1NVPA

Human tfiia/tbp/dna complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
180
structure length
180
Chain Sequence
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*G)-3'
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nvpA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nvpA02
1JFIC 1NGMA 1PCZA 2IV8A 2Z8UA 2D0AA 2D0BA 3H1ZA 4B0AA 4ROEB 2IV9A 1QN4A 1QNAA 1QN9A 1RM1A 1YTFA 1B9KA 1VOKA 1KYUA 1E42A 1QNBA 2VJ0A 1QNCA 3VN5A 1KYFA 5IYDP 1PZDA 1C9BB 3OCIA 3HS8A 1VOLB 1QN6A 1QN5A 4RODB 1MP9A 1TBPA 1AISA 1D3UA 4PY5A 1KYDA 1KY7A 1W80A 1QN3A 1CDWA 1NH2A 5IYCP 3HS9A 1TBAB 1TGHA 1VTLE 1KY6A 4ROCB 1NVPA 3ASMA 1VTOA 1QN8A 1R4XA 5IYBP 4WZSD 1QN7A 1QNEA 2D0CA 2G30A 3OC3C 2MJ7A 1QTPA 1YTBA 1QTSA 3EIKA
chains in the Genus database with same CATH superfamily
2NOBA 3CWAA 4BJUA 1XSZA 2LAEA 3H1ZA 2V9JA 2D0BA 2DKCA 2XHIA 1QNAA 2Y8LA 3OH6A 1YTFA 1B9KA 4HJHA 2JPIA 2YH5A 2DKAA 3TE5A 2FKMX 1V5SA 3VN5A 5IYDP 4CFFA 1PZDA 1C47A 3DPUA 3I0XA 1UL7A 2DKDA 3D4VA 5BMNA 2O3OA 1LWYA 3F0ZA 4WXAA 2HZSA 4EJZA 3PDKA 2EHBD 3DPTA 1N39A 1WJWA 4C7PA 4QG5A 1J3MA 1KY6A 1K2YX 3NA5A 3ASMA 3OSEA 1VTOA 1NVPA 4MRQA 3ULXA 1R4XA 3EAYA 1QNEA 2D0CA 3N89A 2Z0FA 4EAGA 1C4GA 2FKFA 2OOXA 1YTBA 2H5AX 2NOHA 1NGMA 1PCZA 2IV8A 2Z8UA 4B0AA 3IH7A 1YQMA 2IV9A 3D7QA 1QN9A 1P5GX 1HU0A 1KYUA 4EAKA 5JMVD 2VJ0A 4EAIA 2HL9A 2NOLA 2V92A 1WQAA 2NWVA 3CWUA 4I8OA 3ENOC 2PWWA 3ENCA 3CWTA 5F9CA 3OLPA 1QN5A 2NOEA 1KO9A 2NVMA 2HZMA 2FUVA 1QN3A 1NH2A 5IYCP 1YQRA 1TBAB 2NLVA 2QLVA 5BMPA 2Y8QA 4EJYA 3KRMA 1YQLA 3F10A 1T6AA 1UT7A 1QN7A 3CW7A 3T4NA 1Q9UA 2H4LX 1JDYA 2OOYA 2V8QA 1K35A 1LWVA 4WX8A 4IL8A 2I5WA 3EIKA 1PCMX 1TUOA 2QREA 3RSMA 4D7QA 5HSHA 1QN4A 2NOZA 4ROEB 4EALA 2QRCA 4Q11A 1QNBA 1PCJX 1E42A 1QNCA 4TPSA 1EBMA 3OSTA 3OCIA 3HS8A 1VOLB 1QN6A 1UT4A 4RODB 4D7RA 1EUVA 3SNSA 1YQKA 1AISA 1D3UA 4PY5A 1W80A 1LXTA 1CDWA 5AN4A 1M3QA 1TGHA 4ROCB 3KTUA 2JOIA 3I0WA 2G30A 1PVSA 2MZ8A 2JHNA 1JFIC 1M3HA 3TDHA 1QN8A 2D0AA 2QRDA 2QR1A 5EPCA 2NOIA 1RM1A 3CVSA 1VOKA 3C04A 3PMGA 3I3WA 3OSMA 2HL8A 1KFQA 4DULA 3CWSA 1KYFA 1N3CA 1C9BB 2ZFDB 5KL0A 4EAJA 1MP9A 1TBPA 2JHJA 1KYDA 1KY7A 1DIZA 5JN5A 3UW2A 3HS9A 2YA3A 1VTLE 1LWWA 3OH9A 1P5DX 2FGTA 3BKQX 1FN7A 2F7LA 2HKPA 1KFIA 1M5Q1 3RPJA 5IYBP 4WZSD 3OGDA 1N3AA 3CVTA 2NOFA 3OC3C 2MJ7A 1QTPA 2R5XA 1VKLA 1QTSA 1MPGA
chains in the Genus database with same CATH topology
2NOBA 2LAEA 3H1ZA 2D0BA 2XHIA 1QNAA 1YTFA 1B9KA 2YH5A 3VN5A 5IYDP 1PZDA 3DPUA 3I0XA 1LWYA 2O3OA 3F0ZA 2HZSA 4EJZA 1N39A 3DPTA 1KY6A 1NVPA 1VTOA 3ULXA 1R4XA 1QNEA 2D0CA 3N89A 1YTBA 2NOHA 1NGMA 1PCZA 2IV8A 2Z8UA 4B0AA 3IH7A 1YQMA 2IV9A 1QN9A 1HU0A 1KYUA 2VJ0A 2NOLA 4I8OA 1QN5A 2NOEA 1KO9A 2HZMA 1QN3A 1NH2A 5IYCP 1YQRA 1TBAB 4EJYA 3KRMA 1YQLA 3F10A 1UT7A 1QN7A 1LWVA 2I5WA 3EIKA 1QN4A 2NOZA 4ROEB 4Q11A 1QNBA 1E42A 1QNCA 4TPSA 1EBMA 3OSTA 3OCIA 3HS8A 1VOLB 1QN6A 1UT4A 4RODB 3SNSA 1YQKA 4PY5A 1AISA 1D3UA 1W80A 1CDWA 5AN4A 1M3QA 1TGHA 4ROCB 3KTUA 2JOIA 3I0WA 2G30A 2MZ8A 1JFIC 1M3HA 1QN8A 2D0AA 2NOIA 1RM1A 1VOKA 3OSMA 4DULA 1KYFA 1N3CA 1C9BB 1MP9A 1TBPA 1KYDA 1KY7A 1QTPA 3HS9A 1VTLE 1LWWA 2FGTA 1FN7A 3RPJA 1N3AA 5IYBP 4WZSD 2NOFA 3OC3C 2MJ7A 3ASMA 1QTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFI C;  1NGM A;  1PCZ A;  2IV8 A;  2Z8U A;  2D0A A;  2D0B A;  3H1Z A;  4B0A A;  4ROE B;  2IV9 A;  1QN4 A;  1QNA A;  1QN9 A;  1RM1 A;  1YTF A;  1B9K A;  1VOK A;  1KYU A;  1E42 A;  1QNB A;  2VJ0 A;  1QNC A;  3VN5 A;  1KYF A;  5IYD P;  1PZD A;  1C9B B;  3OCI A;  3HS8 A;  1VOL B;  1QN6 A;  1QN5 A;  4ROD B;  1MP9 A;  1TBP A;  1AIS A;  1D3U A;  4PY5 A;  1KYD A;  1KY7 A;  1W80 A;  1QN3 A;  1CDW A;  1NH2 A;  5IYC P;  3HS9 A;  1TBA B;  1TGH A;  1VTL E;  1KY6 A;  4ROC B;  1NVP A;  3ASM A;  1VTO A;  1QN8 A;  1R4X A;  5IYB P;  4WZS D;  1QN7 A;  1QNE A;  2D0C A;  2G30 A;  3OC3 C;  2MJ7 A;  1QTP A;  1YTB A;  1QTS A;  3EIK A; 
#chains in the Genus database with same CATH topology
 2NOB A;  3CWA A;  4BJU A;  1XSZ A;  2LAE A;  3H1Z A;  2V9J A;  2D0B A;  2DKC A;  2XHI A;  1QNA A;  2Y8L A;  3OH6 A;  1YTF A;  1B9K A;  4HJH A;  2JPI A;  2YH5 A;  2DKA A;  3TE5 A;  2FKM X;  1V5S A;  3VN5 A;  5IYD P;  4CFF A;  1PZD A;  1C47 A;  3DPU A;  3I0X A;  1UL7 A;  2DKD A;  3D4V A;  5BMN A;  2O3O A;  1LWY A;  3F0Z A;  4WXA A;  2HZS A;  4EJZ A;  3PDK A;  2EHB D;  3DPT A;  1N39 A;  1WJW A;  4C7P A;  4QG5 A;  1J3M A;  1KY6 A;  1K2Y X;  3NA5 A;  3ASM A;  3OSE A;  1VTO A;  1NVP A;  4MRQ A;  3ULX A;  1R4X A;  3EAY A;  1QNE A;  2D0C A;  3N89 A;  2Z0F A;  4EAG A;  1C4G A;  2FKF A;  2OOX A;  1YTB A;  2H5A X;  2NOH A;  1NGM A;  1PCZ A;  2IV8 A;  2Z8U A;  4B0A A;  3IH7 A;  1YQM A;  2IV9 A;  3D7Q A;  1QN9 A;  1P5G X;  1HU0 A;  1KYU A;  4EAK A;  5JMV D;  2VJ0 A;  4EAI A;  2HL9 A;  2NOL A;  2V92 A;  1WQA A;  2NWV A;  3CWU A;  4I8O A;  3ENO C;  2PWW A;  3ENC A;  3CWT A;  5F9C A;  3OLP A;  1QN5 A;  2NOE A;  1KO9 A;  2NVM A;  2HZM A;  2FUV A;  1QN3 A;  1NH2 A;  5IYC P;  1YQR A;  1TBA B;  2NLV A;  2QLV A;  5BMP A;  2Y8Q A;  4EJY A;  3KRM A;  1YQL A;  3F10 A;  1T6A A;  1UT7 A;  1QN7 A;  3CW7 A;  3T4N A;  1Q9U A;  2H4L X;  1JDY A;  2OOY A;  2V8Q A;  1K35 A;  1LWV A;  4WX8 A;  4IL8 A;  2I5W A;  3EIK A;  1PCM X;  1TUO A;  2QRE A;  3RSM A;  4D7Q A;  5HSH A;  1QN4 A;  2NOZ A;  4ROE B;  4EAL A;  2QRC A;  4Q11 A;  1QNB A;  1PCJ X;  1E42 A;  1QNC A;  4TPS A;  1EBM A;  3OST A;  3OCI A;  3HS8 A;  1VOL B;  1QN6 A;  1UT4 A;  4ROD B;  4D7R A;  1EUV A;  3SNS A;  1YQK A;  1AIS A;  1D3U A;  4PY5 A;  1W80 A;  1LXT A;  1CDW A;  5AN4 A;  1M3Q A;  1TGH A;  4ROC B;  3KTU A;  2JOI A;  3I0W A;  2G30 A;  1PVS A;  2MZ8 A;  2JHN A;  1JFI C;  1M3H A;  3TDH A;  1QN8 A;  2D0A A;  2QRD A;  2QR1 A;  5EPC A;  2NOI A;  1RM1 A;  3CVS A;  1VOK A;  3C04 A;  3PMG A;  3I3W A;  3OSM A;  2HL8 A;  1KFQ A;  4DUL A;  3CWS A;  1KYF A;  1N3C A;  1C9B B;  2ZFD B;  5KL0 A;  4EAJ A;  1MP9 A;  1TBP A;  2JHJ A;  1KYD A;  1KY7 A;  1DIZ A;  5JN5 A;  3UW2 A;  3HS9 A;  2YA3 A;  1VTL E;  1LWW A;  3OH9 A;  1P5D X;  2FGT A;  3BKQ X;  1FN7 A;  2F7L A;  2HKP A;  1KFI A;  1M5Q 1;  3RPJ A;  5IYB P;  4WZS D;  3OGD A;  1N3A A;  3CVT A;  2NOF A;  3OC3 C;  2MJ7 A;  1QTP A;  2R5X A;  1VKL A;  1QTS A;  1MPG A; 
#chains in the Genus database with same CATH homology
 2NOB A;  2LAE A;  3H1Z A;  2D0B A;  2XHI A;  1QNA A;  1YTF A;  1B9K A;  2YH5 A;  3VN5 A;  5IYD P;  1PZD A;  3DPU A;  3I0X A;  1LWY A;  2O3O A;  3F0Z A;  2HZS A;  4EJZ A;  1N39 A;  3DPT A;  1KY6 A;  1NVP A;  1VTO A;  3ULX A;  1R4X A;  1QNE A;  2D0C A;  3N89 A;  1YTB A;  2NOH A;  1NGM A;  1PCZ A;  2IV8 A;  2Z8U A;  4B0A A;  3IH7 A;  1YQM A;  2IV9 A;  1QN9 A;  1HU0 A;  1KYU A;  2VJ0 A;  2NOL A;  4I8O A;  1QN5 A;  2NOE A;  1KO9 A;  2HZM A;  1QN3 A;  1NH2 A;  5IYC P;  1YQR A;  1TBA B;  4EJY A;  3KRM A;  1YQL A;  3F10 A;  1UT7 A;  1QN7 A;  1LWV A;  2I5W A;  3EIK A;  1QN4 A;  2NOZ A;  4ROE B;  4Q11 A;  1QNB A;  1E42 A;  1QNC A;  4TPS A;  1EBM A;  3OST A;  3OCI A;  3HS8 A;  1VOL B;  1QN6 A;  1UT4 A;  4ROD B;  3SNS A;  1YQK A;  4PY5 A;  1AIS A;  1D3U A;  1W80 A;  1CDW A;  5AN4 A;  1M3Q A;  1TGH A;  4ROC B;  3KTU A;  2JOI A;  3I0W A;  2G30 A;  2MZ8 A;  1JFI C;  1M3H A;  1QN8 A;  2D0A A;  2NOI A;  1RM1 A;  1VOK A;  3OSM A;  4DUL A;  1KYF A;  1N3C A;  1C9B B;  1MP9 A;  1TBP A;  1KYD A;  1KY7 A;  1QTP A;  3HS9 A;  1VTL E;  1LWW A;  2FGT A;  1FN7 A;  3RPJ A;  1N3A A;  5IYB P;  4WZS D;  2NOF A;  3OC3 C;  2MJ7 A;  3ASM A;  1QTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...