3EIKA

Double stranded dna binding protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
178
Chain Sequence
GIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TATA-box-binding protein
publication title structural studies of ecTBP
rcsb
source organism Encephalitozoon cuniculi
total genus 39
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3eikA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3eikA02
1TBAB 2VJ0A 4RODB 1RM1A 4WZSD 1QNBA 1TBPA 1VOKA 3HS8A 5IYDP 3HS9A 1MP9A 1R4XA 1KY6A 3ASMA 2G30A 1E42A 3VN5A 1QTSA 2Z8UA 1B9KA 1QTPA 1NVPA 1CDWA 1JFIC 1PCZA 1NGMA 1PZDA 1W80A 1NH2A 2IV9A 5IYBP 2D0BA 2MJ7A 1QN6A 4B0AA 1AISA 1D3UA 1QN9A 3H1ZA 1QN8A 2D0CA 4ROCB 1QN3A 1QNAA 1KYDA 1QN7A 5IYCP 1VOLB 1QNCA 1QN4A 1TGHA 1KY7A 1KYUA 4ROEB 1VTLE 1KYFA 2IV8A 3OCIA 1YTBA 1VTOA 1QN5A 3OC3C 1QNEA 1YTFA 4PY5A 2D0AA 1C9BB 3EIKA
chains in the Genus database with same CATH superfamily
1PCMX 1TBAB 2VJ0A 3OSEA 3RPJA 1RM1A 2YH5A 2NOIA 3CWAA 1UT7A 2OOXA 5BMNA 3ASMA 5JN5A 4EALA 3CVTA 3T4NA 3OSTA 3VN5A 4D7RA 1UT4A 2Z8UA 3PDKA 1B9KA 1NVPA 3UW2A 3OSMA 2OOYA 1LWWA 2V8QA 2XHIA 1NGMA 4C7PA 4I8OA 1PZDA 1M5Q1 1P5GX 3OGDA 2FKFA 4EAKA 2MJ7A 3D7QA 4B0AA 1D3UA 1QN9A 1V5SA 2ZFDB 4BJUA 1PVSA 1YQKA 1VOLB 3TE5A 4EAJA 2FKMX 1QNCA 1HU0A 4IL8A 2YA3A 2EHBD 4ROEB 2HKPA 3CWUA 1KYFA 2IV8A 4Q11A 5F9CA 2DKCA 2PWWA 1YQLA 2JHNA 1MPGA 3KTUA 1VTOA 1LWVA 1FN7A 1QNEA 3BKQX 1C9BB 3ULXA 5IYDP 3TDHA 1N3AA 5AN4A 1TBPA 4HJHA 2QR1A 1KO9A 1KFIA 1JDYA 1E42A 2QRDA 1K35A 1C47A 1QTPA 3DPUA 3RSMA 2O3OA 4EJZA 1J3MA 1PCZA 2HL9A 2H5AX 3NA5A 1W80A 2QLVA 5IYBP 2D0BA 3CVSA 2NOHA 3H1ZA 1UL7A 1M3QA 1KFQA 4WX8A 2V92A 3CW7A 4TPSA 1KY7A 1KYUA 2FUVA 1T6AA 2QRCA 4EAIA 2JHJA 3C04A 1NH2A 1YTFA 2D0AA 2NLVA 3IH7A 1PCJX 2QREA 2V9JA 4EAGA 3HS8A 4QG5A 3HS9A 1MP9A 1R4XA 1EUVA 1KY6A 2JPIA 2MZ8A 1C4GA 2F7LA 3DPTA 2G30A 5JMVD 3OLPA 1QTSA 3N89A 5EPCA 1JFIC 3CWSA 2NOZA 2NOBA 2Y8QA 1YQMA 2JOIA 2HZSA 2IV9A 1VKLA 2Z0FA 1AISA 2R5XA 3I0XA 2HZMA 5KL0A 1DIZA 4ROCB 1QN3A 1QNAA 1QN7A 1EBMA 4CFFA 2Y8LA 1N39A 3OCIA 2DKAA 1N3CA 1WJWA 2H4LX 3PMGA 1LWYA 1YTBA 1QN5A 3OC3C 3D4VA 4PY5A 1K2YX 3OH6A 3I0WA 2NOEA 4RODB 1P5DX 1XSZA 4DULA 4WZSD 4EJYA 1QNBA 1VOKA 1LXTA 3ENCA 3SNSA 2I5WA 2FGTA 5HSHA 2DKDA 5BMPA 3CWTA 1WQAA 2NOLA 2NOFA 1Q9UA 3KRMA 1CDWA 2HL8A 2NWVA 3ENOC 3EAYA 4D7QA 1M3HA 3OH9A 3F10A 1QN6A 4WXAA 1YQRA 4MRQA 2D0CA 1QN8A 1KYDA 5IYCP 1QN4A 3I3WA 1TGHA 3F0ZA 1VTLE 2NVMA 2LAEA 1TUOA 3EIKA
chains in the Genus database with same CATH topology
1TBAB 2VJ0A 1RM1A 3RPJA 2YH5A 2NOIA 1UT7A 3ASMA 3OSTA 3VN5A 1UT4A 2Z8UA 1B9KA 1NVPA 3OSMA 1LWWA 2XHIA 1NGMA 4I8OA 1PZDA 2MJ7A 4B0AA 1D3UA 1QN9A 1YQKA 1VOLB 1QNCA 1HU0A 4ROEB 1KYFA 2IV8A 4Q11A 1YQLA 3KTUA 1VTOA 1LWVA 1FN7A 1QNEA 1C9BB 3ULXA 5IYDP 1N3AA 5AN4A 1TBPA 1KO9A 1E42A 1QTPA 3DPUA 2O3OA 4EJZA 1PCZA 1W80A 5IYBP 2D0BA 2NOHA 3H1ZA 1M3QA 4TPSA 1KY7A 1KYUA 1NH2A 1YTFA 2D0AA 3IH7A 3HS8A 3HS9A 1MP9A 1R4XA 1KY6A 2MZ8A 3DPTA 2G30A 1QTSA 3N89A 1JFIC 2NOZA 2NOBA 1YQMA 2JOIA 2HZSA 2IV9A 1AISA 3I0XA 2HZMA 4ROCB 1QN3A 1QNAA 1QN7A 1EBMA 1N39A 3OCIA 1N3CA 1LWYA 1YTBA 1QN5A 3OC3C 4PY5A 3I0WA 2NOEA 4RODB 4EJYA 4DULA 4WZSD 1QNBA 1VOKA 3SNSA 2I5WA 2FGTA 2NOLA 2NOFA 3KRMA 1CDWA 1M3HA 3F10A 1QN6A 1YQRA 1QN8A 2D0CA 1KYDA 5IYCP 1QN4A 1TGHA 3F0ZA 1VTLE 2LAEA 3EIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBA B;  2VJ0 A;  4ROD B;  1RM1 A;  4WZS D;  1QNB A;  1TBP A;  1VOK A;  3HS8 A;  5IYD P;  3HS9 A;  1MP9 A;  1R4X A;  1KY6 A;  3ASM A;  2G30 A;  1E42 A;  3VN5 A;  1QTS A;  2Z8U A;  1B9K A;  1QTP A;  1NVP A;  1CDW A;  1JFI C;  1PCZ A;  1NGM A;  1PZD A;  1W80 A;  1NH2 A;  2IV9 A;  5IYB P;  2D0B A;  2MJ7 A;  1QN6 A;  4B0A A;  1AIS A;  1D3U A;  1QN9 A;  3H1Z A;  1QN8 A;  2D0C A;  4ROC B;  1QN3 A;  1QNA A;  1KYD A;  1QN7 A;  5IYC P;  1VOL B;  1QNC A;  1QN4 A;  1TGH A;  1KY7 A;  1KYU A;  4ROE B;  1VTL E;  1KYF A;  2IV8 A;  3OCI A;  1YTB A;  1VTO A;  1QN5 A;  3OC3 C;  1QNE A;  1YTF A;  4PY5 A;  2D0A A;  1C9B B;  3EIK A; 
#chains in the Genus database with same CATH topology
 1PCM X;  1TBA B;  2VJ0 A;  3OSE A;  3RPJ A;  1RM1 A;  2YH5 A;  2NOI A;  3CWA A;  1UT7 A;  2OOX A;  5BMN A;  3ASM A;  5JN5 A;  4EAL A;  3CVT A;  3T4N A;  3OST A;  3VN5 A;  4D7R A;  1UT4 A;  2Z8U A;  3PDK A;  1B9K A;  1NVP A;  3UW2 A;  3OSM A;  2OOY A;  1LWW A;  2V8Q A;  2XHI A;  1NGM A;  4C7P A;  4I8O A;  1PZD A;  1M5Q 1;  1P5G X;  3OGD A;  2FKF A;  4EAK A;  2MJ7 A;  3D7Q A;  4B0A A;  1D3U A;  1QN9 A;  1V5S A;  2ZFD B;  4BJU A;  1PVS A;  1YQK A;  1VOL B;  3TE5 A;  4EAJ A;  2FKM X;  1QNC A;  1HU0 A;  4IL8 A;  2YA3 A;  2EHB D;  4ROE B;  2HKP A;  3CWU A;  1KYF A;  2IV8 A;  4Q11 A;  5F9C A;  2DKC A;  2PWW A;  1YQL A;  2JHN A;  1MPG A;  3KTU A;  1VTO A;  1LWV A;  1FN7 A;  1QNE A;  3BKQ X;  1C9B B;  3ULX A;  5IYD P;  3TDH A;  1N3A A;  5AN4 A;  1TBP A;  4HJH A;  2QR1 A;  1KO9 A;  1KFI A;  1JDY A;  1E42 A;  2QRD A;  1K35 A;  1C47 A;  1QTP A;  3DPU A;  3RSM A;  2O3O A;  4EJZ A;  1J3M A;  1PCZ A;  2HL9 A;  2H5A X;  3NA5 A;  1W80 A;  2QLV A;  5IYB P;  2D0B A;  3CVS A;  2NOH A;  3H1Z A;  1UL7 A;  1M3Q A;  1KFQ A;  4WX8 A;  2V92 A;  3CW7 A;  4TPS A;  1KY7 A;  1KYU A;  2FUV A;  1T6A A;  2QRC A;  4EAI A;  2JHJ A;  3C04 A;  1NH2 A;  1YTF A;  2D0A A;  2NLV A;  3IH7 A;  1PCJ X;  2QRE A;  2V9J A;  4EAG A;  3HS8 A;  4QG5 A;  3HS9 A;  1MP9 A;  1R4X A;  1EUV A;  1KY6 A;  2JPI A;  2MZ8 A;  1C4G A;  2F7L A;  3DPT A;  2G30 A;  5JMV D;  3OLP A;  1QTS A;  3N89 A;  5EPC A;  1JFI C;  3CWS A;  2NOZ A;  2NOB A;  2Y8Q A;  1YQM A;  2JOI A;  2HZS A;  2IV9 A;  1VKL A;  2Z0F A;  1AIS A;  2R5X A;  3I0X A;  2HZM A;  5KL0 A;  1DIZ A;  4ROC B;  1QN3 A;  1QNA A;  1QN7 A;  1EBM A;  4CFF A;  2Y8L A;  1N39 A;  3OCI A;  2DKA A;  1N3C A;  1WJW A;  2H4L X;  3PMG A;  1LWY A;  1YTB A;  1QN5 A;  3OC3 C;  3D4V A;  4PY5 A;  1K2Y X;  3OH6 A;  3I0W A;  2NOE A;  4ROD B;  1P5D X;  1XSZ A;  4DUL A;  4WZS D;  4EJY A;  1QNB A;  1VOK A;  1LXT A;  3ENC A;  3SNS A;  2I5W A;  2FGT A;  5HSH A;  2DKD A;  5BMP A;  3CWT A;  1WQA A;  2NOL A;  2NOF A;  1Q9U A;  3KRM A;  1CDW A;  2HL8 A;  2NWV A;  3ENO C;  3EAY A;  4D7Q A;  1M3H A;  3OH9 A;  3F10 A;  1QN6 A;  4WXA A;  1YQR A;  4MRQ A;  2D0C A;  1QN8 A;  1KYD A;  5IYC P;  1QN4 A;  3I3W A;  1TGH A;  3F0Z A;  1VTL E;  2NVM A;  2LAE A;  1TUO A;  3EIK A; 
#chains in the Genus database with same CATH homology
 1TBA B;  2VJ0 A;  1RM1 A;  3RPJ A;  2YH5 A;  2NOI A;  1UT7 A;  3ASM A;  3OST A;  3VN5 A;  1UT4 A;  2Z8U A;  1B9K A;  1NVP A;  3OSM A;  1LWW A;  2XHI A;  1NGM A;  4I8O A;  1PZD A;  2MJ7 A;  4B0A A;  1D3U A;  1QN9 A;  1YQK A;  1VOL B;  1QNC A;  1HU0 A;  4ROE B;  1KYF A;  2IV8 A;  4Q11 A;  1YQL A;  3KTU A;  1VTO A;  1LWV A;  1FN7 A;  1QNE A;  1C9B B;  3ULX A;  5IYD P;  1N3A A;  5AN4 A;  1TBP A;  1KO9 A;  1E42 A;  1QTP A;  3DPU A;  2O3O A;  4EJZ A;  1PCZ A;  1W80 A;  5IYB P;  2D0B A;  2NOH A;  3H1Z A;  1M3Q A;  4TPS A;  1KY7 A;  1KYU A;  1NH2 A;  1YTF A;  2D0A A;  3IH7 A;  3HS8 A;  3HS9 A;  1MP9 A;  1R4X A;  1KY6 A;  2MZ8 A;  3DPT A;  2G30 A;  1QTS A;  3N89 A;  1JFI C;  2NOZ A;  2NOB A;  1YQM A;  2JOI A;  2HZS A;  2IV9 A;  1AIS A;  3I0X A;  2HZM A;  4ROC B;  1QN3 A;  1QNA A;  1QN7 A;  1EBM A;  1N39 A;  3OCI A;  1N3C A;  1LWY A;  1YTB A;  1QN5 A;  3OC3 C;  4PY5 A;  3I0W A;  2NOE A;  4ROD B;  4EJY A;  4DUL A;  4WZS D;  1QNB A;  1VOK A;  3SNS A;  2I5W A;  2FGT A;  2NOL A;  2NOF A;  3KRM A;  1CDW A;  1M3H A;  3F10 A;  1QN6 A;  1YQR A;  1QN8 A;  2D0C A;  1KYD A;  5IYC P;  1QN4 A;  1TGH A;  3F0Z A;  1VTL E;  2LAE A;  3EIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...