5IYBP

Human core-pic in the open state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
185
structure length
185
Chain Sequence
TPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iybP01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iybP02
1QNEA 1QN6A 2IV8A 1PCZA 1QTPA 5IYDP 1VOKA 3EIKA 2D0AA 2IV9A 3VN5A 1PZDA 1NVPA 1QN5A 1NH2A 1QN7A 1QN3A 1KY6A 1R4XA 1QNAA 1E42A 2Z8UA 4ROCB 1MP9A 1D3UA 4B0AA 2D0CA 1C9BB 4PY5A 1JFIC 1KYUA 1QTSA 1TBAB 1KYFA 1VOLB 2MJ7A 1YTFA 1QN9A 1TGHA 1TBPA 1B9KA 4ROEB 1RM1A 1YTBA 1QNCA 5IYCP 1AISA 1VTLE 1QN4A 1KYDA 3OC3C 3HS8A 2G30A 3ASMA 4WZSD 2D0BA 2VJ0A 1QNBA 1KY7A 3H1ZA 1QN8A 1VTOA 3HS9A 1CDWA 4RODB 3OCIA 5IYBP 1NGMA 1W80A
chains in the Genus database with same CATH superfamily
3C04A 1QN6A 2QRDA 2IV8A 1PCZA 1LWYA 3PMGA 3N89A 1NVPA 2LAEA 3OGDA 1MPGA 1KY6A 2H5AX 4ROCB 3DPTA 3ENCA 1QTSA 4IL8A 3I0WA 1PVSA 4CFFA 3OH6A 4I8OA 1KFIA 3UW2A 2FKMX 1AISA 1HU0A 4DULA 2V92A 3KTUA 1VKLA 2H4LX 2FKFA 1M3HA 4BJUA 1K2YX 4Q11A 2I5WA 1KFQA 3H1ZA 2FUVA 1UT7A 2R5XA 4RODB 4EAJA 1J3MA 2Y8QA 1UT4A 3BKQX 1Q9UA 1QNEA 2NOIA 1TUOA 5IYDP 3VN5A 3EIKA 5KL0A 1YQLA 1FN7A 1QN7A 4D7QA 2HZMA 1QNAA 2Z8UA 1D3UA 3OH9A 1WQAA 5EPCA 3RPJA 2DKAA 2Y8LA 2NOEA 1YQKA 4EAGA 1EUVA 2PWWA 1N3CA 4EAIA 1DIZA 1YTFA 1YTBA 1B9KA 2F7LA 4ROEB 1M5Q1 1QNCA 4EJZA 1KYDA 2DKDA 3EAYA 3ULXA 3HS8A 3ASMA 3IH7A 1QNBA 2Z0FA 1KY7A 3D7QA 2HL9A 3CWAA 2NOZA 2NLVA 3CWSA 3OCIA 1UL7A 1W80A 2NOLA 3CVTA 3F0ZA 1N3AA 1QTPA 4HJHA 1VOKA 4EAKA 2D0AA 2IV9A 5JN5A 3PDKA 1K35A 1PZDA 3CVSA 1NH2A 1QN5A 2NOHA 3I0XA 2XHIA 1R4XA 2JHNA 2MZ8A 2QLVA 1T6AA 3OSTA 1MP9A 4QG5A 4B0AA 3D4VA 2JPIA 1C9BB 1KYUA 2O3OA 1TBAB 2OOXA 2HZSA 1KYFA 2QRCA 1VOLB 2JOIA 4EALA 1P5DX 1M3QA 1QN9A 1TBPA 2V8QA 1RM1A 1YQRA 5F9CA 1QN4A 1P5GX 3OC3C 3RSMA 1LWWA 1WJWA 4D7RA 1LWVA 3DPUA 5AN4A 1XSZA 1PCJX 4TPSA 4C7PA 3OLPA 1VTOA 3I3WA 2JHJA 1C4GA 2NWVA 3SNSA 5IYBP 3F10A 3TDHA 1JDYA 3NA5A 2QR1A 1LXTA 3CW7A 3OSEA 2FGTA 2HKPA 2YA3A 1PCMX 2DKCA 2NVMA 1QN3A 2OOYA 1N39A 1E42A 4PY5A 3CWTA 2V9JA 1EBMA 2D0CA 3OSMA 1JFIC 5BMNA 2NOBA 3KRMA 5BMPA 4MRQA 2MJ7A 1TGHA 5IYCP 2NOFA 3T4NA 1VTLE 4WXAA 1KO9A 4WX8A 3TE5A 5HSHA 2ZFDB 2G30A 4EJYA 4WZSD 2D0BA 2EHBD 2VJ0A 1V5SA 3ENOC 3CWUA 1QN8A 1C47A 3HS9A 2YH5A 5JMVD 1CDWA 2HL8A 1YQMA 1NGMA 2QREA
chains in the Genus database with same CATH topology
1QN6A 2IV8A 1PCZA 1LWYA 3N89A 1NVPA 2LAEA 1KY6A 4ROCB 3DPTA 1QTSA 3I0WA 4I8OA 1AISA 1HU0A 4DULA 3KTUA 1M3HA 2I5WA 4Q11A 3H1ZA 1UT7A 4RODB 1UT4A 1QNEA 2NOIA 5IYDP 3VN5A 3EIKA 1YQLA 1FN7A 1QN7A 2HZMA 1QNAA 2Z8UA 1D3UA 3RPJA 2NOEA 1YQKA 1N3CA 1YTFA 1YTBA 1B9KA 4ROEB 1QNCA 4EJZA 1KYDA 3ULXA 3HS8A 3ASMA 3IH7A 1QNBA 1KY7A 2NOZA 3OCIA 1W80A 2NOLA 3F0ZA 1N3AA 1QTPA 1VOKA 2D0AA 2IV9A 1PZDA 1QN5A 2NOHA 1NH2A 3I0XA 2XHIA 1R4XA 2MZ8A 3OSTA 1MP9A 4B0AA 1C9BB 1KYUA 2O3OA 1TBAB 2HZSA 1KYFA 1VOLB 2JOIA 1M3QA 1QN9A 1TBPA 1RM1A 1YQRA 1QN4A 3OC3C 1LWWA 1LWVA 3DPUA 5AN4A 4TPSA 1VTOA 3SNSA 5IYBP 3F10A 2FGTA 1QN3A 1N39A 1E42A 4PY5A 1EBMA 2D0CA 3OSMA 1JFIC 2NOBA 3KRMA 2MJ7A 1TGHA 5IYCP 2NOFA 1VTLE 1KO9A 2G30A 4EJYA 4WZSD 2D0BA 2VJ0A 1QN8A 3HS9A 2YH5A 1CDWA 1YQMA 1NGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNE A;  1QN6 A;  2IV8 A;  1PCZ A;  1QTP A;  5IYD P;  1VOK A;  3EIK A;  2D0A A;  2IV9 A;  3VN5 A;  1PZD A;  1NVP A;  1QN5 A;  1NH2 A;  1QN7 A;  1QN3 A;  1KY6 A;  1R4X A;  1QNA A;  1E42 A;  2Z8U A;  4ROC B;  1MP9 A;  1D3U A;  4B0A A;  2D0C A;  1C9B B;  4PY5 A;  1JFI C;  1KYU A;  1QTS A;  1TBA B;  1KYF A;  1VOL B;  2MJ7 A;  1YTF A;  1QN9 A;  1TGH A;  1TBP A;  1B9K A;  4ROE B;  1RM1 A;  1YTB A;  1QNC A;  5IYC P;  1AIS A;  1VTL E;  1QN4 A;  1KYD A;  3OC3 C;  3HS8 A;  2G30 A;  3ASM A;  4WZS D;  2D0B A;  2VJ0 A;  1QNB A;  1KY7 A;  3H1Z A;  1QN8 A;  1VTO A;  3HS9 A;  1CDW A;  4ROD B;  3OCI A;  5IYB P;  1NGM A;  1W80 A; 
#chains in the Genus database with same CATH topology
 3C04 A;  1QN6 A;  2QRD A;  2IV8 A;  1PCZ A;  1LWY A;  3PMG A;  3N89 A;  1NVP A;  2LAE A;  3OGD A;  1MPG A;  1KY6 A;  2H5A X;  4ROC B;  3DPT A;  3ENC A;  1QTS A;  4IL8 A;  3I0W A;  1PVS A;  4CFF A;  3OH6 A;  4I8O A;  1KFI A;  3UW2 A;  2FKM X;  1AIS A;  1HU0 A;  4DUL A;  2V92 A;  3KTU A;  1VKL A;  2H4L X;  2FKF A;  1M3H A;  4BJU A;  1K2Y X;  4Q11 A;  2I5W A;  1KFQ A;  3H1Z A;  2FUV A;  1UT7 A;  2R5X A;  4ROD B;  4EAJ A;  1J3M A;  2Y8Q A;  1UT4 A;  3BKQ X;  1Q9U A;  1QNE A;  2NOI A;  1TUO A;  5IYD P;  3VN5 A;  3EIK A;  5KL0 A;  1YQL A;  1FN7 A;  1QN7 A;  4D7Q A;  2HZM A;  1QNA A;  2Z8U A;  1D3U A;  3OH9 A;  1WQA A;  5EPC A;  3RPJ A;  2DKA A;  2Y8L A;  2NOE A;  1YQK A;  4EAG A;  1EUV A;  2PWW A;  1N3C A;  4EAI A;  1DIZ A;  1YTF A;  1YTB A;  1B9K A;  2F7L A;  4ROE B;  1M5Q 1;  1QNC A;  4EJZ A;  1KYD A;  2DKD A;  3EAY A;  3ULX A;  3HS8 A;  3ASM A;  3IH7 A;  1QNB A;  2Z0F A;  1KY7 A;  3D7Q A;  2HL9 A;  3CWA A;  2NOZ A;  2NLV A;  3CWS A;  3OCI A;  1UL7 A;  1W80 A;  2NOL A;  3CVT A;  3F0Z A;  1N3A A;  1QTP A;  4HJH A;  1VOK A;  4EAK A;  2D0A A;  2IV9 A;  5JN5 A;  3PDK A;  1K35 A;  1PZD A;  3CVS A;  1NH2 A;  1QN5 A;  2NOH A;  3I0X A;  2XHI A;  1R4X A;  2JHN A;  2MZ8 A;  2QLV A;  1T6A A;  3OST A;  1MP9 A;  4QG5 A;  4B0A A;  3D4V A;  2JPI A;  1C9B B;  1KYU A;  2O3O A;  1TBA B;  2OOX A;  2HZS A;  1KYF A;  2QRC A;  1VOL B;  2JOI A;  4EAL A;  1P5D X;  1M3Q A;  1QN9 A;  1TBP A;  2V8Q A;  1RM1 A;  1YQR A;  5F9C A;  1QN4 A;  1P5G X;  3OC3 C;  3RSM A;  1LWW A;  1WJW A;  4D7R A;  1LWV A;  3DPU A;  5AN4 A;  1XSZ A;  1PCJ X;  4TPS A;  4C7P A;  3OLP A;  1VTO A;  3I3W A;  2JHJ A;  1C4G A;  2NWV A;  3SNS A;  5IYB P;  3F10 A;  3TDH A;  1JDY A;  3NA5 A;  2QR1 A;  1LXT A;  3CW7 A;  3OSE A;  2FGT A;  2HKP A;  2YA3 A;  1PCM X;  2DKC A;  2NVM A;  1QN3 A;  2OOY A;  1N39 A;  1E42 A;  4PY5 A;  3CWT A;  2V9J A;  1EBM A;  2D0C A;  3OSM A;  1JFI C;  5BMN A;  2NOB A;  3KRM A;  5BMP A;  4MRQ A;  2MJ7 A;  1TGH A;  5IYC P;  2NOF A;  3T4N A;  1VTL E;  4WXA A;  1KO9 A;  4WX8 A;  3TE5 A;  5HSH A;  2ZFD B;  2G30 A;  4EJY A;  4WZS D;  2D0B A;  2EHB D;  2VJ0 A;  1V5S A;  3ENO C;  3CWU A;  1QN8 A;  1C47 A;  3HS9 A;  2YH5 A;  5JMV D;  1CDW A;  2HL8 A;  1YQM A;  1NGM A;  2QRE A; 
#chains in the Genus database with same CATH homology
 1QN6 A;  2IV8 A;  1PCZ A;  1LWY A;  3N89 A;  1NVP A;  2LAE A;  1KY6 A;  4ROC B;  3DPT A;  1QTS A;  3I0W A;  4I8O A;  1AIS A;  1HU0 A;  4DUL A;  3KTU A;  1M3H A;  2I5W A;  4Q11 A;  3H1Z A;  1UT7 A;  4ROD B;  1UT4 A;  1QNE A;  2NOI A;  5IYD P;  3VN5 A;  3EIK A;  1YQL A;  1FN7 A;  1QN7 A;  2HZM A;  1QNA A;  2Z8U A;  1D3U A;  3RPJ A;  2NOE A;  1YQK A;  1N3C A;  1YTF A;  1YTB A;  1B9K A;  4ROE B;  1QNC A;  4EJZ A;  1KYD A;  3ULX A;  3HS8 A;  3ASM A;  3IH7 A;  1QNB A;  1KY7 A;  2NOZ A;  3OCI A;  1W80 A;  2NOL A;  3F0Z A;  1N3A A;  1QTP A;  1VOK A;  2D0A A;  2IV9 A;  1PZD A;  1QN5 A;  2NOH A;  1NH2 A;  3I0X A;  2XHI A;  1R4X A;  2MZ8 A;  3OST A;  1MP9 A;  4B0A A;  1C9B B;  1KYU A;  2O3O A;  1TBA B;  2HZS A;  1KYF A;  1VOL B;  2JOI A;  1M3Q A;  1QN9 A;  1TBP A;  1RM1 A;  1YQR A;  1QN4 A;  3OC3 C;  1LWW A;  1LWV A;  3DPU A;  5AN4 A;  4TPS A;  1VTO A;  3SNS A;  5IYB P;  3F10 A;  2FGT A;  1QN3 A;  1N39 A;  1E42 A;  4PY5 A;  1EBM A;  2D0C A;  3OSM A;  1JFI C;  2NOB A;  3KRM A;  2MJ7 A;  1TGH A;  5IYC P;  2NOF A;  1VTL E;  1KO9 A;  2G30 A;  4EJY A;  4WZS D;  2D0B A;  2VJ0 A;  1QN8 A;  3HS9 A;  2YH5 A;  1CDW A;  1YQM A;  1NGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...