2QR1A

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
116
Chain Sequence
KWHFGVRCRGDAPEILLAVYRALQRAGAQFTVPKPVNGKYRSDMYTIKSRWEIPHCKREGKNTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSHDLKSSFPFLDLCAMLVCKLFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 32
structure length 116
sequence length 126
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2qr1A00
2Y8LA 3T4NA 2OOXA 2QREA 2ZFDB 4EAGA 1V5SA 2YA3A 2V92A 2EHBD 4EAIA 2QR1A 2QRDA 3TDHA 4CFFA 3TE5A 4EAKA 1UL7A 3OSEA 2QLVA 2OOYA 2Y8QA 2V8QA 2V9JA 4EAJA 2QRCA 4EALA
chains in the Genus database with same CATH superfamily
1MPGA 3N89A 3RPJA 4RODB 3OSTA 1AISA 2H5AX 3CVSA 4BJUA 2JOIA 2ZFDB 1TBPA 1V5SA 3OC3C 3OGDA 1N39A 2V92A 1EUVA 4ROEB 1T6AA 2NOEA 2FKFA 1NVPA 5BMNA 1KY6A 3BKQX 1UT7A 2H4LX 3SNSA 1P5DX 1M3HA 1N3AA 2HZMA 1TBAB 1QN3A 4I8OA 2NOIA 3EIKA 5F9CA 2QLVA 1KY7A 1E42A 2HKPA 2OOYA 2F7LA 2Y8QA 3OSMA 3ENOC 4Q11A 5IYBP 1VOLB 1QTPA 1LXTA 4D7RA 2JHNA 2FGTA 3F10A 3RSMA 1QNCA 4EAJA 2HZSA 2NLVA 4C7PA 3I0XA 2OOXA 1RM1A 4PY5A 4WZSD 3ASMA 3NA5A 1M5Q1 1JFIC 4HJHA 1YQRA 2MJ7A 1YTBA 2JHJA 2EHBD 4EAIA 1MP9A 2QR1A 1LWVA 3EAYA 5HSHA 1TUOA 1QN9A 1QTSA 2QRDA 5BMPA 4EJYA 2D0BA 2FUVA 4CFFA 2DKCA 2G30A 2YH5A 3TE5A 5IYDP 2MZ8A 1YQMA 3DPTA 1D3UA 5KL0A 3I0WA 1QN7A 1J3MA 1VOKA 4DULA 2V8QA 2DKDA 3D4VA 3HS8A 1PCMX 2I5WA 1KFQA 2QRCA 1HU0A 4EALA 1W80A 3UW2A 5EPCA 2NOBA 3F0ZA 4TPSA 3T4NA 4B0AA 2QREA 1FN7A 2NOLA 3PDKA 4EAGA 1VKLA 3OH9A 2YA3A 1N3CA 4WXAA 1PVSA 1VTOA 5JMVD 1NH2A 1KYDA 3VN5A 2D0AA 2LAEA 3CWAA 1YTFA 3D7QA 1M3QA 4QG5A 2Z0FA 4MRQA 1WQAA 1QN5A 2FKMX 2O3OA 3IH7A 1LWYA 1KFIA 3I3WA 1UT4A 3OSEA 1XSZA 2NVMA 2VJ0A 1QN6A 1TGHA 1KYUA 1LWWA 3ULXA 2NOZA 3ENCA 1JDYA 4IL8A 1R4XA 1QN4A 1QN8A 2XHIA 3C04A 3KRMA 3KTUA 1QNBA 2R5XA 2Y8LA 2D0CA 2NOFA 1PCZA 3HS9A 3CW7A 3CWUA 1QNAA 1B9KA 2Z8UA 1VTLE 2NOHA 3CVTA 1YQLA 1KO9A 2HL9A 1K2YX 5AN4A 3PMGA 3H1ZA 3OCIA 1NGMA 2DKAA 2IV9A 3TDHA 1PCJX 2HL8A 3CWSA 4EAKA 1K35A 4WX8A 1UL7A 1DIZA 1C4GA 2PWWA 1P5GX 3OH6A 5JN5A 5IYCP 1WJWA 1YQKA 2NWVA 4EJZA 4D7QA 2V9JA 1PZDA 1QNEA 1C47A 2IV8A 3DPUA 3OLPA 1CDWA 1EBMA 3CWTA 1C9BB 2JPIA 4ROCB 1KYFA 1Q9UA
chains in the Genus database with same CATH topology
2Y8LA 3T4NA 2OOXA 2QREA 2ZFDB 4EAGA 1V5SA 2YA3A 2V92A 2EHBD 4EAIA 2QR1A 2QRDA 3TDHA 4CFFA 3TE5A 4EAKA 1UL7A 3OSEA 2QLVA 2OOYA 2Y8QA 2V8QA 2V9JA 4EAJA 2QRCA 4EALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8L A;  3T4N A;  2OOX A;  2QRE A;  2ZFD B;  4EAG A;  1V5S A;  2YA3 A;  2V92 A;  2EHB D;  4EAI A;  2QR1 A;  2QRD A;  3TDH A;  4CFF A;  3TE5 A;  4EAK A;  1UL7 A;  3OSE A;  2QLV A;  2OOY A;  2Y8Q A;  2V8Q A;  2V9J A;  4EAJ A;  2QRC A;  4EAL A; 
#chains in the Genus database with same CATH topology
 1MPG A;  3N89 A;  3RPJ A;  4ROD B;  3OST A;  1AIS A;  2H5A X;  3CVS A;  4BJU A;  2JOI A;  2ZFD B;  1TBP A;  1V5S A;  3OC3 C;  3OGD A;  1N39 A;  2V92 A;  1EUV A;  4ROE B;  1T6A A;  2NOE A;  2FKF A;  1NVP A;  5BMN A;  1KY6 A;  3BKQ X;  1UT7 A;  2H4L X;  3SNS A;  1P5D X;  1M3H A;  1N3A A;  2HZM A;  1TBA B;  1QN3 A;  4I8O A;  2NOI A;  3EIK A;  5F9C A;  2QLV A;  1KY7 A;  1E42 A;  2HKP A;  2OOY A;  2F7L A;  2Y8Q A;  3OSM A;  3ENO C;  4Q11 A;  5IYB P;  1VOL B;  1QTP A;  1LXT A;  4D7R A;  2JHN A;  2FGT A;  3F10 A;  3RSM A;  1QNC A;  4EAJ A;  2HZS A;  2NLV A;  4C7P A;  3I0X A;  2OOX A;  1RM1 A;  4PY5 A;  4WZS D;  3ASM A;  3NA5 A;  1M5Q 1;  1JFI C;  4HJH A;  1YQR A;  2MJ7 A;  1YTB A;  2JHJ A;  2EHB D;  4EAI A;  1MP9 A;  2QR1 A;  1LWV A;  3EAY A;  5HSH A;  1TUO A;  1QN9 A;  1QTS A;  2QRD A;  5BMP A;  4EJY A;  2D0B A;  2FUV A;  4CFF A;  2DKC A;  2G30 A;  2YH5 A;  3TE5 A;  5IYD P;  2MZ8 A;  1YQM A;  3DPT A;  1D3U A;  5KL0 A;  3I0W A;  1QN7 A;  1J3M A;  1VOK A;  4DUL A;  2V8Q A;  2DKD A;  3D4V A;  3HS8 A;  1PCM X;  2I5W A;  1KFQ A;  2QRC A;  1HU0 A;  4EAL A;  1W80 A;  3UW2 A;  5EPC A;  2NOB A;  3F0Z A;  4TPS A;  3T4N A;  4B0A A;  2QRE A;  1FN7 A;  2NOL A;  3PDK A;  4EAG A;  1VKL A;  3OH9 A;  2YA3 A;  1N3C A;  4WXA A;  1PVS A;  1VTO A;  5JMV D;  1NH2 A;  1KYD A;  3VN5 A;  2D0A A;  2LAE A;  3CWA A;  1YTF A;  3D7Q A;  1M3Q A;  4QG5 A;  2Z0F A;  4MRQ A;  1WQA A;  1QN5 A;  2FKM X;  2O3O A;  3IH7 A;  1LWY A;  1KFI A;  3I3W A;  1UT4 A;  3OSE A;  1XSZ A;  2NVM A;  2VJ0 A;  1QN6 A;  1TGH A;  1KYU A;  1LWW A;  3ULX A;  2NOZ A;  3ENC A;  1JDY A;  4IL8 A;  1R4X A;  1QN4 A;  1QN8 A;  2XHI A;  3C04 A;  3KRM A;  3KTU A;  1QNB A;  2R5X A;  2Y8L A;  2D0C A;  2NOF A;  1PCZ A;  3HS9 A;  3CW7 A;  3CWU A;  1QNA A;  1B9K A;  2Z8U A;  1VTL E;  2NOH A;  3CVT A;  1YQL A;  1KO9 A;  2HL9 A;  1K2Y X;  5AN4 A;  3PMG A;  3H1Z A;  3OCI A;  1NGM A;  2DKA A;  2IV9 A;  3TDH A;  1PCJ X;  2HL8 A;  3CWS A;  4EAK A;  1K35 A;  4WX8 A;  1UL7 A;  1DIZ A;  1C4G A;  2PWW A;  1P5G X;  3OH6 A;  5JN5 A;  5IYC P;  1WJW A;  1YQK A;  2NWV A;  4EJZ A;  4D7Q A;  2V9J A;  1PZD A;  1QNE A;  1C47 A;  2IV8 A;  3DPU A;  3OLP A;  1CDW A;  1EBM A;  3CWT A;  1C9B B;  2JPI A;  4ROC B;  1KYF A;  1Q9U A; 
#chains in the Genus database with same CATH homology
 2Y8L A;  3T4N A;  2OOX A;  2QRE A;  2ZFD B;  4EAG A;  1V5S A;  2YA3 A;  2V92 A;  2EHB D;  4EAI A;  2QR1 A;  2QRD A;  3TDH A;  4CFF A;  3TE5 A;  4EAK A;  1UL7 A;  3OSE A;  2QLV A;  2OOY A;  2Y8Q A;  2V8Q A;  2V9J A;  4EAJ A;  2QRC A;  4EAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...