4ROCB

Human tfiib-related factor 2 (brf2) and tbp bound to u6#2 promoter
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
GPSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IIIB 50 kDa subunit
publication title Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4rocB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4rocB02
2VJ0A 3H1ZA 1JFIC 1C9BB 1QN8A 1QNAA 1KYDA 1PZDA 1KYFA 3VN5A 3OC3C 1QN3A 2IV9A 2G30A 1KYUA 4RODB 3EIKA 3HS9A 1NVPA 1PCZA 1CDWA 1VTLE 1QNBA 1NGMA 1QN9A 1R4XA 2IV8A 2D0AA 3ASMA 1RM1A 1VOLB 4ROEB 1NH2A 2Z8UA 5IYBP 3OCIA 1TBAB 1QN5A 2D0BA 4WZSD 1YTFA 1MP9A 1QTSA 1W80A 1QTPA 1QNCA 1TGHA 1TBPA 4ROCB 1QN7A 4B0AA 1YTBA 1AISA 5IYCP 1KY7A 4PY5A 1VTOA 1QN6A 1KY6A 1E42A 2MJ7A 1QNEA 1B9KA 1QN4A 3HS8A 1VOKA 2D0CA 5IYDP 1D3UA
chains in the Genus database with same CATH superfamily
2VJ0A 2EHBD 3F0ZA 1Q9UA 1P5DX 1QN3A 1KO9A 2G30A 5F9CA 3IH7A 3PMGA 3KTUA 1LWVA 1M5Q1 3EIKA 2HZSA 4WX8A 5BMPA 1YQRA 1QNBA 2HKPA 1R4XA 4WXAA 2JPIA 2LAEA 1J3MA 1C4GA 3I3WA 5HSHA 1RM1A 3UW2A 3PDKA 2DKAA 2OOXA 5JN5A 3TE5A 1T6AA 1W80A 2HZMA 4Q11A 2I5WA 4PY5A 1LWYA 5KL0A 4D7QA 3F10A 4BJUA 1B9KA 1JDYA 3I0WA 3D4VA 3CW7A 5BMNA 4EAJA 1QN4A 1VKLA 1VOKA 1K2YX 2YH5A 1D3UA 1QN8A 1EUVA 5JMVD 2QR1A 4EAKA 1QNAA 2NOLA 2DKCA 3CVSA 2DKDA 2HL9A 3OH9A 2Y8LA 3OSMA 1PCZA 1WJWA 2QLVA 2QREA 2H4LX 4HJHA 3T4NA 3CWAA 1NH2A 1KFIA 2HL8A 5IYBP 1P5GX 1TBAB 3ULXA 2NWVA 4WZSD 1PCJX 2NOEA 1QTSA 1TGHA 1QTPA 3EAYA 4TPSA 4ROCB 4B0AA 5IYCP 2Z0FA 3OSEA 2V9JA 1KY6A 1QNEA 1XSZA 4I8OA 3OSTA 3OGDA 2NVMA 2D0CA 3CWTA 3H1ZA 1C9BB 1LWWA 2XHIA 3I0XA 1KYDA 1N3AA 3VN5A 4DULA 3OC3C 2QRCA 2NOHA 3RSMA 2IV9A 2V92A 3DPUA 3SNSA 2NLVA 1KYUA 4EALA 3ENCA 4RODB 3HS9A 2FGTA 3OH6A 1NVPA 1CDWA 2FUVA 1NGMA 1WQAA 2R5XA 3TDHA 2D0AA 3RPJA 4CFFA 1LXTA 2ZFDB 5AN4A 2QRDA 2Z8UA 3OCIA 1QN5A 2NOZA 2D0BA 1YQKA 5EPCA 1YTFA 1MP9A 1PCMX 4IL8A 4EJZA 1N39A 1TBPA 1UT7A 3DPTA 4EAIA 1AISA 1KY7A 1DIZA 1FN7A 1E42A 4D7RA 2NOIA 1YQMA 1KFQA 1TUOA 5IYDP 3C04A 1JFIC 3CWSA 3OLPA 1PZDA 1KYFA 3ENOC 4EAGA 2JHJA 2H5AX 3BKQX 1M3QA 2NOFA 3KRMA 3CVTA 2JHNA 4EJYA 2YA3A 1EBMA 1VTLE 3D7QA 4QG5A 1M3HA 1QN9A 1UT4A 2IV8A 3CWUA 3ASMA 3N89A 4MRQA 1N3CA 1HU0A 1VOLB 2JOIA 4ROEB 1PVSA 2Y8QA 2FKFA 2PWWA 2F7LA 2V8QA 1QNCA 2MZ8A 1YQLA 2O3OA 1QN7A 1YTBA 1MPGA 4C7PA 1VTOA 1QN6A 1K35A 2MJ7A 2OOYA 1C47A 1UL7A 1V5SA 2FKMX 2NOBA 3HS8A 3NA5A
chains in the Genus database with same CATH topology
2VJ0A 3F0ZA 1QN3A 1KO9A 2G30A 3IH7A 3KTUA 1LWVA 3EIKA 2HZSA 1YQRA 1QNBA 1R4XA 2LAEA 1RM1A 1W80A 2HZMA 4Q11A 2I5WA 4PY5A 1LWYA 3F10A 1B9KA 3I0WA 1QN4A 1VOKA 2YH5A 1D3UA 1QN8A 2NOLA 1QNAA 3OSMA 1PCZA 1NH2A 5IYBP 1TBAB 3ULXA 4WZSD 2NOEA 1QTSA 1TGHA 1QTPA 4ROCB 4TPSA 4B0AA 5IYCP 1KY6A 1QNEA 4I8OA 3OSTA 2D0CA 3H1ZA 1C9BB 1LWWA 2XHIA 3I0XA 1KYDA 1N3AA 3VN5A 4DULA 3OC3C 2NOHA 2IV9A 3DPUA 3SNSA 1KYUA 4RODB 1NVPA 3HS9A 2FGTA 1CDWA 1NGMA 2D0AA 3RPJA 5AN4A 2Z8UA 3OCIA 1QN5A 2NOZA 2D0BA 1YQKA 1YTFA 1MP9A 4EJZA 1N39A 1TBPA 1UT7A 3DPTA 1AISA 1KY7A 1FN7A 1E42A 2NOIA 1YQMA 5IYDP 1JFIC 1PZDA 1KYFA 1M3QA 2NOFA 3KRMA 4EJYA 1EBMA 1VTLE 1M3HA 1QN9A 1UT4A 2IV8A 3ASMA 3N89A 1N3CA 1HU0A 1VOLB 2JOIA 4ROEB 1QNCA 2MZ8A 1YQLA 2O3OA 1QN7A 1YTBA 1VTOA 1QN6A 2MJ7A 2NOBA 3HS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJ0 A;  3H1Z A;  1JFI C;  1C9B B;  1QN8 A;  1QNA A;  1KYD A;  1PZD A;  1KYF A;  3VN5 A;  3OC3 C;  1QN3 A;  2IV9 A;  2G30 A;  1KYU A;  4ROD B;  3EIK A;  3HS9 A;  1NVP A;  1PCZ A;  1CDW A;  1VTL E;  1QNB A;  1NGM A;  1QN9 A;  1R4X A;  2IV8 A;  2D0A A;  3ASM A;  1RM1 A;  1VOL B;  4ROE B;  1NH2 A;  2Z8U A;  5IYB P;  3OCI A;  1TBA B;  1QN5 A;  2D0B A;  4WZS D;  1YTF A;  1MP9 A;  1QTS A;  1W80 A;  1QTP A;  1QNC A;  1TGH A;  1TBP A;  4ROC B;  1QN7 A;  4B0A A;  1YTB A;  1AIS A;  5IYC P;  1KY7 A;  4PY5 A;  1VTO A;  1QN6 A;  1KY6 A;  1E42 A;  2MJ7 A;  1QNE A;  1B9K A;  1QN4 A;  3HS8 A;  1VOK A;  2D0C A;  5IYD P;  1D3U A; 
#chains in the Genus database with same CATH topology
 2VJ0 A;  2EHB D;  3F0Z A;  1Q9U A;  1P5D X;  1QN3 A;  1KO9 A;  2G30 A;  5F9C A;  3IH7 A;  3PMG A;  3KTU A;  1LWV A;  1M5Q 1;  3EIK A;  2HZS A;  4WX8 A;  5BMP A;  1YQR A;  1QNB A;  2HKP A;  1R4X A;  4WXA A;  2JPI A;  2LAE A;  1J3M A;  1C4G A;  3I3W A;  5HSH A;  1RM1 A;  3UW2 A;  3PDK A;  2DKA A;  2OOX A;  5JN5 A;  3TE5 A;  1T6A A;  1W80 A;  2HZM A;  4Q11 A;  2I5W A;  4PY5 A;  1LWY A;  5KL0 A;  4D7Q A;  3F10 A;  4BJU A;  1B9K A;  1JDY A;  3I0W A;  3D4V A;  3CW7 A;  5BMN A;  4EAJ A;  1QN4 A;  1VKL A;  1VOK A;  1K2Y X;  2YH5 A;  1D3U A;  1QN8 A;  1EUV A;  5JMV D;  2QR1 A;  4EAK A;  1QNA A;  2NOL A;  2DKC A;  3CVS A;  2DKD A;  2HL9 A;  3OH9 A;  2Y8L A;  3OSM A;  1PCZ A;  1WJW A;  2QLV A;  2QRE A;  2H4L X;  4HJH A;  3T4N A;  3CWA A;  1NH2 A;  1KFI A;  2HL8 A;  5IYB P;  1P5G X;  1TBA B;  3ULX A;  2NWV A;  4WZS D;  1PCJ X;  2NOE A;  1QTS A;  1TGH A;  1QTP A;  3EAY A;  4TPS A;  4ROC B;  4B0A A;  5IYC P;  2Z0F A;  3OSE A;  2V9J A;  1KY6 A;  1QNE A;  1XSZ A;  4I8O A;  3OST A;  3OGD A;  2NVM A;  2D0C A;  3CWT A;  3H1Z A;  1C9B B;  1LWW A;  2XHI A;  3I0X A;  1KYD A;  1N3A A;  3VN5 A;  4DUL A;  3OC3 C;  2QRC A;  2NOH A;  3RSM A;  2IV9 A;  2V92 A;  3DPU A;  3SNS A;  2NLV A;  1KYU A;  4EAL A;  3ENC A;  4ROD B;  3HS9 A;  2FGT A;  3OH6 A;  1NVP A;  1CDW A;  2FUV A;  1NGM A;  1WQA A;  2R5X A;  3TDH A;  2D0A A;  3RPJ A;  4CFF A;  1LXT A;  2ZFD B;  5AN4 A;  2QRD A;  2Z8U A;  3OCI A;  1QN5 A;  2NOZ A;  2D0B A;  1YQK A;  5EPC A;  1YTF A;  1MP9 A;  1PCM X;  4IL8 A;  4EJZ A;  1N39 A;  1TBP A;  1UT7 A;  3DPT A;  4EAI A;  1AIS A;  1KY7 A;  1DIZ A;  1FN7 A;  1E42 A;  4D7R A;  2NOI A;  1YQM A;  1KFQ A;  1TUO A;  5IYD P;  3C04 A;  1JFI C;  3CWS A;  3OLP A;  1PZD A;  1KYF A;  3ENO C;  4EAG A;  2JHJ A;  2H5A X;  3BKQ X;  1M3Q A;  2NOF A;  3KRM A;  3CVT A;  2JHN A;  4EJY A;  2YA3 A;  1EBM A;  1VTL E;  3D7Q A;  4QG5 A;  1M3H A;  1QN9 A;  1UT4 A;  2IV8 A;  3CWU A;  3ASM A;  3N89 A;  4MRQ A;  1N3C A;  1HU0 A;  1VOL B;  2JOI A;  4ROE B;  1PVS A;  2Y8Q A;  2FKF A;  2PWW A;  2F7L A;  2V8Q A;  1QNC A;  2MZ8 A;  1YQL A;  2O3O A;  1QN7 A;  1YTB A;  1MPG A;  4C7P A;  1VTO A;  1QN6 A;  1K35 A;  2MJ7 A;  2OOY A;  1C47 A;  1UL7 A;  1V5S A;  2FKM X;  2NOB A;  3HS8 A;  3NA5 A; 
#chains in the Genus database with same CATH homology
 2VJ0 A;  3F0Z A;  1QN3 A;  1KO9 A;  2G30 A;  3IH7 A;  3KTU A;  1LWV A;  3EIK A;  2HZS A;  1YQR A;  1QNB A;  1R4X A;  2LAE A;  1RM1 A;  1W80 A;  2HZM A;  4Q11 A;  2I5W A;  4PY5 A;  1LWY A;  3F10 A;  1B9K A;  3I0W A;  1QN4 A;  1VOK A;  2YH5 A;  1D3U A;  1QN8 A;  2NOL A;  1QNA A;  3OSM A;  1PCZ A;  1NH2 A;  5IYB P;  1TBA B;  3ULX A;  4WZS D;  2NOE A;  1QTS A;  1TGH A;  1QTP A;  4ROC B;  4TPS A;  4B0A A;  5IYC P;  1KY6 A;  1QNE A;  4I8O A;  3OST A;  2D0C A;  3H1Z A;  1C9B B;  1LWW A;  2XHI A;  3I0X A;  1KYD A;  1N3A A;  3VN5 A;  4DUL A;  3OC3 C;  2NOH A;  2IV9 A;  3DPU A;  3SNS A;  1KYU A;  4ROD B;  1NVP A;  3HS9 A;  2FGT A;  1CDW A;  1NGM A;  2D0A A;  3RPJ A;  5AN4 A;  2Z8U A;  3OCI A;  1QN5 A;  2NOZ A;  2D0B A;  1YQK A;  1YTF A;  1MP9 A;  4EJZ A;  1N39 A;  1TBP A;  1UT7 A;  3DPT A;  1AIS A;  1KY7 A;  1FN7 A;  1E42 A;  2NOI A;  1YQM A;  5IYD P;  1JFI C;  1PZD A;  1KYF A;  1M3Q A;  2NOF A;  3KRM A;  4EJY A;  1EBM A;  1VTL E;  1M3H A;  1QN9 A;  1UT4 A;  2IV8 A;  3ASM A;  3N89 A;  1N3C A;  1HU0 A;  1VOL B;  2JOI A;  4ROE B;  1QNC A;  2MZ8 A;  1YQL A;  2O3O A;  1QN7 A;  1YTB A;  1VTO A;  1QN6 A;  2MJ7 A;  2NOB A;  3HS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...