2QLVA

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
133
Chain Sequence
YKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSLWTIKLRWKDLMKMVIQLFQNNYLVDFKFDGWESEMSTFSAYPFLHLTTKLIMELAVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite derepressing protein kinase
publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/protein binding
total genus 29
structure length 133
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2qlvA01
4EALA 2Y8QA 2EHBD 3OSEA 2ZFDB 2YA3A 3TE5A 3TDHA 2QRCA 4EAJA 4EAKA 2V8QA 4EAIA 2QR1A 3T4NA 1UL7A 2OOXA 4EAGA 1V5SA 4CFFA 2QLVA 2V92A 2QRDA 2V9JA 2QREA 2OOYA 2Y8LA
chains in the Genus database with same CATH superfamily
1LXTA 1QN5A 2H4LX 1VTOA 5JN5A 1QTSA 2PWWA 4TPSA 1E42A 1PVSA 1KY7A 2VJ0A 5IYBP 4WXAA 1P5GX 3HS8A 1HU0A 1QN4A 1WQAA 2HZSA 3OH6A 1JDYA 3OSTA 2YA3A 2HL9A 1P5DX 5EPCA 3TE5A 4B0AA 1QN3A 2QRCA 3OLPA 1QNCA 2FKMX 4IL8A 1EUVA 2NOIA 2JHNA 2MZ8A 3KRMA 3CW7A 1V5SA 5BMPA 1LWVA 1QN7A 2NOLA 1B9KA 2QRDA 2YH5A 3ENCA 2D0AA 2NOZA 2HKPA 2Y8LA 5IYDP 3CWAA 4D7QA 2IV8A 1KFQA 5JMVD 4EJYA 3PDKA 1VTLE 3F0ZA 3RSMA 3EAYA 2H5AX 1XSZA 2EHBD 3OGDA 1N3AA 3OC3C 1JFIC 3DPTA 1PCZA 4QG5A 3PMGA 3N89A 1NH2A 2G30A 1MPGA 1K2YX 3F10A 5KL0A 4EAKA 1R4XA 1AISA 2LAEA 1KFIA 3VN5A 3DPUA 1QTPA 1TBAB 2DKAA 3UW2A 2Z0FA 4DULA 1M3HA 1KYUA 1UT7A 2OOXA 1EBMA 1PCJX 2QLVA 1YTBA 2I5WA 4C7PA 3CWSA 2O3OA 3RPJA 2FGTA 4EALA 2NOBA 1RM1A 1QN9A 4ROEB 3CWTA 3ASMA 5F9CA 2XHIA 3KTUA 2NOHA 3CWUA 1MP9A 3CVSA 5IYCP 1TUOA 2NOEA 1KYDA 3EIKA 1C4GA 2FUVA 3C04A 3I3WA 4ROCB 1QNBA 1YQMA 3NA5A 1VKLA 1PCMX 2JPIA 4EAIA 3I0WA 2NOFA 4I8OA 1YQLA 4Q11A 3BKQX 1NGMA 1D3UA 2JOIA 3H1ZA 1CDWA 4EJZA 3OH9A 2IV9A 3T4NA 3I0XA 1NVPA 1PZDA 2V92A 2Z8UA 1J3MA 1LWWA 2NVMA 1YQRA 2QREA 3OCIA 3D4VA 1QNAA 1N39A 1UT4A 2Y8QA 1C9BB 4RODB 1QNEA 2F7LA 3OSEA 1FN7A 1M5Q1 1KO9A 4MRQA 3ULXA 1LWYA 2FKFA 3ENOC 2ZFDB 4WZSD 2MJ7A 2NWVA 2D0CA 1T6AA 3SNSA 1KYFA 3TDHA 3D7QA 3IH7A 1KY6A 1VOKA 4EAJA 1QN8A 1TBPA 2V8QA 2D0BA 2HL8A 4BJUA 4D7RA 1N3CA 1DIZA 1QN6A 2QR1A 2R5XA 1YTFA 3CVTA 1WJWA 1K35A 2HZMA 1TGHA 1UL7A 4EAGA 5BMNA 1Q9UA 1W80A 3HS9A 4CFFA 5HSHA 2JHJA 1VOLB 4WX8A 2V9JA 4HJHA 1M3QA 2DKDA 2OOYA 2NLVA 5AN4A 3OSMA 1YQKA 4PY5A 2DKCA 1C47A
chains in the Genus database with same CATH topology
4EALA 2Y8QA 2EHBD 3OSEA 2ZFDB 2YA3A 3TE5A 3TDHA 2QRCA 4EAJA 4EAKA 2V8QA 4EAIA 2QR1A 3T4NA 1UL7A 2OOXA 4EAGA 1V5SA 4CFFA 2QLVA 2V92A 2QRDA 2V9JA 2QREA 2OOYA 2Y8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAL A;  2Y8Q A;  2EHB D;  3OSE A;  2ZFD B;  2YA3 A;  3TE5 A;  3TDH A;  2QRC A;  4EAJ A;  4EAK A;  2V8Q A;  4EAI A;  2QR1 A;  3T4N A;  1UL7 A;  2OOX A;  4EAG A;  1V5S A;  4CFF A;  2QLV A;  2V92 A;  2QRD A;  2V9J A;  2QRE A;  2OOY A;  2Y8L A; 
#chains in the Genus database with same CATH topology
 1LXT A;  1QN5 A;  2H4L X;  1VTO A;  5JN5 A;  1QTS A;  2PWW A;  4TPS A;  1E42 A;  1PVS A;  1KY7 A;  2VJ0 A;  5IYB P;  4WXA A;  1P5G X;  3HS8 A;  1HU0 A;  1QN4 A;  1WQA A;  2HZS A;  3OH6 A;  1JDY A;  3OST A;  2YA3 A;  2HL9 A;  1P5D X;  5EPC A;  3TE5 A;  4B0A A;  1QN3 A;  2QRC A;  3OLP A;  1QNC A;  2FKM X;  4IL8 A;  1EUV A;  2NOI A;  2JHN A;  2MZ8 A;  3KRM A;  3CW7 A;  1V5S A;  5BMP A;  1LWV A;  1QN7 A;  2NOL A;  1B9K A;  2QRD A;  2YH5 A;  3ENC A;  2D0A A;  2NOZ A;  2HKP A;  2Y8L A;  5IYD P;  3CWA A;  4D7Q A;  2IV8 A;  1KFQ A;  5JMV D;  4EJY A;  3PDK A;  1VTL E;  3F0Z A;  3RSM A;  3EAY A;  2H5A X;  1XSZ A;  2EHB D;  3OGD A;  1N3A A;  3OC3 C;  1JFI C;  3DPT A;  1PCZ A;  4QG5 A;  3PMG A;  3N89 A;  1NH2 A;  2G30 A;  1MPG A;  1K2Y X;  3F10 A;  5KL0 A;  4EAK A;  1R4X A;  1AIS A;  2LAE A;  1KFI A;  3VN5 A;  3DPU A;  1QTP A;  1TBA B;  2DKA A;  3UW2 A;  2Z0F A;  4DUL A;  1M3H A;  1KYU A;  1UT7 A;  2OOX A;  1EBM A;  1PCJ X;  2QLV A;  1YTB A;  2I5W A;  4C7P A;  3CWS A;  2O3O A;  3RPJ A;  2FGT A;  4EAL A;  2NOB A;  1RM1 A;  1QN9 A;  4ROE B;  3CWT A;  3ASM A;  5F9C A;  2XHI A;  3KTU A;  2NOH A;  3CWU A;  1MP9 A;  3CVS A;  5IYC P;  1TUO A;  2NOE A;  1KYD A;  3EIK A;  1C4G A;  2FUV A;  3C04 A;  3I3W A;  4ROC B;  1QNB A;  1YQM A;  3NA5 A;  1VKL A;  1PCM X;  2JPI A;  4EAI A;  3I0W A;  2NOF A;  4I8O A;  1YQL A;  4Q11 A;  3BKQ X;  1NGM A;  1D3U A;  2JOI A;  3H1Z A;  1CDW A;  4EJZ A;  3OH9 A;  2IV9 A;  3T4N A;  3I0X A;  1NVP A;  1PZD A;  2V92 A;  2Z8U A;  1J3M A;  1LWW A;  2NVM A;  1YQR A;  2QRE A;  3OCI A;  3D4V A;  1QNA A;  1N39 A;  1UT4 A;  2Y8Q A;  1C9B B;  4ROD B;  1QNE A;  2F7L A;  3OSE A;  1FN7 A;  1M5Q 1;  1KO9 A;  4MRQ A;  3ULX A;  1LWY A;  2FKF A;  3ENO C;  2ZFD B;  4WZS D;  2MJ7 A;  2NWV A;  2D0C A;  1T6A A;  3SNS A;  1KYF A;  3TDH A;  3D7Q A;  3IH7 A;  1KY6 A;  1VOK A;  4EAJ A;  1QN8 A;  1TBP A;  2V8Q A;  2D0B A;  2HL8 A;  4BJU A;  4D7R A;  1N3C A;  1DIZ A;  1QN6 A;  2QR1 A;  2R5X A;  1YTF A;  3CVT A;  1WJW A;  1K35 A;  2HZM A;  1TGH A;  1UL7 A;  4EAG A;  5BMN A;  1Q9U A;  1W80 A;  3HS9 A;  4CFF A;  5HSH A;  2JHJ A;  1VOL B;  4WX8 A;  2V9J A;  4HJH A;  1M3Q A;  2DKD A;  2OOY A;  2NLV A;  5AN4 A;  3OSM A;  1YQK A;  4PY5 A;  2DKC A;  1C47 A; 
#chains in the Genus database with same CATH homology
 4EAL A;  2Y8Q A;  2EHB D;  3OSE A;  2ZFD B;  2YA3 A;  3TE5 A;  3TDH A;  2QRC A;  4EAJ A;  4EAK A;  2V8Q A;  4EAI A;  2QR1 A;  3T4N A;  1UL7 A;  2OOX A;  4EAG A;  1V5S A;  4CFF A;  2QLV A;  2V92 A;  2QRD A;  2V9J A;  2QRE A;  2OOY A;  2Y8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...