1QTPA 2NOZA 2Z8UA 2YH5A 3EIKA 1LWWA 4ROCB 4PY5A 4WZSD 1VTOA 2IV8A 1VOLB 1KYFA 2NOLA 1QNAA 3OSMA 1N3AA 2VJ0A 2I5WA 1QTSA 2NOEA 1QN9A 1QN5A 3F10A 1N3CA 5IYDP 3SNSA 2LAEA 1KO9A 3VN5A 1QNEA 1AISA 2NOHA 1TBPA 1RM1A 2FGTA 1CDWA 3OSTA 4EJZA 1R4XA 1YTFA 1NH2A 4DULA 1QN4A 1TBAB 5IYCP 1QNCA 1N39A 2XHIA 1VOKA 1LWVA 3HS8A 1PCZA 3OC3C 3IH7A 1QN3A 2MZ8A 3ULXA 3F0ZA 1UT4A 4RODB 2D0BA 1QN6A 1YTBA 1QNBA 3KTUA 3N89A 4Q11A 2IV9A 1KY6A 3RPJA 1PZDA 4I8OA 1UT7A 1M3HA 1TGHA 1HU0A 1NGMA 2D0AA 2HZMA 2G30A 1YQMA 1MP9A 3KRMA 1M3QA 2NOIA 1D3UA 3OCIA 2JOIA 4TPSA 1LWYA 2O3OA 1C9BB 4EJYA 3H1ZA 1W80A 2NOFA 1KYUA 3ASMA 5AN4A 4B0AA 1NVPA 1YQLA 4ROEB 2MJ7A 1KY7A 1YQRA 1EBMA 1VTLE 3HS9A 1QN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9K A;  1E42 A;  2VJ0 A;  1QN7 A;  5IYB P;  1TGH A;  1QTS A;  1KYD A;  3HS8 A;  1NGM A;  1QN9 A;  1QN5 A;  2D0A A;  2G30 A;  1JFI C;  1QN8 A;  5IYD P;  1PCZ A;  3OC3 C;  1MP9 A;  2D0C A;  3VN5 A;  1QNE A;  1QN3 A;  1AIS A;  1D3U A;  1TBP A;  1QTP A;  1RM1 A;  3OCI A;  1CDW A;  1R4X A;  2Z8U A;  1C9B B;  3H1Z A;  1W80 A;  3EIK A;  1YTF A;  4ROC B;  4ROD B;  2D0B A;  1KYU A;  1NH2 A;  3ASM A;  1QN6 A;  4B0A A;  1NVP A;  1QNB A;  1YTB A;  4PY5 A;  4WZS D;  1QN4 A;  2IV9 A;  1VTO A;  4ROE B;  1TBA B;  2IV8 A;  5IYC P;  1QNC A;  1VOL B;  1KY6 A;  1KYF A;  1VOK A;  2MJ7 A;  1KY7 A;  1QNA A;  1VTL E;  3HS9 A;  1PZD A; 
#chains in the Genus database with same CATH topology
 3OSE A;  1E42 A;  1B9K A;  2HZS A;  1QN7 A;  3DPU A;  3UW2 A;  5IYB P;  1KYD A;  3I0W A;  1XSZ A;  1JFI C;  1YQK A;  2D0C A;  3I0X A;  3DPT A;  1C4G A;  4D7R A;  1MPG A;  2Y8Q A;  2NOB A;  3ENO C;  5BMP A;  4WXA A;  2V92 A;  1FN7 A;  1QTP A;  2NOZ A;  2DKC A;  2Z8U A;  2HL8 A;  2YH5 A;  3EIK A;  1LWW A;  4ROC B;  3CWU A;  4EAJ A;  4PY5 A;  4WZS D;  1VTO A;  1WQA A;  4QG5 A;  2IV8 A;  1K35 A;  2H4L X;  1UL7 A;  1VOL B;  1KYF A;  3OLP A;  2NOL A;  1QNA A;  3OSM A;  1N3A A;  3ENC A;  3CW7 A;  2VJ0 A;  3CWA A;  2I5W A;  1QTS A;  2NOE A;  1QN9 A;  1Q9U A;  3F10 A;  1QN5 A;  1N3C A;  5JMV D;  5IYD P;  2HKP A;  3SNS A;  1PVS A;  1KO9 A;  1LXT A;  1P5G X;  2LAE A;  4EAL A;  3VN5 A;  1QNE A;  2QLV A;  2ZFD B;  3OH9 A;  1AIS A;  3CWT A;  2NOH A;  1TBP A;  1RM1 A;  2FGT A;  1CDW A;  3OST A;  3I3W A;  3TE5 A;  4EJZ A;  1R4X A;  2Z0F A;  2FUV A;  1YTF A;  1KFQ A;  1NH2 A;  3BKQ X;  2DKA A;  4EAG A;  3T4N A;  3NA5 A;  2NVM A;  2QR1 A;  4DUL A;  3PDK A;  1QN4 A;  2YA3 A;  1TBA B;  5IYC P;  4D7Q A;  2JHN A;  1QNC A;  1N39 A;  2XHI A;  5HSH A;  4EAI A;  1VOK A;  2V8Q A;  2FKF A;  1LWV A;  5KL0 A;  3D4V A;  3HS8 A;  2OOY A;  1J3M A;  2H5A X;  1PCZ A;  2OOX A;  3OC3 C;  3RSM A;  3IH7 A;  3PMG A;  1QN3 A;  2MZ8 A;  2Y8L A;  3ULX A;  1P5D X;  1DIZ A;  1EUV A;  1T6A A;  3F0Z A;  3D7Q A;  1UT4 A;  4WX8 A;  3C04 A;  5EPC A;  4MRQ A;  4ROD B;  2D0B A;  1JDY A;  1WJW A;  1QN6 A;  4C7P A;  1YTB A;  1QNB A;  3KTU A;  2NLV A;  3N89 A;  4Q11 A;  2IV9 A;  1TUO A;  4BJU A;  3CWS A;  2JHJ A;  2NWV A;  4IL8 A;  1KY6 A;  5F9C A;  1M5Q 1;  1K2Y X;  1PZD A;  3RPJ A;  4EAK A;  3EAY A;  1KFI A;  2PWW A;  4I8O A;  1UT7 A;  1M3H A;  1TGH A;  1HU0 A;  5JN5 A;  1NGM A;  2QRC A;  2EHB D;  2D0A A;  1C47 A;  2HZM A;  2G30 A;  1YQM A;  1PCJ X;  2QRD A;  1MP9 A;  2F7L A;  3KRM A;  1M3Q A;  1VKL A;  2FKM X;  4HJH A;  1D3U A;  2NOI A;  3OCI A;  2JPI A;  2JOI A;  4TPS A;  3OGD A;  2V9J A;  2O3O A;  1LWY A;  1C9B B;  4EJY A;  3CVS A;  2QRE A;  1W80 A;  2R5X A;  3H1Z A;  2NOF A;  1KYU A;  3HS9 A;  3ASM A;  5AN4 A;  4B0A A;  1NVP A;  3CVT A;  2HL9 A;  1YQL A;  1PCM X;  1V5S A;  4ROE B;  5BMN A;  3OH6 A;  3TDH A;  2MJ7 A;  1KY7 A;  1YQR A;  1EBM A;  1VTL E;  2DKD A;  1QN8 A;  4CFF A; 
#chains in the Genus database with same CATH homology
 1B9K A;  1E42 A;  2HZS A;  1QN7 A;  3DPU A;  5IYB P;  1KYD A;  3I0W A;  1JFI C;  1YQK A;  2D0C A;  3I0X A;  3DPT A;  2NOB A;  1FN7 A;  1QTP A;  2NOZ A;  2Z8U A;  2YH5 A;  3EIK A;  1LWW A;  4ROC B;  4PY5 A;  4WZS D;  1VTO A;  2IV8 A;  1VOL B;  1KYF A;  2NOL A;  1QNA A;  3OSM A;  1N3A A;  2VJ0 A;  2I5W A;  1QTS A;  2NOE A;  1QN9 A;  1QN5 A;  3F10 A;  1N3C A;  5IYD P;  3SNS A;  2LAE A;  1KO9 A;  3VN5 A;  1QNE A;  1AIS A;  2NOH A;  1TBP A;  1RM1 A;  2FGT A;  1CDW A;  3OST A;  4EJZ A;  1R4X A;  1YTF A;  1NH2 A;  4DUL A;  1QN4 A;  1TBA B;  5IYC P;  1QNC A;  1N39 A;  2XHI A;  1VOK A;  1LWV A;  3HS8 A;  1PCZ A;  3OC3 C;  3IH7 A;  1QN3 A;  2MZ8 A;  3ULX A;  3F0Z A;  1UT4 A;  4ROD B;  2D0B A;  1QN6 A;  1YTB A;  1QNB A;  3KTU A;  3N89 A;  4Q11 A;  2IV9 A;  1KY6 A;  3RPJ A;  1PZD A;  4I8O A;  1UT7 A;  1M3H A;  1TGH A;  1HU0 A;  1NGM A;  2D0A A;  2HZM A;  2G30 A;  1YQM A;  1MP9 A;  3KRM A;  1M3Q A;  2NOI A;  1D3U A;  3OCI A;  2JOI A;  4TPS A;  1LWY A;  2O3O A;  1C9B B;  4EJY A;  3H1Z A;  1W80 A;  2NOF A;  1KYU A;  3ASM A;  5AN4 A;  4B0A A;  1NVP A;  1YQL A;  4ROE B;  2MJ7 A;  1KY7 A;  1YQR A;  1EBM A;  1VTL E;  3HS9 A;  1QN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...