2QLVA

Crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
133
Chain Sequence
YKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSLWTIKLRWKDLMKMVIQLFQNNYLVDFKFDGWESEMSTFSAYPFLHLTTKLIMELAVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/protein binding
molecule keywords Carbon catabolite derepressing protein kinase
publication title Crystal structure of the heterotrimer core of Saccharomyces cerevisiae AMPK homologue SNF1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 133
sequence length 171
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2qlvA01
4EAIA 3TE5A 2ZFDB 4EAJA 1V5SA 3OSEA 4EALA 2V9JA 2QRDA 2Y8LA 2QR1A 2OOXA 2V92A 1UL7A 2OOYA 4EAKA 3TDHA 2EHBD 2YA3A 4CFFA 3T4NA 2Y8QA 2V8QA 2QLVA 4EAGA 2QRCA 2QREA
chains in the Genus database with same CATH superfamily
3CWTA 1TGHA 1QN7A 1QN3A 4BJUA 1QN6A 3CWAA 4D7QA 1YQLA 2NOFA 3TE5A 3KTUA 1N3CA 1KFIA 2ZFDB 4EAJA 1NGMA 2H5AX 1PCMX 2F7LA 2I5WA 2V9JA 1JDYA 1PZDA 2D0BA 4B0AA 1C47A 3CW7A 1D3UA 2LAEA 5IYDP 1N3AA 2FKFA 4EJZA 1R4XA 2Y8LA 2NLVA 2V92A 2H4LX 1J3MA 1W80A 4MRQA 3ENOC 2JHJA 5IYBP 1VTLE 3RSMA 4PY5A 2NOEA 1JFIC 1MPGA 3RPJA 1UT4A 5KL0A 2NOBA 2HZSA 3BKQX 2VJ0A 2MZ8A 2QLVA 2PWWA 1WQAA 4QG5A 3ULXA 1UT7A 2D0AA 1WJWA 3N89A 3F10A 1HU0A 3H1ZA 1V5SA 1P5DX 4C7PA 3CWSA 2FKMX 4IL8A 1PCJX 3DPTA 3OC3C 1KY6A 2YH5A 2QREA 3I3WA 1C4GA 2FGTA 2Z8UA 3CVSA 4RODB 2QR1A 1FN7A 1LXTA 2DKAA 1M3HA 5F9CA 2OOYA 1QTPA 2O3OA 4WX8A 1YTBA 1VOKA 4EJYA 4EAKA 1VTOA 1KYFA 2NVMA 1TBAB 2DKCA 2HKPA 3ASMA 2XHIA 2HL9A 4D7RA 3CWUA 1KO9A 4TPSA 1QN4A 4WZSD 1M3QA 2Y8QA 2IV8A 3OH9A 1KY7A 5JN5A 5BMNA 1VOLB 1YQKA 1K35A 4EAIA 1QN5A 1T6AA 3C04A 2NOHA 1QTSA 1EBMA 3ENCA 1LWWA 3PDKA 1QNCA 1YTFA 2QRDA 3EAYA 3IH7A 3I0XA 3F0ZA 1N39A 1E42A 3D4VA 3I0WA 1M5Q1 2NWVA 1QNAA 1K2YX 1QNEA 2NOZA 1XSZA 2EHBD 3CVTA 5HSHA 4ROEB 4ROCB 3OSMA 1YQMA 3HS8A 1KYUA 3T4NA 4CFFA 2Z0FA 3OSTA 1TBPA 3NA5A 4Q11A 2V8QA 1P5GX 5JMVD 4WXAA 4EAGA 2QRCA 1QN9A 5AN4A 3OH6A 2DKDA 1LWYA 2JPIA 3VN5A 1QN8A 1PVSA 3DPUA 1NVPA 1DIZA 1NH2A 5EPCA 3OSEA 1C9BB 1QNBA 4EALA 3HS9A 1AISA 1YQRA 3OCIA 2IV9A 2FUVA 1EUVA 2JOIA 5IYCP 1UL7A 2OOXA 3PMGA 3SNSA 2G30A 2D0CA 3UW2A 3OGDA 3D7QA 4DULA 2R5XA 1MP9A 2MJ7A 3EIKA 1TUOA 1KYDA 3OLPA 1LWVA 3TDHA 2NOLA 2NOIA 3KRMA 2HZMA 2YA3A 1CDWA 1VKLA 1PCZA 4I8OA 4HJHA 1Q9UA 1B9KA 1KFQA 2JHNA 1RM1A 5BMPA 2HL8A
chains in the Genus database with same CATH topology
4EAIA 3TE5A 2ZFDB 4EAJA 1V5SA 3OSEA 4EALA 2V9JA 2QRDA 2Y8LA 2QR1A 2OOXA 2V92A 1UL7A 2OOYA 4EAKA 3TDHA 2EHBD 2YA3A 4CFFA 3T4NA 2Y8QA 2V8QA 2QLVA 4EAGA 2QRCA 2QREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAI A;  3TE5 A;  2ZFD B;  4EAJ A;  1V5S A;  3OSE A;  4EAL A;  2V9J A;  2QRD A;  2Y8L A;  2QR1 A;  2OOX A;  2V92 A;  1UL7 A;  2OOY A;  4EAK A;  3TDH A;  2EHB D;  2YA3 A;  4CFF A;  3T4N A;  2Y8Q A;  2V8Q A;  2QLV A;  4EAG A;  2QRC A;  2QRE A; 
#chains in the Genus database with same CATH topology
 3CWT A;  1TGH A;  1QN7 A;  1QN3 A;  4BJU A;  1QN6 A;  3CWA A;  4D7Q A;  1YQL A;  2NOF A;  3TE5 A;  3KTU A;  1N3C A;  1KFI A;  2ZFD B;  4EAJ A;  1NGM A;  2H5A X;  1PCM X;  2F7L A;  2I5W A;  2V9J A;  1JDY A;  1PZD A;  2D0B A;  4B0A A;  1C47 A;  3CW7 A;  1D3U A;  2LAE A;  5IYD P;  1N3A A;  2FKF A;  4EJZ A;  1R4X A;  2Y8L A;  2NLV A;  2V92 A;  2H4L X;  1J3M A;  1W80 A;  4MRQ A;  3ENO C;  2JHJ A;  5IYB P;  1VTL E;  3RSM A;  4PY5 A;  2NOE A;  1JFI C;  1MPG A;  3RPJ A;  1UT4 A;  5KL0 A;  2NOB A;  2HZS A;  3BKQ X;  2VJ0 A;  2MZ8 A;  2QLV A;  2PWW A;  1WQA A;  4QG5 A;  3ULX A;  1UT7 A;  2D0A A;  1WJW A;  3N89 A;  3F10 A;  1HU0 A;  3H1Z A;  1V5S A;  1P5D X;  4C7P A;  3CWS A;  2FKM X;  4IL8 A;  1PCJ X;  3DPT A;  3OC3 C;  1KY6 A;  2YH5 A;  2QRE A;  3I3W A;  1C4G A;  2FGT A;  2Z8U A;  3CVS A;  4ROD B;  2QR1 A;  1FN7 A;  1LXT A;  2DKA A;  1M3H A;  5F9C A;  2OOY A;  1QTP A;  2O3O A;  4WX8 A;  1YTB A;  1VOK A;  4EJY A;  4EAK A;  1VTO A;  1KYF A;  2NVM A;  1TBA B;  2DKC A;  2HKP A;  3ASM A;  2XHI A;  2HL9 A;  4D7R A;  3CWU A;  1KO9 A;  4TPS A;  1QN4 A;  4WZS D;  1M3Q A;  2Y8Q A;  2IV8 A;  3OH9 A;  1KY7 A;  5JN5 A;  5BMN A;  1VOL B;  1YQK A;  1K35 A;  4EAI A;  1QN5 A;  1T6A A;  3C04 A;  2NOH A;  1QTS A;  1EBM A;  3ENC A;  1LWW A;  3PDK A;  1QNC A;  1YTF A;  2QRD A;  3EAY A;  3IH7 A;  3I0X A;  3F0Z A;  1N39 A;  1E42 A;  3D4V A;  3I0W A;  1M5Q 1;  2NWV A;  1QNA A;  1K2Y X;  1QNE A;  2NOZ A;  1XSZ A;  2EHB D;  3CVT A;  5HSH A;  4ROE B;  4ROC B;  3OSM A;  1YQM A;  3HS8 A;  1KYU A;  3T4N A;  4CFF A;  2Z0F A;  3OST A;  1TBP A;  3NA5 A;  4Q11 A;  2V8Q A;  1P5G X;  5JMV D;  4WXA A;  4EAG A;  2QRC A;  1QN9 A;  5AN4 A;  3OH6 A;  2DKD A;  1LWY A;  2JPI A;  3VN5 A;  1QN8 A;  1PVS A;  3DPU A;  1NVP A;  1DIZ A;  1NH2 A;  5EPC A;  3OSE A;  1C9B B;  1QNB A;  4EAL A;  3HS9 A;  1AIS A;  1YQR A;  3OCI A;  2IV9 A;  2FUV A;  1EUV A;  2JOI A;  5IYC P;  1UL7 A;  2OOX A;  3PMG A;  3SNS A;  2G30 A;  2D0C A;  3UW2 A;  3OGD A;  3D7Q A;  4DUL A;  2R5X A;  1MP9 A;  2MJ7 A;  3EIK A;  1TUO A;  1KYD A;  3OLP A;  1LWV A;  3TDH A;  2NOL A;  2NOI A;  3KRM A;  2HZM A;  2YA3 A;  1CDW A;  1VKL A;  1PCZ A;  4I8O A;  4HJH A;  1Q9U A;  1B9K A;  1KFQ A;  2JHN A;  1RM1 A;  5BMP A;  2HL8 A; 
#chains in the Genus database with same CATH homology
 4EAI A;  3TE5 A;  2ZFD B;  4EAJ A;  1V5S A;  3OSE A;  4EAL A;  2V9J A;  2QRD A;  2Y8L A;  2QR1 A;  2OOX A;  2V92 A;  1UL7 A;  2OOY A;  4EAK A;  3TDH A;  2EHB D;  2YA3 A;  4CFF A;  3T4N A;  2Y8Q A;  2V8Q A;  2QLV A;  4EAG A;  2QRC A;  2QRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...