5IYCP

Human core-pic in the initial transcribing state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
185
structure length
185
Chain Sequence
TPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iycP01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iycP02
1PCZA 5IYBP 1NGMA 2D0AA 1C9BB 1VOKA 1QN3A 5IYDP 1B9KA 1QN7A 1QN5A 1KYDA 2D0CA 4B0AA 1W80A 5IYCP 1QN4A 1PZDA 1JFIC 3H1ZA 1VOLB 1KYUA 1KY6A 1TBAB 1YTFA 1CDWA 1E42A 1NVPA 2VJ0A 1RM1A 1QN6A 3VN5A 1YTBA 4ROEB 1KYFA 1AISA 2D0BA 1NH2A 1VTLE 2IV9A 1QNAA 1TBPA 4ROCB 1TGHA 3HS9A 1QNCA 2Z8UA 2IV8A 3OC3C 1QTPA 3ASMA 3HS8A 4WZSD 1QNBA 3OCIA 1QNEA 1VTOA 4PY5A 1R4XA 1QN8A 4RODB 2G30A 1KY7A 3EIKA 1D3UA 1QTSA 2MJ7A 1QN9A 1MP9A
chains in the Genus database with same CATH superfamily
2FUVA 3NA5A 5IYDP 1DIZA 1YQLA 1QN5A 1KYDA 3SNSA 4B0AA 1YQKA 4D7QA 4TPSA 3H1ZA 4BJUA 3D4VA 1KY6A 1VOLB 2DKDA 2FGTA 3F10A 2DKCA 4EAIA 2NOFA 1P5DX 1KYFA 4EALA 1MPGA 2YA3A 1NH2A 2IV9A 1QNAA 3CWSA 5BMPA 3OH9A 2NOZA 1LWYA 2H5AX 1WJWA 1QNBA 1QTPA 1VKLA 3ASMA 2JHJA 1UL7A 1N3CA 2V8QA 1YQMA 3F0ZA 2DKAA 4RODB 3RPJA 3CVTA 3EIKA 2H4LX 1PCMX 3VN5A 2NOIA 2MZ8A 3I3WA 3TDHA 1KO9A 1QN3A 3PDKA 3D7QA 2HL8A 4DULA 1B9KA 4WXAA 5AN4A 3UW2A 1W80A 2PWWA 2QRCA 2Y8QA 2R5XA 4MRQA 1E42A 1UT7A 2VJ0A 1Q9UA 3BKQX 3N89A 1RM1A 1C47A 1C4GA 4EAJA 2V92A 2D0BA 1N39A 1P5GX 1VTLE 3CW7A 1UT4A 2Z0FA 1TBPA 2NOBA 1TGHA 1QNCA 1EBMA 3OC3C 4WX8A 3HS8A 2QRDA 2OOYA 3OCIA 2XHIA 1QNEA 3ENCA 1K2YX 1V5SA 3OGDA 2NWVA 2HKPA 4EAKA 1QTSA 3IH7A 2NOHA 1MP9A 2JPIA 1TUOA 5IYBP 1XSZA 5KL0A 1M3HA 1QN7A 2LAEA 2FKMX 2D0CA 1N3AA 1QN4A 1KFIA 1JFIC 1KYUA 1TBAB 3OSMA 5JMVD 4D7RA 1YQRA 1YTFA 1CDWA 1LXTA 1FN7A 2QREA 2V9JA 1QN6A 1LWWA 4C7PA 1YTBA 4I8OA 5JN5A 4ROEB 5HSHA 1KFQA 2I5WA 1PVSA 3KTUA 2O3OA 1HU0A 1K35A 1JDYA 2F7LA 2NLVA 4ROCB 4EJYA 2YH5A 1M5Q1 3DPTA 4EAGA 4WZSD 2HZSA 2HL9A 3PMGA 3TE5A 1VTOA 3CWTA 1WQAA 3ULXA 1QN8A 3CWAA 2JOIA 1KY7A 4QG5A 2MJ7A 3CVSA 2Y8LA 1M3QA 1QN9A 5BMNA 1PCZA 1NGMA 1C9BB 2D0AA 1VOKA 4EJZA 2HZMA 1EUVA 2QLVA 3OLPA 5IYCP 1PZDA 2ZFDB 3EAYA 2NOEA 3C04A 3I0XA 1NVPA 2EHBD 5F9CA 1T6AA 4HJHA 4CFFA 3CWUA 1AISA 2NOLA 1LWVA 1J3MA 2FKFA 3KRMA 4Q11A 3HS9A 3OSTA 2Z8UA 3ENOC 2IV8A 4IL8A 3RSMA 3DPUA 2NVMA 1PCJX 3I0WA 5EPCA 2OOXA 3OSEA 3T4NA 4PY5A 1R4XA 2JHNA 2QR1A 2G30A 1D3UA 3OH6A
chains in the Genus database with same CATH topology
5IYDP 1YQLA 1QN5A 1KYDA 3SNSA 4B0AA 1YQKA 4TPSA 3H1ZA 1VOLB 1KY6A 2FGTA 3F10A 2NOFA 1KYFA 1NH2A 2IV9A 1QNAA 2NOZA 1LWYA 1QNBA 1QTPA 3ASMA 1N3CA 1YQMA 3F0ZA 4RODB 3RPJA 3EIKA 3VN5A 2NOIA 2MZ8A 1KO9A 1QN3A 4DULA 1B9KA 5AN4A 1W80A 1E42A 1UT7A 2VJ0A 1RM1A 3N89A 1N39A 2D0BA 1VTLE 1UT4A 1TBPA 2NOBA 1TGHA 1QNCA 1EBMA 3OC3C 3HS8A 1QNEA 3OCIA 2XHIA 1QTSA 3IH7A 2NOHA 1MP9A 5IYBP 1M3HA 1QN7A 2LAEA 2D0CA 1N3AA 1QN4A 1JFIC 1KYUA 1TBAB 3OSMA 1YQRA 1YTFA 1CDWA 1FN7A 1QN6A 1LWWA 1YTBA 4I8OA 4ROEB 2I5WA 3KTUA 2O3OA 1HU0A 4ROCB 4EJYA 2YH5A 3DPTA 4WZSD 2HZSA 1VTOA 3ULXA 1QN8A 2JOIA 1KY7A 2MJ7A 1M3QA 1QN9A 1PCZA 1NGMA 1C9BB 2D0AA 1VOKA 4EJZA 2HZMA 5IYCP 1PZDA 2NOEA 3I0XA 1NVPA 1AISA 2NOLA 1LWVA 3KRMA 4Q11A 3HS9A 3OSTA 2Z8UA 3I0WA 2IV8A 3DPUA 4PY5A 1R4XA 2G30A 1D3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCZ A;  5IYB P;  1NGM A;  2D0A A;  1C9B B;  1VOK A;  1QN3 A;  5IYD P;  1B9K A;  1QN7 A;  1QN5 A;  1KYD A;  2D0C A;  4B0A A;  1W80 A;  5IYC P;  1QN4 A;  1PZD A;  1JFI C;  3H1Z A;  1VOL B;  1KYU A;  1KY6 A;  1TBA B;  1YTF A;  1CDW A;  1E42 A;  1NVP A;  2VJ0 A;  1RM1 A;  1QN6 A;  3VN5 A;  1YTB A;  4ROE B;  1KYF A;  1AIS A;  2D0B A;  1NH2 A;  1VTL E;  2IV9 A;  1QNA A;  1TBP A;  4ROC B;  1TGH A;  3HS9 A;  1QNC A;  2Z8U A;  2IV8 A;  3OC3 C;  1QTP A;  3ASM A;  3HS8 A;  4WZS D;  1QNB A;  3OCI A;  1QNE A;  1VTO A;  4PY5 A;  1R4X A;  1QN8 A;  4ROD B;  2G30 A;  1KY7 A;  3EIK A;  1D3U A;  1QTS A;  2MJ7 A;  1QN9 A;  1MP9 A; 
#chains in the Genus database with same CATH topology
 2FUV A;  3NA5 A;  5IYD P;  1DIZ A;  1YQL A;  1QN5 A;  1KYD A;  3SNS A;  4B0A A;  1YQK A;  4D7Q A;  4TPS A;  3H1Z A;  4BJU A;  3D4V A;  1KY6 A;  1VOL B;  2DKD A;  2FGT A;  3F10 A;  2DKC A;  4EAI A;  2NOF A;  1P5D X;  1KYF A;  4EAL A;  1MPG A;  2YA3 A;  1NH2 A;  2IV9 A;  1QNA A;  3CWS A;  5BMP A;  3OH9 A;  2NOZ A;  1LWY A;  2H5A X;  1WJW A;  1QNB A;  1QTP A;  1VKL A;  3ASM A;  2JHJ A;  1UL7 A;  1N3C A;  2V8Q A;  1YQM A;  3F0Z A;  2DKA A;  4ROD B;  3RPJ A;  3CVT A;  3EIK A;  2H4L X;  1PCM X;  3VN5 A;  2NOI A;  2MZ8 A;  3I3W A;  3TDH A;  1KO9 A;  1QN3 A;  3PDK A;  3D7Q A;  2HL8 A;  4DUL A;  1B9K A;  4WXA A;  5AN4 A;  3UW2 A;  1W80 A;  2PWW A;  2QRC A;  2Y8Q A;  2R5X A;  4MRQ A;  1E42 A;  1UT7 A;  2VJ0 A;  1Q9U A;  3BKQ X;  3N89 A;  1RM1 A;  1C47 A;  1C4G A;  4EAJ A;  2V92 A;  2D0B A;  1N39 A;  1P5G X;  1VTL E;  3CW7 A;  1UT4 A;  2Z0F A;  1TBP A;  2NOB A;  1TGH A;  1QNC A;  1EBM A;  3OC3 C;  4WX8 A;  3HS8 A;  2QRD A;  2OOY A;  3OCI A;  2XHI A;  1QNE A;  3ENC A;  1K2Y X;  1V5S A;  3OGD A;  2NWV A;  2HKP A;  4EAK A;  1QTS A;  3IH7 A;  2NOH A;  1MP9 A;  2JPI A;  1TUO A;  5IYB P;  1XSZ A;  5KL0 A;  1M3H A;  1QN7 A;  2LAE A;  2FKM X;  2D0C A;  1N3A A;  1QN4 A;  1KFI A;  1JFI C;  1KYU A;  1TBA B;  3OSM A;  5JMV D;  4D7R A;  1YQR A;  1YTF A;  1CDW A;  1LXT A;  1FN7 A;  2QRE A;  2V9J A;  1QN6 A;  1LWW A;  4C7P A;  1YTB A;  4I8O A;  5JN5 A;  4ROE B;  5HSH A;  1KFQ A;  2I5W A;  1PVS A;  3KTU A;  2O3O A;  1HU0 A;  1K35 A;  1JDY A;  2F7L A;  2NLV A;  4ROC B;  4EJY A;  2YH5 A;  1M5Q 1;  3DPT A;  4EAG A;  4WZS D;  2HZS A;  2HL9 A;  3PMG A;  3TE5 A;  1VTO A;  3CWT A;  1WQA A;  3ULX A;  1QN8 A;  3CWA A;  2JOI A;  1KY7 A;  4QG5 A;  2MJ7 A;  3CVS A;  2Y8L A;  1M3Q A;  1QN9 A;  5BMN A;  1PCZ A;  1NGM A;  1C9B B;  2D0A A;  1VOK A;  4EJZ A;  2HZM A;  1EUV A;  2QLV A;  3OLP A;  5IYC P;  1PZD A;  2ZFD B;  3EAY A;  2NOE A;  3C04 A;  3I0X A;  1NVP A;  2EHB D;  5F9C A;  1T6A A;  4HJH A;  4CFF A;  3CWU A;  1AIS A;  2NOL A;  1LWV A;  1J3M A;  2FKF A;  3KRM A;  4Q11 A;  3HS9 A;  3OST A;  2Z8U A;  3ENO C;  2IV8 A;  4IL8 A;  3RSM A;  3DPU A;  2NVM A;  1PCJ X;  3I0W A;  5EPC A;  2OOX A;  3OSE A;  3T4N A;  4PY5 A;  1R4X A;  2JHN A;  2QR1 A;  2G30 A;  1D3U A;  3OH6 A; 
#chains in the Genus database with same CATH homology
 5IYD P;  1YQL A;  1QN5 A;  1KYD A;  3SNS A;  4B0A A;  1YQK A;  4TPS A;  3H1Z A;  1VOL B;  1KY6 A;  2FGT A;  3F10 A;  2NOF A;  1KYF A;  1NH2 A;  2IV9 A;  1QNA A;  2NOZ A;  1LWY A;  1QNB A;  1QTP A;  3ASM A;  1N3C A;  1YQM A;  3F0Z A;  4ROD B;  3RPJ A;  3EIK A;  3VN5 A;  2NOI A;  2MZ8 A;  1KO9 A;  1QN3 A;  4DUL A;  1B9K A;  5AN4 A;  1W80 A;  1E42 A;  1UT7 A;  2VJ0 A;  1RM1 A;  3N89 A;  1N39 A;  2D0B A;  1VTL E;  1UT4 A;  1TBP A;  2NOB A;  1TGH A;  1QNC A;  1EBM A;  3OC3 C;  3HS8 A;  1QNE A;  3OCI A;  2XHI A;  1QTS A;  3IH7 A;  2NOH A;  1MP9 A;  5IYB P;  1M3H A;  1QN7 A;  2LAE A;  2D0C A;  1N3A A;  1QN4 A;  1JFI C;  1KYU A;  1TBA B;  3OSM A;  1YQR A;  1YTF A;  1CDW A;  1FN7 A;  1QN6 A;  1LWW A;  1YTB A;  4I8O A;  4ROE B;  2I5W A;  3KTU A;  2O3O A;  1HU0 A;  4ROC B;  4EJY A;  2YH5 A;  3DPT A;  4WZS D;  2HZS A;  1VTO A;  3ULX A;  1QN8 A;  2JOI A;  1KY7 A;  2MJ7 A;  1M3Q A;  1QN9 A;  1PCZ A;  1NGM A;  1C9B B;  2D0A A;  1VOK A;  4EJZ A;  2HZM A;  5IYC P;  1PZD A;  2NOE A;  3I0X A;  1NVP A;  1AIS A;  2NOL A;  1LWV A;  3KRM A;  4Q11 A;  3HS9 A;  3OST A;  2Z8U A;  3I0W A;  2IV8 A;  3DPU A;  4PY5 A;  1R4X A;  2G30 A;  1D3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...