2HZSA

Structure of the mediator head submodule med8c/18/20
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
203
Chain Sequence
GKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLNEICDLAYQYVRALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II mediator complex subunit 20
publication title Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 48
structure length 203
sequence length 208
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.140.20 Mainly Beta Single Sheet q64v53_bacfr protein fold q64v53_bacfr protein fold 2hzsA02
3.30.310.180 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2hzsA01
2HZMA 2HZSA
chains in the Genus database with same CATH superfamily
3F0ZA 3ULXA 5BMPA 1M3QA 3TDHA 2OOYA 2V8QA 3PMGA 4EALA 3CWAA 1E42A 3HS8A 2FKFA 1KFQA 1QTSA 4EAGA 1PCJX 5IYDP 3I0XA 3VN5A 4CFFA 3EAYA 1QNEA 4DQYC 4DULA 1YQLA 1KY6A 1KYUA 1LXTA 4IL8A 1JFIC 3NA5A 1YQMA 1PCZA 2DKCA 1NGMA 3CVTA 1LWYA 3PDKA 1M3HA 1P5DX 1PZDA 1VKLA 3KRMA 4WX8A 1EBMA 2NOLA 3IH7A 3CWUA 1QN8A 2EOCA 1PCMX 1T6AA 1M5Q1 1VTLE 2H4LX 4C7PA 5F9CA 1MP9A 3OH9A 2RA8A 1KYDA 2QLVA 1WJWA 4I8OA 1NVPA 1KY7A 2HZSA 1QN7A 4D7QA 1FN7A 1QN3A 2IV8A 1VTOA 2HL9A 4EJZA 1UT4A 3EIKA 3ENCA 1NH2A 2JHJA 4QG5A 1QTPA 1RM1A 2G30A 3OSMA 2QR1A 4EJYA 1VOLB 1N39A 2EHBD 3HS9A 2QRCA 2XHIA 1KYFA 1K2YX 1Q9UA 1VOKA 2F7LA 1YTBA 3CVSA 3I3WA 1QN4A 2JPIA 1QNBA 3CW7A 3BKQX 4WZSD 1QNCA 3OGDA 1B9KA 1WQAA 1DIZA 4PY5A 1J3MA 1YTFA 1N3AA 1HU0A 1YQRA 1MPGA 2Z8UA 2YH5A 4BJUA 2FKMX 5BMNA 2VJ0A 1TBAB 2MJ7A 2I5WA 1JDYA 1CDWA 3DPTA 1D3UA 1KO9A 3DPUA 1LWVA 1C47A 1KFIA 2DKAA 4EAIA 1PVSA 2IV9A 2QRDA 3OCIA 3OC3C 3UW2A 2NOEA 2D0BA 1P5GX 3CWSA 4RODB 2D0AA 3I0WA 2NOZA 1UT7A 2NOIA 1UL7A 2CR9A 1QN6A 2QREA 5IYBP 2DKDA 2NOBA 3CWTA 2MZ8A 3T4NA 3KTUA 4EAJA 2LAEA 3N89A 2OOXA 2NOFA 2Y8QA 3ASMA 5AN4A 1K35A 1C4GA 4HJHA 2FUVA 2HL8A 1W80A 1XSZA 3SNSA 3F10A 1C9BB 4B0AA 4TPSA 2H5AX 5HSHA 2NVMA 3C04A 1QN9A 1AISA 2HZMA 4ROEB 4D7RA 2D0CA 3D4VA 2NWVA 3OLPA 1EUVA 3OSTA 2PWWA 1N3CA 2ZFDB 3RPJA 2FGTA 3RSMA 3TE5A 2NLVA 2Y8LA 3OSEA 4ROCB 2Z0FA 3OH6A 2HKPA 4WXAA 1TGHA 2V92A 4OQAC 2JHNA 1R4XA 2JOIA 4Q11A 1V5SA 4OPXC 3H1ZA 4EAKA 2YA3A 1QNAA 5KL0A 1TBPA 3ENOC 5EPCA 4OQBC 3D7QA 4MRQA 1YQKA 2R5XA 1QN5A 2O3OA 1LWWA 2NOHA 5JN5A 5JMVD 5IYCP 1TUOA 2V9JA
chains in the Genus database with same CATH topology
3F0ZA 3ULXA 1M3QA 1E42A 3HS8A 1QTSA 5IYDP 3I0XA 3VN5A 1QNEA 4DULA 1YQLA 1KY6A 1KYUA 1JFIC 1YQMA 1PCZA 1NGMA 1LWYA 1M3HA 1PZDA 3KRMA 1EBMA 2NOLA 3IH7A 1QN8A 1VTLE 1MP9A 1KYDA 4I8OA 1NVPA 1KY7A 2HZSA 1QN7A 1FN7A 1QN3A 2IV8A 1VTOA 4EJZA 1UT4A 3EIKA 1NH2A 1QTPA 1RM1A 2G30A 3OSMA 4EJYA 1VOLB 1N39A 3HS9A 2XHIA 1KYFA 1VOKA 1YTBA 1QN4A 1QNBA 4WZSD 1QNCA 4PY5A 1B9KA 1YTFA 1N3AA 1HU0A 1YQRA 2Z8UA 2YH5A 2VJ0A 1TBAB 2MJ7A 2I5WA 1CDWA 3DPTA 1D3UA 1KO9A 3DPUA 1LWVA 2IV9A 3OCIA 3OC3C 2NOEA 2D0BA 4RODB 2D0AA 3I0WA 2NOZA 1UT7A 2NOIA 1QN6A 5IYBP 2NOBA 2MZ8A 3KTUA 2LAEA 3N89A 2NOFA 3ASMA 5AN4A 1W80A 3SNSA 1C9BB 3F10A 4B0AA 4TPSA 1QN9A 1AISA 2HZMA 4ROEB 2D0CA 3OSTA 1N3CA 3RPJA 2FGTA 4ROCB 1TGHA 1R4XA 4Q11A 2JOIA 3H1ZA 1QNAA 1TBPA 1YQKA 1QN5A 2O3OA 1LWWA 2NOHA 5IYCP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZM A;  2HZS A; 
#chains in the Genus database with same CATH topology
 3F0Z A;  3ULX A;  5BMP A;  1M3Q A;  3TDH A;  2OOY A;  2V8Q A;  3PMG A;  4EAL A;  3CWA A;  1E42 A;  3HS8 A;  2FKF A;  1KFQ A;  1QTS A;  4EAG A;  1PCJ X;  5IYD P;  3I0X A;  3VN5 A;  4CFF A;  3EAY A;  1QNE A;  4DQY C;  4DUL A;  1YQL A;  1KY6 A;  1KYU A;  1LXT A;  4IL8 A;  1JFI C;  3NA5 A;  1YQM A;  1PCZ A;  2DKC A;  1NGM A;  3CVT A;  1LWY A;  3PDK A;  1M3H A;  1P5D X;  1PZD A;  1VKL A;  3KRM A;  4WX8 A;  1EBM A;  2NOL A;  3IH7 A;  3CWU A;  1QN8 A;  2EOC A;  1PCM X;  1T6A A;  1M5Q 1;  1VTL E;  2H4L X;  4C7P A;  5F9C A;  1MP9 A;  3OH9 A;  2RA8 A;  1KYD A;  2QLV A;  1WJW A;  4I8O A;  1NVP A;  1KY7 A;  2HZS A;  1QN7 A;  4D7Q A;  1FN7 A;  1QN3 A;  2IV8 A;  1VTO A;  2HL9 A;  4EJZ A;  1UT4 A;  3EIK A;  3ENC A;  1NH2 A;  2JHJ A;  4QG5 A;  1QTP A;  1RM1 A;  2G30 A;  3OSM A;  2QR1 A;  4EJY A;  1VOL B;  1N39 A;  2EHB D;  3HS9 A;  2QRC A;  2XHI A;  1KYF A;  1K2Y X;  1Q9U A;  1VOK A;  2F7L A;  1YTB A;  3CVS A;  3I3W A;  1QN4 A;  2JPI A;  1QNB A;  3CW7 A;  3BKQ X;  4WZS D;  1QNC A;  3OGD A;  1B9K A;  1WQA A;  1DIZ A;  4PY5 A;  1J3M A;  1YTF A;  1N3A A;  1HU0 A;  1YQR A;  1MPG A;  2Z8U A;  2YH5 A;  4BJU A;  2FKM X;  5BMN A;  2VJ0 A;  1TBA B;  2MJ7 A;  2I5W A;  1JDY A;  1CDW A;  3DPT A;  1D3U A;  1KO9 A;  3DPU A;  1LWV A;  1C47 A;  1KFI A;  2DKA A;  4EAI A;  1PVS A;  2IV9 A;  2QRD A;  3OCI A;  3OC3 C;  3UW2 A;  2NOE A;  2D0B A;  1P5G X;  3CWS A;  4ROD B;  2D0A A;  3I0W A;  2NOZ A;  1UT7 A;  2NOI A;  1UL7 A;  2CR9 A;  1QN6 A;  2QRE A;  5IYB P;  2DKD A;  2NOB A;  3CWT A;  2MZ8 A;  3T4N A;  3KTU A;  4EAJ A;  2LAE A;  3N89 A;  2OOX A;  2NOF A;  2Y8Q A;  3ASM A;  5AN4 A;  1K35 A;  1C4G A;  4HJH A;  2FUV A;  2HL8 A;  1W80 A;  1XSZ A;  3SNS A;  3F10 A;  1C9B B;  4B0A A;  4TPS A;  2H5A X;  5HSH A;  2NVM A;  3C04 A;  1QN9 A;  1AIS A;  2HZM A;  4ROE B;  4D7R A;  2D0C A;  3D4V A;  2NWV A;  3OLP A;  1EUV A;  3OST A;  2PWW A;  1N3C A;  2ZFD B;  3RPJ A;  2FGT A;  3RSM A;  3TE5 A;  2NLV A;  2Y8L A;  3OSE A;  4ROC B;  2Z0F A;  3OH6 A;  2HKP A;  4WXA A;  1TGH A;  2V92 A;  4OQA C;  2JHN A;  1R4X A;  2JOI A;  4Q11 A;  1V5S A;  4OPX C;  3H1Z A;  4EAK A;  2YA3 A;  1QNA A;  5KL0 A;  1TBP A;  3ENO C;  5EPC A;  4OQB C;  3D7Q A;  4MRQ A;  1YQK A;  2R5X A;  1QN5 A;  2O3O A;  1LWW A;  2NOH A;  5JN5 A;  5JMV D;  5IYC P;  1TUO A;  2V9J A; 
#chains in the Genus database with same CATH homology
 3F0Z A;  3ULX A;  1M3Q A;  1E42 A;  3HS8 A;  1QTS A;  5IYD P;  3I0X A;  3VN5 A;  1QNE A;  4DUL A;  1YQL A;  1KY6 A;  1KYU A;  1JFI C;  1YQM A;  1PCZ A;  1NGM A;  1LWY A;  1M3H A;  1PZD A;  3KRM A;  1EBM A;  2NOL A;  3IH7 A;  1QN8 A;  1VTL E;  1MP9 A;  1KYD A;  4I8O A;  1NVP A;  1KY7 A;  2HZS A;  1QN7 A;  1FN7 A;  1QN3 A;  2IV8 A;  1VTO A;  4EJZ A;  1UT4 A;  3EIK A;  1NH2 A;  1QTP A;  1RM1 A;  2G30 A;  3OSM A;  4EJY A;  1VOL B;  1N39 A;  3HS9 A;  2XHI A;  1KYF A;  1VOK A;  1YTB A;  1QN4 A;  1QNB A;  4WZS D;  1QNC A;  4PY5 A;  1B9K A;  1YTF A;  1N3A A;  1HU0 A;  1YQR A;  2Z8U A;  2YH5 A;  2VJ0 A;  1TBA B;  2MJ7 A;  2I5W A;  1CDW A;  3DPT A;  1D3U A;  1KO9 A;  3DPU A;  1LWV A;  2IV9 A;  3OCI A;  3OC3 C;  2NOE A;  2D0B A;  4ROD B;  2D0A A;  3I0W A;  2NOZ A;  1UT7 A;  2NOI A;  1QN6 A;  5IYB P;  2NOB A;  2MZ8 A;  3KTU A;  2LAE A;  3N89 A;  2NOF A;  3ASM A;  5AN4 A;  1W80 A;  3SNS A;  1C9B B;  3F10 A;  4B0A A;  4TPS A;  1QN9 A;  1AIS A;  2HZM A;  4ROE B;  2D0C A;  3OST A;  1N3C A;  3RPJ A;  2FGT A;  4ROC B;  1TGH A;  1R4X A;  4Q11 A;  2JOI A;  3H1Z A;  1QNA A;  1TBP A;  1YQK A;  1QN5 A;  2O3O A;  1LWW A;  2NOH A;  5IYC P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...