4ROCB

Human tfiib-related factor 2 (brf2) and tbp bound to u6#2 promoter
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
GPSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription factor IIIB 50 kDa subunit
publication title Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4rocB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4rocB02
1QNAA 3VN5A 1QNEA 5IYBP 1QN9A 3HS8A 1CDWA 1YTFA 1TBAB 2G30A 1KY7A 3HS9A 2MJ7A 1QN5A 1TBPA 1R4XA 3ASMA 1NVPA 1QN3A 5IYCP 1QNBA 4PY5A 2Z8UA 1KY6A 1W80A 2D0BA 1KYDA 2IV9A 1NH2A 1D3UA 1PZDA 2IV8A 1NGMA 4B0AA 1QN8A 5IYDP 1C9BB 4RODB 1VTOA 1QN6A 3OC3C 1RM1A 1AISA 1JFIC 1VOKA 1QN7A 2D0CA 1VTLE 1QNCA 1E42A 1TGHA 1B9KA 1YTBA 1VOLB 1QTSA 1QTPA 3H1ZA 1PCZA 4ROCB 2VJ0A 1MP9A 1KYUA 4ROEB 1QN4A 1KYFA 4WZSD 3OCIA 3EIKA 2D0AA
chains in the Genus database with same CATH superfamily
3VN5A 1YQRA 1YQLA 2H4LX 1PCJX 3HS8A 4EAJA 3KTUA 1DIZA 1YQMA 2OOXA 3N89A 5HSHA 1EBMA 2ZFDB 1TUOA 1KFIA 2V9JA 1EUVA 4HJHA 3TE5A 1M3HA 5AN4A 3T4NA 3CWTA 1KO9A 1N3AA 1QN6A 1AISA 2HL8A 1KFQA 1JFIC 4IL8A 3OSEA 2PWWA 2YA3A 2HZSA 2JOIA 1QTPA 1P5DX 1PCZA 2HL9A 3RSMA 2NOLA 1WQAA 1YQKA 2FKMX 1VKLA 1KYFA 1N3CA 3NA5A 3OH6A 2QRDA 1RM1A 2MZ8A 2NWVA 3CWAA 2JPIA 2EHBD 1N39A 3OSTA 3TDHA 2V92A 3HS9A 4CFFA 3CVSA 2NVMA 1QN5A 1TBPA 3OGDA 1UT4A 1QNBA 2JHJA 1LWVA 1M5Q1 4PY5A 1KYDA 2IV9A 1QN8A 2NLVA 1PZDA 2IV8A 3I0XA 1NGMA 5IYDP 4EAGA 3ULXA 1C9BB 3RPJA 1QN7A 2D0CA 3DPTA 3F10A 2YH5A 2H5AX 1WJWA 3PMGA 1YTBA 1QTSA 1VOLB 1UT7A 4I8OA 4ROCB 4EJZA 4WX8A 2OOYA 2Z0FA 1KYUA 1QN4A 1C47A 2FKFA 4WZSD 3EIKA 1QNAA 1UL7A 1QN9A 1YTFA 1CDWA 1TBAB 2G30A 3ENCA 4C7PA 3CWSA 2QREA 3D4VA 3IH7A 3KRMA 3ASMA 4EJYA 1QN3A 5F9CA 3CW7A 5IYCP 1LWYA 2Z8UA 1KY6A 1W80A 3UW2A 1NH2A 1D3UA 2I5WA 3EAYA 4QG5A 1MPGA 1C4GA 4RODB 2FGTA 1K2YX 1JDYA 3BKQX 1TGHA 1Q9UA 1XSZA 2NOBA 3CVTA 1B9KA 1K35A 1PVSA 5JN5A 2HZMA 2QLVA 3OSMA 2NOIA 2DKCA 4Q11A 2F7LA 5EPCA 1V5SA 3CWUA 1FN7A 1J3MA 5KL0A 3OH9A 4D7QA 1LXTA 5IYBP 3I0WA 4EALA 1KY7A 3F0ZA 2DKDA 2MJ7A 3D7QA 1NVPA 1R4XA 2DKAA 2XHIA 3OLPA 4D7RA 2JHNA 2NOZA 3ENOC 2D0BA 2Y8LA 2NOHA 2Y8QA 2NOEA 5BMPA 2FUVA 4B0AA 1PCMX 4BJUA 2O3OA 5JMVD 3DPUA 1LWWA 4EAKA 3I3WA 3PDKA 1VTOA 3OC3C 1VOKA 1VTLE 1QNCA 1E42A 4TPSA 2QRCA 1P5GX 4MRQA 2R5XA 4DULA 5BMNA 4EAIA 2NOFA 4WXAA 2HKPA 3H1ZA 1M3QA 2VJ0A 2LAEA 1MP9A 1T6AA 3C04A 3SNSA 2QR1A 4ROEB 1HU0A 2V8QA 1QNEA 3OCIA 2D0AA
chains in the Genus database with same CATH topology
3VN5A 1YQRA 1YQLA 3HS8A 3KTUA 1YQMA 3N89A 1EBMA 1M3HA 5AN4A 1KO9A 1N3AA 1QN6A 1AISA 1JFIC 2HZSA 2JOIA 1QTPA 1PCZA 2NOLA 1YQKA 1KYFA 1N3CA 1RM1A 2MZ8A 1N39A 3OSTA 3HS9A 1QN5A 1TBPA 1UT4A 1QNBA 4PY5A 1LWVA 1KYDA 2IV9A 1QN8A 3I0XA 1PZDA 2IV8A 1NGMA 5IYDP 3ULXA 1C9BB 3RPJA 1QN7A 2D0CA 3DPTA 3F10A 2YH5A 1YTBA 1VOLB 1QTSA 1UT7A 4I8OA 4ROCB 4EJZA 1KYUA 1QN4A 4WZSD 3EIKA 1QNAA 1QN9A 1YTFA 1CDWA 1TBAB 2G30A 3IH7A 3KRMA 3ASMA 4EJYA 1QN3A 5IYCP 1LWYA 2Z8UA 1KY6A 1W80A 1NH2A 1D3UA 2I5WA 4RODB 2FGTA 1TGHA 2NOBA 1B9KA 2HZMA 3OSMA 2NOIA 4Q11A 1FN7A 5IYBP 3I0WA 1KY7A 3F0ZA 2MJ7A 1NVPA 1R4XA 2XHIA 2NOZA 2D0BA 2NOHA 2NOEA 4B0AA 1LWWA 2O3OA 3DPUA 1VTOA 3OC3C 1VOKA 1VTLE 1QNCA 1E42A 4TPSA 4DULA 2NOFA 3H1ZA 1M3QA 2VJ0A 2LAEA 1MP9A 3SNSA 1HU0A 4ROEB 1QNEA 3OCIA 2D0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNA A;  3VN5 A;  1QNE A;  5IYB P;  1QN9 A;  3HS8 A;  1CDW A;  1YTF A;  1TBA B;  2G30 A;  1KY7 A;  3HS9 A;  2MJ7 A;  1QN5 A;  1TBP A;  1R4X A;  3ASM A;  1NVP A;  1QN3 A;  5IYC P;  1QNB A;  4PY5 A;  2Z8U A;  1KY6 A;  1W80 A;  2D0B A;  1KYD A;  2IV9 A;  1NH2 A;  1D3U A;  1PZD A;  2IV8 A;  1NGM A;  4B0A A;  1QN8 A;  5IYD P;  1C9B B;  4ROD B;  1VTO A;  1QN6 A;  3OC3 C;  1RM1 A;  1AIS A;  1JFI C;  1VOK A;  1QN7 A;  2D0C A;  1VTL E;  1QNC A;  1E42 A;  1TGH A;  1B9K A;  1YTB A;  1VOL B;  1QTS A;  1QTP A;  3H1Z A;  1PCZ A;  4ROC B;  2VJ0 A;  1MP9 A;  1KYU A;  4ROE B;  1QN4 A;  1KYF A;  4WZS D;  3OCI A;  3EIK A;  2D0A A; 
#chains in the Genus database with same CATH topology
 3VN5 A;  1YQR A;  1YQL A;  2H4L X;  1PCJ X;  3HS8 A;  4EAJ A;  3KTU A;  1DIZ A;  1YQM A;  2OOX A;  3N89 A;  5HSH A;  1EBM A;  2ZFD B;  1TUO A;  1KFI A;  2V9J A;  1EUV A;  4HJH A;  3TE5 A;  1M3H A;  5AN4 A;  3T4N A;  3CWT A;  1KO9 A;  1N3A A;  1QN6 A;  1AIS A;  2HL8 A;  1KFQ A;  1JFI C;  4IL8 A;  3OSE A;  2PWW A;  2YA3 A;  2HZS A;  2JOI A;  1QTP A;  1P5D X;  1PCZ A;  2HL9 A;  3RSM A;  2NOL A;  1WQA A;  1YQK A;  2FKM X;  1VKL A;  1KYF A;  1N3C A;  3NA5 A;  3OH6 A;  2QRD A;  1RM1 A;  2MZ8 A;  2NWV A;  3CWA A;  2JPI A;  2EHB D;  1N39 A;  3OST A;  3TDH A;  2V92 A;  3HS9 A;  4CFF A;  3CVS A;  2NVM A;  1QN5 A;  1TBP A;  3OGD A;  1UT4 A;  1QNB A;  2JHJ A;  1LWV A;  1M5Q 1;  4PY5 A;  1KYD A;  2IV9 A;  1QN8 A;  2NLV A;  1PZD A;  2IV8 A;  3I0X A;  1NGM A;  5IYD P;  4EAG A;  3ULX A;  1C9B B;  3RPJ A;  1QN7 A;  2D0C A;  3DPT A;  3F10 A;  2YH5 A;  2H5A X;  1WJW A;  3PMG A;  1YTB A;  1QTS A;  1VOL B;  1UT7 A;  4I8O A;  4ROC B;  4EJZ A;  4WX8 A;  2OOY A;  2Z0F A;  1KYU A;  1QN4 A;  1C47 A;  2FKF A;  4WZS D;  3EIK A;  1QNA A;  1UL7 A;  1QN9 A;  1YTF A;  1CDW A;  1TBA B;  2G30 A;  3ENC A;  4C7P A;  3CWS A;  2QRE A;  3D4V A;  3IH7 A;  3KRM A;  3ASM A;  4EJY A;  1QN3 A;  5F9C A;  3CW7 A;  5IYC P;  1LWY A;  2Z8U A;  1KY6 A;  1W80 A;  3UW2 A;  1NH2 A;  1D3U A;  2I5W A;  3EAY A;  4QG5 A;  1MPG A;  1C4G A;  4ROD B;  2FGT A;  1K2Y X;  1JDY A;  3BKQ X;  1TGH A;  1Q9U A;  1XSZ A;  2NOB A;  3CVT A;  1B9K A;  1K35 A;  1PVS A;  5JN5 A;  2HZM A;  2QLV A;  3OSM A;  2NOI A;  2DKC A;  4Q11 A;  2F7L A;  5EPC A;  1V5S A;  3CWU A;  1FN7 A;  1J3M A;  5KL0 A;  3OH9 A;  4D7Q A;  1LXT A;  5IYB P;  3I0W A;  4EAL A;  1KY7 A;  3F0Z A;  2DKD A;  2MJ7 A;  3D7Q A;  1NVP A;  1R4X A;  2DKA A;  2XHI A;  3OLP A;  4D7R A;  2JHN A;  2NOZ A;  3ENO C;  2D0B A;  2Y8L A;  2NOH A;  2Y8Q A;  2NOE A;  5BMP A;  2FUV A;  4B0A A;  1PCM X;  4BJU A;  2O3O A;  5JMV D;  3DPU A;  1LWW A;  4EAK A;  3I3W A;  3PDK A;  1VTO A;  3OC3 C;  1VOK A;  1VTL E;  1QNC A;  1E42 A;  4TPS A;  2QRC A;  1P5G X;  4MRQ A;  2R5X A;  4DUL A;  5BMN A;  4EAI A;  2NOF A;  4WXA A;  2HKP A;  3H1Z A;  1M3Q A;  2VJ0 A;  2LAE A;  1MP9 A;  1T6A A;  3C04 A;  3SNS A;  2QR1 A;  4ROE B;  1HU0 A;  2V8Q A;  1QNE A;  3OCI A;  2D0A A; 
#chains in the Genus database with same CATH homology
 3VN5 A;  1YQR A;  1YQL A;  3HS8 A;  3KTU A;  1YQM A;  3N89 A;  1EBM A;  1M3H A;  5AN4 A;  1KO9 A;  1N3A A;  1QN6 A;  1AIS A;  1JFI C;  2HZS A;  2JOI A;  1QTP A;  1PCZ A;  2NOL A;  1YQK A;  1KYF A;  1N3C A;  1RM1 A;  2MZ8 A;  1N39 A;  3OST A;  3HS9 A;  1QN5 A;  1TBP A;  1UT4 A;  1QNB A;  4PY5 A;  1LWV A;  1KYD A;  2IV9 A;  1QN8 A;  3I0X A;  1PZD A;  2IV8 A;  1NGM A;  5IYD P;  3ULX A;  1C9B B;  3RPJ A;  1QN7 A;  2D0C A;  3DPT A;  3F10 A;  2YH5 A;  1YTB A;  1VOL B;  1QTS A;  1UT7 A;  4I8O A;  4ROC B;  4EJZ A;  1KYU A;  1QN4 A;  4WZS D;  3EIK A;  1QNA A;  1QN9 A;  1YTF A;  1CDW A;  1TBA B;  2G30 A;  3IH7 A;  3KRM A;  3ASM A;  4EJY A;  1QN3 A;  5IYC P;  1LWY A;  2Z8U A;  1KY6 A;  1W80 A;  1NH2 A;  1D3U A;  2I5W A;  4ROD B;  2FGT A;  1TGH A;  2NOB A;  1B9K A;  2HZM A;  3OSM A;  2NOI A;  4Q11 A;  1FN7 A;  5IYB P;  3I0W A;  1KY7 A;  3F0Z A;  2MJ7 A;  1NVP A;  1R4X A;  2XHI A;  2NOZ A;  2D0B A;  2NOH A;  2NOE A;  4B0A A;  1LWW A;  2O3O A;  3DPU A;  1VTO A;  3OC3 C;  1VOK A;  1VTL E;  1QNC A;  1E42 A;  4TPS A;  4DUL A;  2NOF A;  3H1Z A;  1M3Q A;  2VJ0 A;  2LAE A;  1MP9 A;  3SNS A;  1HU0 A;  4ROE B;  1QNE A;  3OCI A;  2D0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...