2HZSA

Structure of the mediator head submodule med8c/18/20
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
208
structure length
203
Chain Sequence
GKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLNEICDLAYQYVRALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II mediator complex subunit 20
publication title Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 48
structure length 203
sequence length 208
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.140.20 Mainly Beta Single Sheet q64v53_bacfr protein fold q64v53_bacfr protein fold 2hzsA02
3.30.310.180 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2hzsA01
2HZSA 2HZMA
chains in the Genus database with same CATH superfamily
3EIKA 4OQBC 1VOLB 3CVSA 2JOIA 4DQYC 2IV8A 2EOCA 1LWVA 1KFIA 2F7LA 2FGTA 1M3HA 5HSHA 1AISA 2H4LX 2HZSA 3H1ZA 1QTSA 5BMPA 1LWWA 2PWWA 1YQMA 2D0CA 2O3OA 4CFFA 1TUOA 5JN5A 2NOLA 3D4VA 3NA5A 2DKCA 1P5GX 3CWUA 1PCMX 2ZFDB 3T4NA 4C7PA 2QRDA 1QNCA 3C04A 2EHBD 1PZDA 3OSEA 2XHIA 1TBPA 4B0AA 1QNBA 1K2YX 2DKDA 3RPJA 2NOHA 4PY5A 4MRQA 1T6AA 3CW7A 4WXAA 3ASMA 2CR9A 3N89A 2MZ8A 1KY7A 2FKMX 3OLPA 1NGMA 1HU0A 4DULA 1M3QA 5EPCA 1R4XA 3EAYA 1QN8A 1UT4A 1YQRA 1QN7A 1KYDA 1QTPA 1FN7A 1QN3A 5AN4A 2VJ0A 3F0ZA 4OQAC 4BJUA 1JDYA 1V5SA 1DIZA 3PDKA 3IH7A 4WZSD 3RSMA 4HJHA 1TBAB 4I8OA 1E42A 1YQLA 2NOBA 1VTOA 3CVTA 1C9BB 2NLVA 3VN5A 1Q9UA 1NVPA 1J3MA 3KRMA 3ENOC 4TPSA 4ROCB 1RM1A 1KO9A 1QN6A 5IYDP 2MJ7A 2NWVA 1D3UA 3HS8A 3OSMA 3CWAA 2R5XA 1LWYA 4IL8A 4WX8A 1KFQA 3I0XA 2YH5A 3F10A 2JHJA 1KY6A 3ENCA 2HZMA 2HL9A 3OH6A 1NH2A 4EAIA 1KYFA 3ULXA 2NOEA 3KTUA 5BMNA 1KYUA 1PCJX 5F9CA 1QNEA 4Q11A 2D0AA 1YQKA 1N39A 2OOYA 4EAGA 2Z0FA 3OC3C 4EJZA 4ROEB 3UW2A 3OGDA 2Y8LA 2NOIA 5IYCP 2V8QA 1M5Q1 1B9KA 1C47A 2FKFA 2JHNA 3DPUA 2FUVA 5KL0A 2NVMA 4EJYA 3D7QA 2YA3A 3HS9A 4EALA 1MP9A 3DPTA 2HL8A 2QR1A 4OPXC 1EUVA 1P5DX 1CDWA 3I3WA 1K35A 2QRCA 2V9JA 1VOKA 2Y8QA 1N3CA 1QN5A 1TGHA 1WQAA 2Z8UA 4D7QA 4EAJA 1WJWA 3I0WA 2V92A 5JMVD 3OSTA 4D7RA 2OOXA 4EAKA 1VTLE 2JPIA 1PVSA 1QN4A 1QNAA 2NOFA 1UL7A 2IV9A 2QLVA 1QN9A 1C4GA 2D0BA 3OH9A 2NOZA 2I5WA 1MPGA 2H5AX 1UT7A 5IYBP 1LXTA 1EBMA 2G30A 3PMGA 1XSZA 3TE5A 1N3AA 1YTBA 3CWSA 2DKAA 1PCZA 2HKPA 3SNSA 4RODB 1YTFA 1JFIC 3OCIA 1W80A 3TDHA 2LAEA 2RA8A 3CWTA 3BKQX 1VKLA 4QG5A 2QREA
chains in the Genus database with same CATH topology
3EIKA 1VOLB 2JOIA 2IV8A 1LWVA 2FGTA 1M3HA 1AISA 2HZSA 3H1ZA 1QTSA 1LWWA 1YQMA 2D0CA 2O3OA 2NOLA 1QNCA 1PZDA 2XHIA 1TBPA 4B0AA 1QNBA 3RPJA 2NOHA 4PY5A 3ASMA 3N89A 2MZ8A 1KY7A 1NGMA 1HU0A 4DULA 1M3QA 1R4XA 1QN8A 1UT4A 1YQRA 1QN7A 1KYDA 1QTPA 1FN7A 1QN3A 5AN4A 2VJ0A 3F0ZA 3IH7A 4WZSD 1TBAB 4I8OA 1E42A 1YQLA 2NOBA 1VTOA 1C9BB 3VN5A 1NVPA 3KRMA 4ROCB 1RM1A 1KO9A 1QN6A 5IYDP 2MJ7A 1D3UA 3HS8A 3OSMA 1LWYA 3I0XA 2YH5A 3F10A 1KY6A 2HZMA 2NOEA 1NH2A 1KYFA 3ULXA 3KTUA 1KYUA 1QNEA 4Q11A 2D0AA 1YQKA 1N39A 3OC3C 4EJZA 4ROEB 2NOIA 5IYCP 1B9KA 3DPUA 4EJYA 3HS9A 1MP9A 3DPTA 1CDWA 1TGHA 1N3CA 1VOKA 1QN5A 2Z8UA 3I0WA 3OSTA 1QNAA 1VTLE 1QN4A 2NOFA 2IV9A 1QN9A 2NOZA 2D0BA 2I5WA 1UT7A 5IYBP 1EBMA 2G30A 1YTBA 1N3AA 1PCZA 3SNSA 4RODB 1YTFA 1JFIC 3OCIA 1W80A 2LAEA 4TPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZS A;  2HZM A; 
#chains in the Genus database with same CATH topology
 3EIK A;  4OQB C;  1VOL B;  3CVS A;  2JOI A;  4DQY C;  2IV8 A;  2EOC A;  1LWV A;  1KFI A;  2F7L A;  2FGT A;  1M3H A;  5HSH A;  1AIS A;  2H4L X;  2HZS A;  3H1Z A;  1QTS A;  5BMP A;  1LWW A;  2PWW A;  1YQM A;  2D0C A;  2O3O A;  4CFF A;  1TUO A;  5JN5 A;  2NOL A;  3D4V A;  3NA5 A;  2DKC A;  1P5G X;  3CWU A;  1PCM X;  2ZFD B;  3T4N A;  4C7P A;  2QRD A;  1QNC A;  3C04 A;  2EHB D;  1PZD A;  3OSE A;  2XHI A;  1TBP A;  4B0A A;  1QNB A;  1K2Y X;  2DKD A;  3RPJ A;  2NOH A;  4PY5 A;  4MRQ A;  1T6A A;  3CW7 A;  4WXA A;  3ASM A;  2CR9 A;  3N89 A;  2MZ8 A;  1KY7 A;  2FKM X;  3OLP A;  1NGM A;  1HU0 A;  4DUL A;  1M3Q A;  5EPC A;  1R4X A;  3EAY A;  1QN8 A;  1UT4 A;  1YQR A;  1QN7 A;  1KYD A;  1QTP A;  1FN7 A;  1QN3 A;  5AN4 A;  2VJ0 A;  3F0Z A;  4OQA C;  4BJU A;  1JDY A;  1V5S A;  1DIZ A;  3PDK A;  3IH7 A;  4WZS D;  3RSM A;  4HJH A;  1TBA B;  4I8O A;  1E42 A;  1YQL A;  2NOB A;  1VTO A;  3CVT A;  1C9B B;  2NLV A;  3VN5 A;  1Q9U A;  1NVP A;  1J3M A;  3KRM A;  3ENO C;  4TPS A;  4ROC B;  1RM1 A;  1KO9 A;  1QN6 A;  5IYD P;  2MJ7 A;  2NWV A;  1D3U A;  3HS8 A;  3OSM A;  3CWA A;  2R5X A;  1LWY A;  4IL8 A;  4WX8 A;  1KFQ A;  3I0X A;  2YH5 A;  3F10 A;  2JHJ A;  1KY6 A;  3ENC A;  2HZM A;  2HL9 A;  3OH6 A;  1NH2 A;  4EAI A;  1KYF A;  3ULX A;  2NOE A;  3KTU A;  5BMN A;  1KYU A;  1PCJ X;  5F9C A;  1QNE A;  4Q11 A;  2D0A A;  1YQK A;  1N39 A;  2OOY A;  4EAG A;  2Z0F A;  3OC3 C;  4EJZ A;  4ROE B;  3UW2 A;  3OGD A;  2Y8L A;  2NOI A;  5IYC P;  2V8Q A;  1M5Q 1;  1B9K A;  1C47 A;  2FKF A;  2JHN A;  3DPU A;  2FUV A;  5KL0 A;  2NVM A;  4EJY A;  3D7Q A;  2YA3 A;  3HS9 A;  4EAL A;  1MP9 A;  3DPT A;  2HL8 A;  2QR1 A;  4OPX C;  1EUV A;  1P5D X;  1CDW A;  3I3W A;  1K35 A;  2QRC A;  2V9J A;  1VOK A;  2Y8Q A;  1N3C A;  1QN5 A;  1TGH A;  1WQA A;  2Z8U A;  4D7Q A;  4EAJ A;  1WJW A;  3I0W A;  2V92 A;  5JMV D;  3OST A;  4D7R A;  2OOX A;  4EAK A;  1VTL E;  2JPI A;  1PVS A;  1QN4 A;  1QNA A;  2NOF A;  1UL7 A;  2IV9 A;  2QLV A;  1QN9 A;  1C4G A;  2D0B A;  3OH9 A;  2NOZ A;  2I5W A;  1MPG A;  2H5A X;  1UT7 A;  5IYB P;  1LXT A;  1EBM A;  2G30 A;  3PMG A;  1XSZ A;  3TE5 A;  1N3A A;  1YTB A;  3CWS A;  2DKA A;  1PCZ A;  2HKP A;  3SNS A;  4ROD B;  1YTF A;  1JFI C;  3OCI A;  1W80 A;  3TDH A;  2LAE A;  2RA8 A;  3CWT A;  3BKQ X;  1VKL A;  4QG5 A;  2QRE A; 
#chains in the Genus database with same CATH homology
 3EIK A;  1VOL B;  2JOI A;  2IV8 A;  1LWV A;  2FGT A;  1M3H A;  1AIS A;  2HZS A;  3H1Z A;  1QTS A;  1LWW A;  1YQM A;  2D0C A;  2O3O A;  2NOL A;  1QNC A;  1PZD A;  2XHI A;  1TBP A;  4B0A A;  1QNB A;  3RPJ A;  2NOH A;  4PY5 A;  3ASM A;  3N89 A;  2MZ8 A;  1KY7 A;  1NGM A;  1HU0 A;  4DUL A;  1M3Q A;  1R4X A;  1QN8 A;  1UT4 A;  1YQR A;  1QN7 A;  1KYD A;  1QTP A;  1FN7 A;  1QN3 A;  5AN4 A;  2VJ0 A;  3F0Z A;  3IH7 A;  4WZS D;  1TBA B;  4I8O A;  1E42 A;  1YQL A;  2NOB A;  1VTO A;  1C9B B;  3VN5 A;  1NVP A;  3KRM A;  4ROC B;  1RM1 A;  1KO9 A;  1QN6 A;  5IYD P;  2MJ7 A;  1D3U A;  3HS8 A;  3OSM A;  1LWY A;  3I0X A;  2YH5 A;  3F10 A;  1KY6 A;  2HZM A;  2NOE A;  1NH2 A;  1KYF A;  3ULX A;  3KTU A;  1KYU A;  1QNE A;  4Q11 A;  2D0A A;  1YQK A;  1N39 A;  3OC3 C;  4EJZ A;  4ROE B;  2NOI A;  5IYC P;  1B9K A;  3DPU A;  4EJY A;  3HS9 A;  1MP9 A;  3DPT A;  1CDW A;  1TGH A;  1N3C A;  1VOK A;  1QN5 A;  2Z8U A;  3I0W A;  3OST A;  1QNA A;  1VTL E;  1QN4 A;  2NOF A;  2IV9 A;  1QN9 A;  2NOZ A;  2D0B A;  2I5W A;  1UT7 A;  5IYB P;  1EBM A;  2G30 A;  1YTB A;  1N3A A;  1PCZ A;  3SNS A;  4ROD B;  1YTF A;  1JFI C;  3OCI A;  1W80 A;  2LAE A;  4TPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...