2QLVA

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
133
Chain Sequence
YKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSLWTIKLRWKDLMKMVIQLFQNNYLVDFKFDGWESEMSTFSAYPFLHLTTKLIMELAVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite derepressing protein kinase
publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/protein binding
total genus 29
structure length 133
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2qlvA01
1UL7A 2V8QA 2V9JA 4CFFA 3TDHA 2QREA 2QLVA 3T4NA 4EAKA 2V92A 3OSEA 2Y8QA 3TE5A 2QR1A 4EAJA 2ZFDB 2OOXA 2QRCA 2YA3A 2EHBD 2OOYA 4EAIA 2Y8LA 4EAGA 2QRDA 1V5SA 4EALA
chains in the Genus database with same CATH superfamily
3TDHA 1LXTA 1QNCA 1T6AA 5JMVD 1P5GX 1W80A 3HS9A 4WX8A 1QN9A 1QNEA 5IYBP 3F0ZA 2I5WA 2FKMX 1QN8A 1QN3A 5BMPA 3BKQX 4EAKA 3IH7A 2PWWA 1VOKA 4D7RA 2Y8QA 2YH5A 5IYDP 1C9BB 2D0AA 4EAJA 4HJHA 1QN4A 3I0WA 1J3MA 1MP9A 1VTOA 3EIKA 1WJWA 1EUVA 1P5DX 2G30A 3OH9A 1NH2A 2OOYA 2NOHA 1XSZA 1TBAB 4Q11A 1JFIC 5F9CA 3ENOC 1YQRA 1N39A 1TUOA 4BJUA 2HKPA 1LWYA 2NOEA 1UT4A 2FKFA 4WZSD 2XHIA 1PCZA 1UL7A 1QNBA 1JDYA 2V9JA 1D3UA 2HL9A 1YTFA 2NOBA 5AN4A 1PZDA 4WXAA 2VJ0A 2JHNA 1B9KA 1MPGA 2D0CA 1K35A 2NLVA 1KY7A 3OGDA 1RM1A 3CWSA 2V92A 2NOZA 1KO9A 1UT7A 3H1ZA 2LAEA 2DKDA 3CVSA 1QTPA 1K2YX 2OOXA 2QRCA 3OLPA 1E42A 3DPUA 3C04A 1TBPA 4EAIA 2R5XA 1DIZA 1PVSA 2JHJA 1WQAA 1KYDA 4EAGA 3DPTA 1CDWA 1M5Q1 1QN5A 3RSMA 2NOLA 1VOLB 1C47A 2MJ7A 2V8QA 5EPCA 2H4LX 2H5AX 1TGHA 4ROCB 3CWAA 3HS8A 3ASMA 3N89A 4TPSA 1YQKA 2FGTA 3OSTA 1KYFA 4IL8A 5KL0A 5BMNA 3TE5A 1EBMA 2QR1A 1Q9UA 3D4VA 1KY6A 1M3QA 1QN6A 1R4XA 3F10A 2HL8A 1PCJX 1VTLE 5IYCP 4RODB 1AISA 2Z0FA 3CVTA 1HU0A 2O3OA 2EHBD 3CW7A 1VKLA 2DKAA 3KTUA 3D7QA 2IV8A 3SNSA 4ROEB 1KYUA 4C7PA 3PMGA 2QRDA 1V5SA 3OSMA 1YQLA 1NVPA 4EALA 3CWTA 1KFQA 4EJZA 1PCMX 2DKCA 4CFFA 4EJYA 4MRQA 3OH6A 2QREA 2QLVA 3EAYA 3CWUA 3I0XA 4I8OA 5JN5A 4PY5A 3T4NA 1N3CA 4B0AA 2D0BA 2F7LA 4QG5A 5HSHA 1N3AA 2FUVA 3OSEA 3OCIA 3KRMA 2IV9A 2NVMA 2NWVA 3NA5A 3PDKA 2HZSA 3RPJA 3ENCA 3ULXA 1LWWA 1KFIA 1QTSA 3I3WA 2Z8UA 3OC3C 2ZFDB 2JPIA 1YQMA 4DULA 1LWVA 2YA3A 3VN5A 1YTBA 2NOFA 1M3HA 2HZMA 2Y8LA 1FN7A 2NOIA 1QN7A 2MZ8A 1C4GA 2JOIA 1NGMA 4D7QA 1QNAA 3UW2A
chains in the Genus database with same CATH topology
1UL7A 2V8QA 2V9JA 4CFFA 3TDHA 2QREA 2QLVA 3T4NA 4EAKA 2V92A 3OSEA 2Y8QA 3TE5A 2QR1A 4EAJA 2ZFDB 2OOXA 2QRCA 2YA3A 2EHBD 2OOYA 4EAIA 2Y8LA 4EAGA 2QRDA 1V5SA 4EALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UL7 A;  2V8Q A;  2V9J A;  4CFF A;  3TDH A;  2QRE A;  2QLV A;  3T4N A;  4EAK A;  2V92 A;  3OSE A;  2Y8Q A;  3TE5 A;  2QR1 A;  4EAJ A;  2ZFD B;  2OOX A;  2QRC A;  2YA3 A;  2EHB D;  2OOY A;  4EAI A;  2Y8L A;  4EAG A;  2QRD A;  1V5S A;  4EAL A; 
#chains in the Genus database with same CATH topology
 3TDH A;  1LXT A;  1QNC A;  1T6A A;  5JMV D;  1P5G X;  1W80 A;  3HS9 A;  4WX8 A;  1QN9 A;  1QNE A;  5IYB P;  3F0Z A;  2I5W A;  2FKM X;  1QN8 A;  1QN3 A;  5BMP A;  3BKQ X;  4EAK A;  3IH7 A;  2PWW A;  1VOK A;  4D7R A;  2Y8Q A;  2YH5 A;  5IYD P;  1C9B B;  2D0A A;  4EAJ A;  4HJH A;  1QN4 A;  3I0W A;  1J3M A;  1MP9 A;  1VTO A;  3EIK A;  1WJW A;  1EUV A;  1P5D X;  2G30 A;  3OH9 A;  1NH2 A;  2OOY A;  2NOH A;  1XSZ A;  1TBA B;  4Q11 A;  1JFI C;  5F9C A;  3ENO C;  1YQR A;  1N39 A;  1TUO A;  4BJU A;  2HKP A;  1LWY A;  2NOE A;  1UT4 A;  2FKF A;  4WZS D;  2XHI A;  1PCZ A;  1UL7 A;  1QNB A;  1JDY A;  2V9J A;  1D3U A;  2HL9 A;  1YTF A;  2NOB A;  5AN4 A;  1PZD A;  4WXA A;  2VJ0 A;  2JHN A;  1B9K A;  1MPG A;  2D0C A;  1K35 A;  2NLV A;  1KY7 A;  3OGD A;  1RM1 A;  3CWS A;  2V92 A;  2NOZ A;  1KO9 A;  1UT7 A;  3H1Z A;  2LAE A;  2DKD A;  3CVS A;  1QTP A;  1K2Y X;  2OOX A;  2QRC A;  3OLP A;  1E42 A;  3DPU A;  3C04 A;  1TBP A;  4EAI A;  2R5X A;  1DIZ A;  1PVS A;  2JHJ A;  1WQA A;  1KYD A;  4EAG A;  3DPT A;  1CDW A;  1M5Q 1;  1QN5 A;  3RSM A;  2NOL A;  1VOL B;  1C47 A;  2MJ7 A;  2V8Q A;  5EPC A;  2H4L X;  2H5A X;  1TGH A;  4ROC B;  3CWA A;  3HS8 A;  3ASM A;  3N89 A;  4TPS A;  1YQK A;  2FGT A;  3OST A;  1KYF A;  4IL8 A;  5KL0 A;  5BMN A;  3TE5 A;  1EBM A;  2QR1 A;  1Q9U A;  3D4V A;  1KY6 A;  1M3Q A;  1QN6 A;  1R4X A;  3F10 A;  2HL8 A;  1PCJ X;  1VTL E;  5IYC P;  4ROD B;  1AIS A;  2Z0F A;  3CVT A;  1HU0 A;  2O3O A;  2EHB D;  3CW7 A;  1VKL A;  2DKA A;  3KTU A;  3D7Q A;  2IV8 A;  3SNS A;  4ROE B;  1KYU A;  4C7P A;  3PMG A;  2QRD A;  1V5S A;  3OSM A;  1YQL A;  1NVP A;  4EAL A;  3CWT A;  1KFQ A;  4EJZ A;  1PCM X;  2DKC A;  4CFF A;  4EJY A;  4MRQ A;  3OH6 A;  2QRE A;  2QLV A;  3EAY A;  3CWU A;  3I0X A;  4I8O A;  5JN5 A;  4PY5 A;  3T4N A;  1N3C A;  4B0A A;  2D0B A;  2F7L A;  4QG5 A;  5HSH A;  1N3A A;  2FUV A;  3OSE A;  3OCI A;  3KRM A;  2IV9 A;  2NVM A;  2NWV A;  3NA5 A;  3PDK A;  2HZS A;  3RPJ A;  3ENC A;  3ULX A;  1LWW A;  1KFI A;  1QTS A;  3I3W A;  2Z8U A;  3OC3 C;  2ZFD B;  2JPI A;  1YQM A;  4DUL A;  1LWV A;  2YA3 A;  3VN5 A;  1YTB A;  2NOF A;  1M3H A;  2HZM A;  2Y8L A;  1FN7 A;  2NOI A;  1QN7 A;  2MZ8 A;  1C4G A;  2JOI A;  1NGM A;  4D7Q A;  1QNA A;  3UW2 A; 
#chains in the Genus database with same CATH homology
 1UL7 A;  2V8Q A;  2V9J A;  4CFF A;  3TDH A;  2QRE A;  2QLV A;  3T4N A;  4EAK A;  2V92 A;  3OSE A;  2Y8Q A;  3TE5 A;  2QR1 A;  4EAJ A;  2ZFD B;  2OOX A;  2QRC A;  2YA3 A;  2EHB D;  2OOY A;  4EAI A;  2Y8L A;  4EAG A;  2QRD A;  1V5S A;  4EAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...