3ENOC

Crystal structure of pyrococcus furiosus pcc1 in complex with thermoplasma acidophilum kae1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
RVQAKIEMEFPSEDVAKVVYEAVLYEHLSVPYRRSEIDFKLEGKKIILDIKATDSSALRGTVNSYLRWIKAAIDVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/unknown function
molecule keywords Putative O-sialoglycoprotein endopeptidase
publication title Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 23
structure length 77
sequence length 77
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09341 Pcc1 Transcription factor Pcc1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.50 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Alpha-D-phosphohexomutase, C-terminal domain 3enoC00
2DKAA 2H4LX 5KL0A 1PCJX 4QG5A 4HJHA 4IL8A 1JDYA 3NA5A 2FUVA 3C04A 3PDKA 1TUOA 4WXAA 2JPIA 1C4GA 4MRQA 3UW2A 5BMNA 5EPCA 3PMGA 2DKDA 1KFIA 3I3WA 5F9CA 1P5DX 3OLPA 2FKFA 5JMVD 1WJWA 5HSHA 4BJUA 3ENOC 3ENCA 1K2YX 5JN5A 3RSMA 1P5GX 1WQAA 2FKMX 1VKLA 1K35A 1LXTA 2Z0FA 2H5AX 1KFQA 2DKCA 2F7LA 1C47A 4WX8A 3BKQX 1PCMX 5BMPA
chains in the Genus database with same CATH superfamily
4D7QA 2QLVA 2NOBA 4QG5A 1LWVA 3CW7A 4EALA 3IH7A 1NVPA 3NA5A 3OC3C 2JHNA 2LAEA 1KO9A 2IV9A 3CWUA 3HS8A 3UW2A 1M3HA 3I3WA 2OOXA 3OH9A 4EAKA 2Z8UA 3F0ZA 4DULA 2HL9A 2V92A 1WJWA 1EBMA 3ENOC 3I0WA 5AN4A 3ENCA 4EJYA 1YQLA 1N39A 1KYDA 2YA3A 1UL7A 2HKPA 3OSMA 3RSMA 3KTUA 1P5GX 1Q9UA 3ASMA 1VKLA 1M3QA 1LWWA 1K35A 2H5AX 4EAGA 1KFQA 4WZSD 2QRCA 3ULXA 4I8OA 4D7RA 1VTLE 2ZFDB 3BKQX 2NVMA 1YTBA 2H4LX 3CVTA 4C7PA 4HJHA 1N3CA 1QTPA 2NOZA 1MPGA 3H1ZA 1JFIC 1KY6A 3C04A 3PDKA 4Q11A 3OH6A 1J3MA 3CWAA 1KYUA 3PMGA 4EAJA 3DPUA 1FN7A 1YQMA 3OSEA 5F9CA 2V9JA 1P5DX 3OLPA 5JMVD 2R5XA 1E42A 2HZSA 2IV8A 3DPTA 1QN5A 2XHIA 2PWWA 1WQAA 1QTSA 3D4VA 1T6AA 3CWTA 1D3UA 3D7QA 4RODB 1PCMX 5BMPA 3CWSA 1TBAB 1UT7A 1PVSA 2DKAA 3EIKA 1C9BB 1KYFA 2FGTA 1QN6A 2QREA 2QR1A 1HU0A 2NOHA 4WXAA 3VN5A 2MZ8A 3TE5A 5IYCP 1RM1A 4MRQA 3OCIA 5BMNA 5EPCA 3TDHA 2DKDA 1NH2A 2NOIA 1QN4A 1DIZA 2G30A 2EHBD 1PZDA 4PY5A 5IYDP 1QNAA 1TGHA 1EUVA 3F10A 2NOLA 2FKMX 1LXTA 2MJ7A 2Z0FA 3EAYA 2F7LA 4B0AA 2NWVA 2HZMA 1QN8A 1KFIA 3RPJA 3I0XA 1R4XA 3CVSA 1W80A 5KL0A 1QN9A 1PCJX 1KY7A 5IYBP 2D0AA 4IL8A 2NOEA 1TBPA 1JDYA 2Y8LA 2HL8A 2JOIA 2FUVA 1M5Q1 2YH5A 1TUOA 1YTFA 2JPIA 1C4GA 1N3AA 2O3OA 3OSTA 2I5WA 2D0CA 3KRMA 1MP9A 1PCZA 4EAIA 3SNSA 1VOLB 1NGMA 2JHJA 2D0BA 1AISA 1QNCA 4ROCB 3T4NA 2FKFA 2NOFA 1LWYA 5HSHA 1YQRA 4BJUA 4EJZA 1CDWA 1VTOA 1YQKA 3HS9A 1K2YX 1QN3A 5JN5A 1VOKA 4ROEB 2Y8QA 1V5SA 1QNBA 1UT4A 2V8QA 2DKCA 1QN7A 2VJ0A 3N89A 4TPSA 2QRDA 4CFFA 1C47A 1QNEA 2NLVA 4WX8A 3OGDA 2OOYA 1XSZA 1B9KA
chains in the Genus database with same CATH topology
2DKAA 2H4LX 5KL0A 1PCJX 4QG5A 4HJHA 4IL8A 1JDYA 3NA5A 2FUVA 3C04A 3PDKA 1TUOA 4WXAA 2JPIA 1C4GA 4MRQA 3UW2A 5BMNA 5EPCA 3PMGA 2DKDA 1KFIA 3I3WA 5F9CA 1P5DX 3OLPA 2FKFA 5JMVD 1WJWA 5HSHA 4BJUA 3ENOC 3ENCA 1K2YX 5JN5A 3RSMA 1P5GX 1WQAA 2FKMX 1VKLA 1K35A 1LXTA 2Z0FA 2H5AX 1KFQA 2DKCA 2F7LA 1C47A 4WX8A 3BKQX 1PCMX 5BMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKA A;  2H4L X;  5KL0 A;  1PCJ X;  4QG5 A;  4HJH A;  4IL8 A;  1JDY A;  3NA5 A;  2FUV A;  3C04 A;  3PDK A;  1TUO A;  4WXA A;  2JPI A;  1C4G A;  4MRQ A;  3UW2 A;  5BMN A;  5EPC A;  3PMG A;  2DKD A;  1KFI A;  3I3W A;  5F9C A;  1P5D X;  3OLP A;  2FKF A;  5JMV D;  1WJW A;  5HSH A;  4BJU A;  3ENO C;  3ENC A;  1K2Y X;  5JN5 A;  3RSM A;  1P5G X;  1WQA A;  2FKM X;  1VKL A;  1K35 A;  1LXT A;  2Z0F A;  2H5A X;  1KFQ A;  2DKC A;  2F7L A;  1C47 A;  4WX8 A;  3BKQ X;  1PCM X;  5BMP A; 
#chains in the Genus database with same CATH topology
 4D7Q A;  2QLV A;  2NOB A;  4QG5 A;  1LWV A;  3CW7 A;  4EAL A;  3IH7 A;  1NVP A;  3NA5 A;  3OC3 C;  2JHN A;  2LAE A;  1KO9 A;  2IV9 A;  3CWU A;  3HS8 A;  3UW2 A;  1M3H A;  3I3W A;  2OOX A;  3OH9 A;  4EAK A;  2Z8U A;  3F0Z A;  4DUL A;  2HL9 A;  2V92 A;  1WJW A;  1EBM A;  3ENO C;  3I0W A;  5AN4 A;  3ENC A;  4EJY A;  1YQL A;  1N39 A;  1KYD A;  2YA3 A;  1UL7 A;  2HKP A;  3OSM A;  3RSM A;  3KTU A;  1P5G X;  1Q9U A;  3ASM A;  1VKL A;  1M3Q A;  1LWW A;  1K35 A;  2H5A X;  4EAG A;  1KFQ A;  4WZS D;  2QRC A;  3ULX A;  4I8O A;  4D7R A;  1VTL E;  2ZFD B;  3BKQ X;  2NVM A;  1YTB A;  2H4L X;  3CVT A;  4C7P A;  4HJH A;  1N3C A;  1QTP A;  2NOZ A;  1MPG A;  3H1Z A;  1JFI C;  1KY6 A;  3C04 A;  3PDK A;  4Q11 A;  3OH6 A;  1J3M A;  3CWA A;  1KYU A;  3PMG A;  4EAJ A;  3DPU A;  1FN7 A;  1YQM A;  3OSE A;  5F9C A;  2V9J A;  1P5D X;  3OLP A;  5JMV D;  2R5X A;  1E42 A;  2HZS A;  2IV8 A;  3DPT A;  1QN5 A;  2XHI A;  2PWW A;  1WQA A;  1QTS A;  3D4V A;  1T6A A;  3CWT A;  1D3U A;  3D7Q A;  4ROD B;  1PCM X;  5BMP A;  3CWS A;  1TBA B;  1UT7 A;  1PVS A;  2DKA A;  3EIK A;  1C9B B;  1KYF A;  2FGT A;  1QN6 A;  2QRE A;  2QR1 A;  1HU0 A;  2NOH A;  4WXA A;  3VN5 A;  2MZ8 A;  3TE5 A;  5IYC P;  1RM1 A;  4MRQ A;  3OCI A;  5BMN A;  5EPC A;  3TDH A;  2DKD A;  1NH2 A;  2NOI A;  1QN4 A;  1DIZ A;  2G30 A;  2EHB D;  1PZD A;  4PY5 A;  5IYD P;  1QNA A;  1TGH A;  1EUV A;  3F10 A;  2NOL A;  2FKM X;  1LXT A;  2MJ7 A;  2Z0F A;  3EAY A;  2F7L A;  4B0A A;  2NWV A;  2HZM A;  1QN8 A;  1KFI A;  3RPJ A;  3I0X A;  1R4X A;  3CVS A;  1W80 A;  5KL0 A;  1QN9 A;  1PCJ X;  1KY7 A;  5IYB P;  2D0A A;  4IL8 A;  2NOE A;  1TBP A;  1JDY A;  2Y8L A;  2HL8 A;  2JOI A;  2FUV A;  1M5Q 1;  2YH5 A;  1TUO A;  1YTF A;  2JPI A;  1C4G A;  1N3A A;  2O3O A;  3OST A;  2I5W A;  2D0C A;  3KRM A;  1MP9 A;  1PCZ A;  4EAI A;  3SNS A;  1VOL B;  1NGM A;  2JHJ A;  2D0B A;  1AIS A;  1QNC A;  4ROC B;  3T4N A;  2FKF A;  2NOF A;  1LWY A;  5HSH A;  1YQR A;  4BJU A;  4EJZ A;  1CDW A;  1VTO A;  1YQK A;  3HS9 A;  1K2Y X;  1QN3 A;  5JN5 A;  1VOK A;  4ROE B;  2Y8Q A;  1V5S A;  1QNB A;  1UT4 A;  2V8Q A;  2DKC A;  1QN7 A;  2VJ0 A;  3N89 A;  4TPS A;  2QRD A;  4CFF A;  1C47 A;  1QNE A;  2NLV A;  4WX8 A;  3OGD A;  2OOY A;  1XSZ A;  1B9K A; 
#chains in the Genus database with same CATH homology
 2DKA A;  2H4L X;  5KL0 A;  1PCJ X;  4QG5 A;  4HJH A;  4IL8 A;  1JDY A;  3NA5 A;  2FUV A;  3C04 A;  3PDK A;  1TUO A;  4WXA A;  2JPI A;  1C4G A;  4MRQ A;  3UW2 A;  5BMN A;  5EPC A;  3PMG A;  2DKD A;  1KFI A;  3I3W A;  5F9C A;  1P5D X;  3OLP A;  2FKF A;  5JMV D;  1WJW A;  5HSH A;  4BJU A;  3ENO C;  3ENC A;  1K2Y X;  5JN5 A;  3RSM A;  1P5G X;  1WQA A;  2FKM X;  1VKL A;  1K35 A;  1LXT A;  2Z0F A;  2H5A X;  1KFQ A;  2DKC A;  2F7L A;  1C47 A;  4WX8 A;  3BKQ X;  1PCM X;  5BMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...