3EIKA

Double stranded dna binding protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
178
Chain Sequence
GIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TATA-box-binding protein
publication title structural studies of ecTBP
rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 39
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3eikA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3eikA02
1NGMA 1C9BB 1KY7A 1D3UA 1QNCA 5IYBP 1KY6A 3EIKA 1PCZA 2MJ7A 3OCIA 2G30A 1W80A 2IV8A 1NH2A 5IYCP 1KYUA 1YTFA 1B9KA 1VTLE 2Z8UA 1QN5A 1KYDA 2D0CA 3HS9A 1QN4A 1MP9A 1QN8A 1PZDA 3VN5A 1JFIC 1TBAB 2IV9A 1QTPA 1AISA 4B0AA 4ROEB 1QN7A 1RM1A 1NVPA 1QTSA 1QNEA 1QN6A 4ROCB 2VJ0A 4WZSD 3HS8A 4PY5A 1TGHA 1QN3A 1TBPA 1QN9A 2D0BA 4RODB 3ASMA 1E42A 1VOKA 3OC3C 1YTBA 1VOLB 1R4XA 1KYFA 1QNAA 1QNBA 3H1ZA 2D0AA 1VTOA 1CDWA 5IYDP
chains in the Genus database with same CATH superfamily
2NOLA 3OSMA 1C9BB 1KY7A 2DKDA 3N89A 1XSZA 1V5SA 3I3WA 2JOIA 3TE5A 3PMGA 1PCZA 2HL8A 1P5GX 2IV8A 1NH2A 1YTFA 3PDKA 2Z0FA 3HS9A 1YQMA 1MP9A 2JHJA 1QN8A 1UL7A 1YQKA 4MRQA 1C47A 3CWUA 3CW7A 1DIZA 4ROCB 1MPGA 1PVSA 2FKMX 5HSHA 3HS8A 3IH7A 3CVSA 3CWSA 4IL8A 3SNSA 5JN5A 1TGHA 4EJYA 3EAYA 1QN3A 2HZSA 1PCMX 2QREA 1QN9A 2ZFDB 4WXAA 4RODB 3OC3C 1VOKA 1N39A 3CVTA 1KYFA 1N3AA 3C04A 1VTOA 2H5AX 5IYDP 3ULXA 3NA5A 3CWTA 1FN7A 1WQAA 4CFFA 1N3CA 2OOXA 1NGMA 2NOIA 4WX8A 1YQRA 1D3UA 2PWWA 4EAKA 4EAJA 2H4LX 2G30A 2O3OA 1HU0A 5IYCP 1KYUA 2R5XA 2Y8LA 2Z8UA 2F7LA 2FUVA 2D0CA 4QG5A 4DULA 3OH9A 2HKPA 3KRMA 3ENCA 3TDHA 2FGTA 2IV9A 1QTPA 1WJWA 1KFIA 4ROEB 1NVPA 4D7RA 1QN6A 2HL9A 4HJHA 1KO9A 1PCJX 3D7QA 2NWVA 2YH5A 3ENOC 2MZ8A 1UT7A 1E42A 2NOZA 1R4XA 2OOYA 1QNBA 3H1ZA 3CWAA 1UT4A 2Y8QA 3OLPA 1VKLA 3BKQX 1Q9UA 5IYBP 1C4GA 1K2YX 1KY6A 1TUOA 2YA3A 3EIKA 2NLVA 3OCIA 3OSTA 3RPJA 5JMVD 4I8OA 1VTLE 1EUVA 1KYDA 1T6AA 2XHIA 1QN4A 4D7QA 1PZDA 1JFIC 2NVMA 3I0XA 3DPUA 4B0AA 1RM1A 4EJZA 2DKAA 2FKFA 1QNEA 1M5Q1 2QLVA 2VJ0A 4WZSD 4PY5A 3T4NA 3DPTA 3OH6A 1EBMA 2NOEA 2QRDA 1LWVA 2D0BA 4C7PA 1YTBA 5KL0A 1VOLB 2V9JA 3OGDA 1JDYA 5BMNA 1CDWA 4Q11A 2EHBD 4EAIA 4BJUA 1P5DX 2HZMA 4EAGA 3F10A 1QNCA 2MJ7A 3KTUA 1LWWA 1W80A 1M3QA 1B9KA 5BMPA 2V92A 2DKCA 2QR1A 5EPCA 1QN5A 2I5WA 5F9CA 3I0WA 2LAEA 3VN5A 1K35A 3F0ZA 1TBAB 2NOHA 3UW2A 4EALA 1AISA 1QN7A 1LXTA 1QTSA 3OSEA 2NOBA 2NOFA 1LWYA 3D4VA 1J3MA 1TBPA 3RSMA 3ASMA 5AN4A 2QRCA 4TPSA 1QNAA 1KFQA 2D0AA 2JHNA 1M3HA 1YQLA 2V8QA 2JPIA
chains in the Genus database with same CATH topology
2NOLA 3OSMA 1C9BB 1KY7A 3N89A 2JOIA 1PCZA 2IV8A 1NH2A 1YTFA 3HS9A 1YQMA 1MP9A 1QN8A 1YQKA 4ROCB 3IH7A 3HS8A 3SNSA 4EJYA 1TGHA 1QN3A 2HZSA 1QN9A 4RODB 3OC3C 1VOKA 1N39A 1KYFA 1N3AA 5IYDP 1VTOA 3ULXA 1FN7A 2NOIA 1N3CA 1NGMA 1YQRA 1D3UA 2G30A 2O3OA 1HU0A 5IYCP 1KYUA 2Z8UA 2D0CA 4DULA 3KRMA 2FGTA 2IV9A 1QTPA 4ROEB 1NVPA 1QN6A 1KO9A 2YH5A 2MZ8A 1UT7A 1E42A 2NOZA 1R4XA 1QNBA 3H1ZA 1UT4A 5IYBP 1KY6A 3EIKA 3RPJA 3OCIA 3OSTA 4I8OA 1VTLE 1KYDA 2XHIA 1QN4A 1PZDA 1JFIC 3I0XA 3DPUA 4B0AA 1RM1A 4EJZA 1QNEA 2VJ0A 4WZSD 4PY5A 3DPTA 1EBMA 2NOEA 1LWVA 2D0BA 1YTBA 1VOLB 1CDWA 4Q11A 2HZMA 3F10A 1QNCA 2MJ7A 3KTUA 1LWWA 1W80A 1M3QA 1B9KA 1QN5A 2I5WA 3I0WA 2LAEA 3VN5A 3F0ZA 1TBAB 2NOHA 1AISA 1QN7A 1QTSA 2NOBA 2NOFA 1LWYA 1TBPA 3ASMA 5AN4A 4TPSA 1QNAA 2D0AA 1M3HA 1YQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM A;  1C9B B;  1KY7 A;  1D3U A;  1QNC A;  5IYB P;  1KY6 A;  3EIK A;  1PCZ A;  2MJ7 A;  3OCI A;  2G30 A;  1W80 A;  2IV8 A;  1NH2 A;  5IYC P;  1KYU A;  1YTF A;  1B9K A;  1VTL E;  2Z8U A;  1QN5 A;  1KYD A;  2D0C A;  3HS9 A;  1QN4 A;  1MP9 A;  1QN8 A;  1PZD A;  3VN5 A;  1JFI C;  1TBA B;  2IV9 A;  1QTP A;  1AIS A;  4B0A A;  4ROE B;  1QN7 A;  1RM1 A;  1NVP A;  1QTS A;  1QNE A;  1QN6 A;  4ROC B;  2VJ0 A;  4WZS D;  3HS8 A;  4PY5 A;  1TGH A;  1QN3 A;  1TBP A;  1QN9 A;  2D0B A;  4ROD B;  3ASM A;  1E42 A;  1VOK A;  3OC3 C;  1YTB A;  1VOL B;  1R4X A;  1KYF A;  1QNA A;  1QNB A;  3H1Z A;  2D0A A;  1VTO A;  1CDW A;  5IYD P; 
#chains in the Genus database with same CATH topology
 2NOL A;  3OSM A;  1C9B B;  1KY7 A;  2DKD A;  3N89 A;  1XSZ A;  1V5S A;  3I3W A;  2JOI A;  3TE5 A;  3PMG A;  1PCZ A;  2HL8 A;  1P5G X;  2IV8 A;  1NH2 A;  1YTF A;  3PDK A;  2Z0F A;  3HS9 A;  1YQM A;  1MP9 A;  2JHJ A;  1QN8 A;  1UL7 A;  1YQK A;  4MRQ A;  1C47 A;  3CWU A;  3CW7 A;  1DIZ A;  4ROC B;  1MPG A;  1PVS A;  2FKM X;  5HSH A;  3HS8 A;  3IH7 A;  3CVS A;  3CWS A;  4IL8 A;  3SNS A;  5JN5 A;  1TGH A;  4EJY A;  3EAY A;  1QN3 A;  2HZS A;  1PCM X;  2QRE A;  1QN9 A;  2ZFD B;  4WXA A;  4ROD B;  3OC3 C;  1VOK A;  1N39 A;  3CVT A;  1KYF A;  1N3A A;  3C04 A;  1VTO A;  2H5A X;  5IYD P;  3ULX A;  3NA5 A;  3CWT A;  1FN7 A;  1WQA A;  4CFF A;  1N3C A;  2OOX A;  1NGM A;  2NOI A;  4WX8 A;  1YQR A;  1D3U A;  2PWW A;  4EAK A;  4EAJ A;  2H4L X;  2G30 A;  2O3O A;  1HU0 A;  5IYC P;  1KYU A;  2R5X A;  2Y8L A;  2Z8U A;  2F7L A;  2FUV A;  2D0C A;  4QG5 A;  4DUL A;  3OH9 A;  2HKP A;  3KRM A;  3ENC A;  3TDH A;  2FGT A;  2IV9 A;  1QTP A;  1WJW A;  1KFI A;  4ROE B;  1NVP A;  4D7R A;  1QN6 A;  2HL9 A;  4HJH A;  1KO9 A;  1PCJ X;  3D7Q A;  2NWV A;  2YH5 A;  3ENO C;  2MZ8 A;  1UT7 A;  1E42 A;  2NOZ A;  1R4X A;  2OOY A;  1QNB A;  3H1Z A;  3CWA A;  1UT4 A;  2Y8Q A;  3OLP A;  1VKL A;  3BKQ X;  1Q9U A;  5IYB P;  1C4G A;  1K2Y X;  1KY6 A;  1TUO A;  2YA3 A;  3EIK A;  2NLV A;  3OCI A;  3OST A;  3RPJ A;  5JMV D;  4I8O A;  1VTL E;  1EUV A;  1KYD A;  1T6A A;  2XHI A;  1QN4 A;  4D7Q A;  1PZD A;  1JFI C;  2NVM A;  3I0X A;  3DPU A;  4B0A A;  1RM1 A;  4EJZ A;  2DKA A;  2FKF A;  1QNE A;  1M5Q 1;  2QLV A;  2VJ0 A;  4WZS D;  4PY5 A;  3T4N A;  3DPT A;  3OH6 A;  1EBM A;  2NOE A;  2QRD A;  1LWV A;  2D0B A;  4C7P A;  1YTB A;  5KL0 A;  1VOL B;  2V9J A;  3OGD A;  1JDY A;  5BMN A;  1CDW A;  4Q11 A;  2EHB D;  4EAI A;  4BJU A;  1P5D X;  2HZM A;  4EAG A;  3F10 A;  1QNC A;  2MJ7 A;  3KTU A;  1LWW A;  1W80 A;  1M3Q A;  1B9K A;  5BMP A;  2V92 A;  2DKC A;  2QR1 A;  5EPC A;  1QN5 A;  2I5W A;  5F9C A;  3I0W A;  2LAE A;  3VN5 A;  1K35 A;  3F0Z A;  1TBA B;  2NOH A;  3UW2 A;  4EAL A;  1AIS A;  1QN7 A;  1LXT A;  1QTS A;  3OSE A;  2NOB A;  2NOF A;  1LWY A;  3D4V A;  1J3M A;  1TBP A;  3RSM A;  3ASM A;  5AN4 A;  2QRC A;  4TPS A;  1QNA A;  1KFQ A;  2D0A A;  2JHN A;  1M3H A;  1YQL A;  2V8Q A;  2JPI A; 
#chains in the Genus database with same CATH homology
 2NOL A;  3OSM A;  1C9B B;  1KY7 A;  3N89 A;  2JOI A;  1PCZ A;  2IV8 A;  1NH2 A;  1YTF A;  3HS9 A;  1YQM A;  1MP9 A;  1QN8 A;  1YQK A;  4ROC B;  3IH7 A;  3HS8 A;  3SNS A;  4EJY A;  1TGH A;  1QN3 A;  2HZS A;  1QN9 A;  4ROD B;  3OC3 C;  1VOK A;  1N39 A;  1KYF A;  1N3A A;  5IYD P;  1VTO A;  3ULX A;  1FN7 A;  2NOI A;  1N3C A;  1NGM A;  1YQR A;  1D3U A;  2G30 A;  2O3O A;  1HU0 A;  5IYC P;  1KYU A;  2Z8U A;  2D0C A;  4DUL A;  3KRM A;  2FGT A;  2IV9 A;  1QTP A;  4ROE B;  1NVP A;  1QN6 A;  1KO9 A;  2YH5 A;  2MZ8 A;  1UT7 A;  1E42 A;  2NOZ A;  1R4X A;  1QNB A;  3H1Z A;  1UT4 A;  5IYB P;  1KY6 A;  3EIK A;  3RPJ A;  3OCI A;  3OST A;  4I8O A;  1VTL E;  1KYD A;  2XHI A;  1QN4 A;  1PZD A;  1JFI C;  3I0X A;  3DPU A;  4B0A A;  1RM1 A;  4EJZ A;  1QNE A;  2VJ0 A;  4WZS D;  4PY5 A;  3DPT A;  1EBM A;  2NOE A;  1LWV A;  2D0B A;  1YTB A;  1VOL B;  1CDW A;  4Q11 A;  2HZM A;  3F10 A;  1QNC A;  2MJ7 A;  3KTU A;  1LWW A;  1W80 A;  1M3Q A;  1B9K A;  1QN5 A;  2I5W A;  3I0W A;  2LAE A;  3VN5 A;  3F0Z A;  1TBA B;  2NOH A;  1AIS A;  1QN7 A;  1QTS A;  2NOB A;  2NOF A;  1LWY A;  1TBP A;  3ASM A;  5AN4 A;  4TPS A;  1QNA A;  2D0A A;  1M3H A;  1YQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...