4DULA

Anac019 nac domain crystal form iv
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
162
structure length
139
Chain Sequence
GIQETDPLTQLSLPPGFRFYPTDEELMVQYLCRKAAGYDLQLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPNRVAGSGYWKATGTDKIISTEGQRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPDWVLCRIYKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NAC domain-containing protein 19
publication title DNA binding by the plant-specific NAC transcription factors in crystal and solution: a firm link to WRKY and GCM transcription factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 25
structure length 139
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02365 NAM No apical meristem (NAM) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.150 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4dulA01
1UT7A 4DULA 3ULXA 1UT4A
chains in the Genus database with same CATH superfamily
3IH7A 2NOZA 4BJUA 2NLVA 4EAIA 1VOKA 4WX8A 1V5SA 5BMPA 3I0XA 3NA5A 1KFIA 1WJWA 1E42A 3CVSA 5IYDP 2JOIA 2NOFA 2NOIA 1QTPA 2DKAA 2FKMX 1B9KA 3DPTA 1FN7A 1MPGA 1N3AA 3D7QA 4EJYA 1C47A 2FUVA 1LWVA 2HL9A 1M3HA 1HU0A 1N39A 2Y8LA 2MZ8A 1JFIC 2QR1A 4D7QA 2DKDA 1YQRA 1QTSA 3OH6A 5IYCP 2NOLA 3ENOC 1QN7A 1KFQA 1UL7A 1UT4A 2G30A 1NGMA 1LWYA 1YQKA 2LAEA 2FKFA 1PVSA 2YH5A 3OSEA 3CWUA 2QLVA 2OOXA 3RPJA 2XHIA 4Q11A 3VN5A 2HL8A 1PCJX 4EAGA 1KY7A 3SNSA 1QN3A 1TGHA 1VOLB 1C4GA 2JHJA 1QN4A 1VTOA 2QREA 2Z8UA 2NOBA 5BMNA 4EALA 3H1ZA 1KYUA 1YQMA 3D4VA 3F0ZA 2FGTA 2Z0FA 1DIZA 4HJHA 1YTBA 2EHBD 2YA3A 4WXAA 3T4NA 1AISA 4TPSA 2QRDA 1TBPA 5KL0A 1M5Q1 3UW2A 4D7RA 4ROCB 4EAJA 2D0BA 1JDYA 3BKQX 1NVPA 1R4XA 3ENCA 1M3QA 2DKCA 3PMGA 4QG5A 2VJ0A 3RSMA 1QN5A 1WQAA 2MJ7A 3PDKA 2IV9A 1K35A 5AN4A 2F7LA 3KTUA 2Y8QA 3EAYA 1KYFA 1QN9A 2V8QA 1MP9A 1QN6A 2PWWA 4I8OA 1J3MA 2JHNA 2O3OA 3F10A 4IL8A 5JN5A 1KYDA 1EUVA 3C04A 3HS9A 4RODB 1QNEA 1T6AA 3DPUA 1UT7A 1QNBA 5IYBP 1CDWA 1EBMA 3CWSA 3HS8A 2V92A 3OH9A 1XSZA 3OSTA 1YQLA 5JMVD 2NOHA 5HSHA 2QRCA 1N3CA 1KO9A 3CVTA 3ULXA 4WZSD 4MRQA 2I5WA 2JPIA 2NVMA 1PCZA 4CFFA 4ROEB 3OC3C 1QNAA 1PZDA 2H5AX 2H4LX 2HZMA 2HKPA 2OOYA 1VTLE 3I3WA 3ASMA 1RM1A 1NH2A 1C9BB 1Q9UA 3OSMA 4DULA 3TE5A 4C7PA 3OLPA 2D0AA 1D3UA 3CWTA 1KY6A 2R5XA 4EJZA 1P5DX 2ZFDB 4B0AA 1YTFA 5EPCA 1LXTA 1TBAB 2D0CA 2HZSA 3OGDA 2V9JA 3CWAA 3KRMA 1QN8A 4PY5A 2NWVA 4EAKA 1K2YX 1TUOA 1LWWA 3CW7A 2NOEA 1W80A 1PCMX 2IV8A 3EIKA 3N89A 5F9CA 1VKLA 3I0WA 1P5GX 3TDHA 3OCIA 1QNCA
chains in the Genus database with same CATH topology
3IH7A 2NOZA 1VOKA 3I0XA 1E42A 5IYDP 2JOIA 2NOFA 2NOIA 1QTPA 1B9KA 3DPTA 1FN7A 1N3AA 4EJYA 1LWVA 1M3HA 1HU0A 1N39A 2MZ8A 1JFIC 1YQRA 1QTSA 2NOLA 5IYCP 1QN7A 1UT4A 2G30A 1NGMA 1LWYA 1YQKA 2LAEA 2YH5A 3RPJA 2XHIA 4Q11A 3VN5A 1KY7A 3SNSA 1QN3A 1TGHA 1VOLB 1QN4A 1VTOA 2Z8UA 2NOBA 3H1ZA 1KYUA 1YQMA 3F0ZA 2FGTA 1YTBA 1AISA 4TPSA 1TBPA 4ROCB 2D0BA 1NVPA 1R4XA 1M3QA 2VJ0A 1QN5A 2MJ7A 2IV9A 5AN4A 3KTUA 1KYFA 1QN9A 1QN6A 1MP9A 4I8OA 2O3OA 3F10A 1KYDA 3HS9A 4RODB 1QNEA 3DPUA 1UT7A 1QNBA 5IYBP 1CDWA 1EBMA 3HS8A 3OSTA 1YQLA 2NOHA 1N3CA 1KO9A 3ULXA 4WZSD 2I5WA 1PCZA 4ROEB 3OC3C 1QNAA 1PZDA 2HZMA 1VTLE 3ASMA 1RM1A 1NH2A 1C9BB 4DULA 3OSMA 2D0AA 1D3UA 1KY6A 4EJZA 4B0AA 1YTFA 1TBAB 4PY5A 2D0CA 2HZSA 3KRMA 1QN8A 1LWWA 2NOEA 1W80A 2IV8A 3I0WA 3EIKA 3N89A 3OCIA 1QNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UT7 A;  4DUL A;  3ULX A;  1UT4 A; 
#chains in the Genus database with same CATH topology
 3IH7 A;  2NOZ A;  4BJU A;  2NLV A;  4EAI A;  1VOK A;  4WX8 A;  1V5S A;  5BMP A;  3I0X A;  3NA5 A;  1KFI A;  1WJW A;  1E42 A;  3CVS A;  5IYD P;  2JOI A;  2NOF A;  2NOI A;  1QTP A;  2DKA A;  2FKM X;  1B9K A;  3DPT A;  1FN7 A;  1MPG A;  1N3A A;  3D7Q A;  4EJY A;  1C47 A;  2FUV A;  1LWV A;  2HL9 A;  1M3H A;  1HU0 A;  1N39 A;  2Y8L A;  2MZ8 A;  1JFI C;  2QR1 A;  4D7Q A;  2DKD A;  1YQR A;  1QTS A;  3OH6 A;  5IYC P;  2NOL A;  3ENO C;  1QN7 A;  1KFQ A;  1UL7 A;  1UT4 A;  2G30 A;  1NGM A;  1LWY A;  1YQK A;  2LAE A;  2FKF A;  1PVS A;  2YH5 A;  3OSE A;  3CWU A;  2QLV A;  2OOX A;  3RPJ A;  2XHI A;  4Q11 A;  3VN5 A;  2HL8 A;  1PCJ X;  4EAG A;  1KY7 A;  3SNS A;  1QN3 A;  1TGH A;  1VOL B;  1C4G A;  2JHJ A;  1QN4 A;  1VTO A;  2QRE A;  2Z8U A;  2NOB A;  5BMN A;  4EAL A;  3H1Z A;  1KYU A;  1YQM A;  3D4V A;  3F0Z A;  2FGT A;  2Z0F A;  1DIZ A;  4HJH A;  1YTB A;  2EHB D;  2YA3 A;  4WXA A;  3T4N A;  1AIS A;  4TPS A;  2QRD A;  1TBP A;  5KL0 A;  1M5Q 1;  3UW2 A;  4D7R A;  4ROC B;  4EAJ A;  2D0B A;  1JDY A;  3BKQ X;  1NVP A;  1R4X A;  3ENC A;  1M3Q A;  2DKC A;  3PMG A;  4QG5 A;  2VJ0 A;  3RSM A;  1QN5 A;  1WQA A;  2MJ7 A;  3PDK A;  2IV9 A;  1K35 A;  5AN4 A;  2F7L A;  3KTU A;  2Y8Q A;  3EAY A;  1KYF A;  1QN9 A;  2V8Q A;  1MP9 A;  1QN6 A;  2PWW A;  4I8O A;  1J3M A;  2JHN A;  2O3O A;  3F10 A;  4IL8 A;  5JN5 A;  1KYD A;  1EUV A;  3C04 A;  3HS9 A;  4ROD B;  1QNE A;  1T6A A;  3DPU A;  1UT7 A;  1QNB A;  5IYB P;  1CDW A;  1EBM A;  3CWS A;  3HS8 A;  2V92 A;  3OH9 A;  1XSZ A;  3OST A;  1YQL A;  5JMV D;  2NOH A;  5HSH A;  2QRC A;  1N3C A;  1KO9 A;  3CVT A;  3ULX A;  4WZS D;  4MRQ A;  2I5W A;  2JPI A;  2NVM A;  1PCZ A;  4CFF A;  4ROE B;  3OC3 C;  1QNA A;  1PZD A;  2H5A X;  2H4L X;  2HZM A;  2HKP A;  2OOY A;  1VTL E;  3I3W A;  3ASM A;  1RM1 A;  1NH2 A;  1C9B B;  1Q9U A;  3OSM A;  4DUL A;  3TE5 A;  4C7P A;  3OLP A;  2D0A A;  1D3U A;  3CWT A;  1KY6 A;  2R5X A;  4EJZ A;  1P5D X;  2ZFD B;  4B0A A;  1YTF A;  5EPC A;  1LXT A;  1TBA B;  2D0C A;  2HZS A;  3OGD A;  2V9J A;  3CWA A;  3KRM A;  1QN8 A;  4PY5 A;  2NWV A;  4EAK A;  1K2Y X;  1TUO A;  1LWW A;  3CW7 A;  2NOE A;  1W80 A;  1PCM X;  2IV8 A;  3EIK A;  3N89 A;  5F9C A;  1VKL A;  3I0W A;  1P5G X;  3TDH A;  3OCI A;  1QNC A; 
#chains in the Genus database with same CATH homology
 3IH7 A;  2NOZ A;  1VOK A;  3I0X A;  1E42 A;  5IYD P;  2JOI A;  2NOF A;  2NOI A;  1QTP A;  1B9K A;  3DPT A;  1FN7 A;  1N3A A;  4EJY A;  1LWV A;  1M3H A;  1HU0 A;  1N39 A;  2MZ8 A;  1JFI C;  1YQR A;  1QTS A;  2NOL A;  5IYC P;  1QN7 A;  1UT4 A;  2G30 A;  1NGM A;  1LWY A;  1YQK A;  2LAE A;  2YH5 A;  3RPJ A;  2XHI A;  4Q11 A;  3VN5 A;  1KY7 A;  3SNS A;  1QN3 A;  1TGH A;  1VOL B;  1QN4 A;  1VTO A;  2Z8U A;  2NOB A;  3H1Z A;  1KYU A;  1YQM A;  3F0Z A;  2FGT A;  1YTB A;  1AIS A;  4TPS A;  1TBP A;  4ROC B;  2D0B A;  1NVP A;  1R4X A;  1M3Q A;  2VJ0 A;  1QN5 A;  2MJ7 A;  2IV9 A;  5AN4 A;  3KTU A;  1KYF A;  1QN9 A;  1QN6 A;  1MP9 A;  4I8O A;  2O3O A;  3F10 A;  1KYD A;  3HS9 A;  4ROD B;  1QNE A;  3DPU A;  1UT7 A;  1QNB A;  5IYB P;  1CDW A;  1EBM A;  3HS8 A;  3OST A;  1YQL A;  2NOH A;  1N3C A;  1KO9 A;  3ULX A;  4WZS D;  2I5W A;  1PCZ A;  4ROE B;  3OC3 C;  1QNA A;  1PZD A;  2HZM A;  1VTL E;  3ASM A;  1RM1 A;  1NH2 A;  1C9B B;  4DUL A;  3OSM A;  2D0A A;  1D3U A;  1KY6 A;  4EJZ A;  4B0A A;  1YTF A;  1TBA B;  4PY5 A;  2D0C A;  2HZS A;  3KRM A;  1QN8 A;  1LWW A;  2NOE A;  1W80 A;  2IV8 A;  3I0W A;  3EIK A;  3N89 A;  3OCI A;  1QNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...