3OC3C

Crystal structure of the mot1 n-terminal domain in complex with tbp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
178
structure length
178
Chain Sequence
SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HELICASE MOT1
publication title Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Hydrolase/transcription
total genus 42
structure length 178
sequence length 178
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3oc3C01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3oc3C02
1E42A 1YTBA 1VOLB 3H1ZA 1PCZA 2D0BA 1QN5A 1YTFA 1R4XA 4WZSD 1KYFA 1VTOA 1NGMA 1MP9A 1QNBA 1QNAA 1JFIC 4RODB 1QN4A 1QNCA 1KY6A 3HS8A 1QN6A 1KYDA 2IV8A 4B0AA 4ROEB 2D0CA 2MJ7A 1QNEA 2G30A 3VN5A 1QTSA 1VTLE 1QTPA 1TBPA 3HS9A 5IYBP 5IYCP 2D0AA 1QN3A 1NH2A 1QN7A 3ASMA 3OCIA 1W80A 4PY5A 1D3UA 1TGHA 2IV9A 3EIKA 5IYDP 4ROCB 1B9KA 1PZDA 1KY7A 1RM1A 1NVPA 1CDWA 1TBAB 3OC3C 1QN9A 1KYUA 1AISA 1VOKA 2VJ0A 1C9BB 2Z8UA 1QN8A
chains in the Genus database with same CATH superfamily
1E42A 2V8QA 1M3HA 1N3AA 2NOHA 4D7QA 1R4XA 1T6AA 2R5XA 4WZSD 1KYFA 1VTOA 1QNBA 3SNSA 1QNCA 3HS8A 3I3WA 5JMVD 4B0AA 1MPGA 1WQAA 2IV8A 3CWUA 3ENCA 1VTLE 1QTSA 1EUVA 2O3OA 1C47A 4EJZA 1P5GX 1K2YX 4DULA 1M3QA 4WXAA 1PCJX 2NOFA 3I0XA 1YQRA 5IYDP 1P5DX 3NA5A 1B9KA 1PZDA 3D4VA 4EJYA 3OC3C 1N3CA 1AISA 2HKPA 1TBPA 1UT7A 1KO9A 3EIKA 3UW2A 1YQLA 1C9BB 1QN8A 4HJHA 3RPJA 2NLVA 2NOLA 2QREA 1LWWA 3OSMA 1NGMA 1QNAA 2NWVA 4QG5A 1DIZA 1UL7A 1N39A 2QRDA 2I5WA 1QN6A 1KYDA 2HZSA 1Q9UA 1TUOA 2NVMA 2FGTA 2HL8A 3TDHA 4EAJA 5BMNA 3F10A 3OH6A 2G30A 3TE5A 3CWTA 2NOZA 1EBMA 1PCMX 1QN3A 2D0AA 3PMGA 4I8OA 3RSMA 1QN7A 3ASMA 3OCIA 1W80A 2Y8QA 1WJWA 2JPIA 2LAEA 3C04A 3IH7A 1TGHA 4ROCB 5HSHA 4EAKA 3KTUA 1NVPA 1CDWA 2JHJA 3OSEA 2DKAA 1JDYA 2H5AX 2OOYA 3KRMA 3CVTA 1V5SA 1VKLA 1VOLB 1YQMA 4EAIA 3OGDA 1PCZA 3CW7A 1QN5A 4WX8A 1YTFA 5JN5A 5AN4A 1K35A 2MZ8A 2H4LX 1JFIC 1QN4A 3EAYA 4C7PA 1PVSA 4EALA 1HU0A 2FKMX 3ULXA 2XHIA 4ROEB 2YA3A 2D0CA 4Q11A 3N89A 4BJUA 4IL8A 1QNEA 2JHNA 1QTPA 3HS9A 3D7QA 5IYCP 2Z0FA 2V92A 3OH9A 2YH5A 2Y8LA 1D3UA 2F7LA 2IV9A 1RM1A 2FKFA 1TBAB 2HL9A 2QLVA 3DPUA 2NOEA 2NOIA 2FUVA 2Z8UA 2PWWA 3CVSA 1M5Q1 1YTBA 3OLPA 3H1ZA 2D0BA 5KL0A 5EPCA 5BMPA 3I0WA 1KFIA 1XSZA 1MP9A 1UT4A 3CWSA 4RODB 2DKCA 1KY6A 5F9CA 3OSTA 2MJ7A 4MRQA 2EHBD 1YQKA 3VN5A 3T4NA 2QRCA 1KFQA 1C4GA 3DPTA 5IYBP 1NH2A 1J3MA 3CWAA 2OOXA 3ENOC 4CFFA 4EAGA 1LWVA 1LWYA 1FN7A 1LXTA 2JOIA 4PY5A 2DKDA 3BKQX 2QR1A 2ZFDB 2V9JA 3F0ZA 1KY7A 4TPSA 4D7RA 2NOBA 3PDKA 1QN9A 1KYUA 2HZMA 1VOKA 2VJ0A
chains in the Genus database with same CATH topology
1E42A 1M3HA 1N3AA 2NOHA 1R4XA 4WZSD 1KYFA 1VTOA 1QNBA 3SNSA 1QNCA 3HS8A 4B0AA 2IV8A 1VTLE 1QTSA 2O3OA 1M3QA 4DULA 2NOFA 3I0XA 1YQRA 5IYDP 1B9KA 1PZDA 4EJYA 3OC3C 1N3CA 1AISA 1KO9A 1TBPA 1UT7A 3EIKA 1YQLA 1C9BB 1QN8A 3RPJA 2NOLA 1LWWA 3OSMA 1NGMA 1QNAA 1N39A 2I5WA 1QN6A 1KYDA 2HZSA 2FGTA 4EJZA 2NOZA 3F10A 2G30A 1EBMA 1QN3A 2D0AA 4I8OA 1QN7A 3ASMA 3OCIA 1W80A 2LAEA 3IH7A 1TGHA 4ROCB 3KTUA 1NVPA 1CDWA 3KRMA 1VOLB 1YQMA 1PCZA 1QN5A 1YTFA 5AN4A 2MZ8A 1JFIC 1QN4A 1HU0A 3ULXA 2XHIA 4ROEB 2D0CA 4Q11A 3N89A 1QNEA 1QTPA 3HS9A 5IYCP 2YH5A 1D3UA 2IV9A 1RM1A 1TBAB 3DPUA 2NOEA 2NOIA 2Z8UA 1YTBA 3H1ZA 2D0BA 3I0WA 1MP9A 1UT4A 4RODB 1KY6A 3OSTA 2MJ7A 1YQKA 3VN5A 3DPTA 5IYBP 1NH2A 1LWVA 1LWYA 1FN7A 4PY5A 2JOIA 4TPSA 2NOBA 3F0ZA 1KY7A 1QN9A 1KYUA 2HZMA 1VOKA 2VJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E42 A;  1YTB A;  1VOL B;  3H1Z A;  1PCZ A;  2D0B A;  1QN5 A;  1YTF A;  1R4X A;  4WZS D;  1KYF A;  1VTO A;  1NGM A;  1MP9 A;  1QNB A;  1QNA A;  1JFI C;  4ROD B;  1QN4 A;  1QNC A;  1KY6 A;  3HS8 A;  1QN6 A;  1KYD A;  2IV8 A;  4B0A A;  4ROE B;  2D0C A;  2MJ7 A;  1QNE A;  2G30 A;  3VN5 A;  1QTS A;  1VTL E;  1QTP A;  1TBP A;  3HS9 A;  5IYB P;  5IYC P;  2D0A A;  1QN3 A;  1NH2 A;  1QN7 A;  3ASM A;  3OCI A;  1W80 A;  4PY5 A;  1D3U A;  1TGH A;  2IV9 A;  3EIK A;  5IYD P;  4ROC B;  1B9K A;  1PZD A;  1KY7 A;  1RM1 A;  1NVP A;  1CDW A;  1TBA B;  3OC3 C;  1QN9 A;  1KYU A;  1AIS A;  1VOK A;  2VJ0 A;  1C9B B;  2Z8U A;  1QN8 A; 
#chains in the Genus database with same CATH topology
 1E42 A;  2V8Q A;  1M3H A;  1N3A A;  2NOH A;  4D7Q A;  1R4X A;  1T6A A;  2R5X A;  4WZS D;  1KYF A;  1VTO A;  1QNB A;  3SNS A;  1QNC A;  3HS8 A;  3I3W A;  5JMV D;  4B0A A;  1MPG A;  1WQA A;  2IV8 A;  3CWU A;  3ENC A;  1VTL E;  1QTS A;  1EUV A;  2O3O A;  1C47 A;  4EJZ A;  1P5G X;  1K2Y X;  4DUL A;  1M3Q A;  4WXA A;  1PCJ X;  2NOF A;  3I0X A;  1YQR A;  5IYD P;  1P5D X;  3NA5 A;  1B9K A;  1PZD A;  3D4V A;  4EJY A;  3OC3 C;  1N3C A;  1AIS A;  2HKP A;  1TBP A;  1UT7 A;  1KO9 A;  3EIK A;  3UW2 A;  1YQL A;  1C9B B;  1QN8 A;  4HJH A;  3RPJ A;  2NLV A;  2NOL A;  2QRE A;  1LWW A;  3OSM A;  1NGM A;  1QNA A;  2NWV A;  4QG5 A;  1DIZ A;  1UL7 A;  1N39 A;  2QRD A;  2I5W A;  1QN6 A;  1KYD A;  2HZS A;  1Q9U A;  1TUO A;  2NVM A;  2FGT A;  2HL8 A;  3TDH A;  4EAJ A;  5BMN A;  3F10 A;  3OH6 A;  2G30 A;  3TE5 A;  3CWT A;  2NOZ A;  1EBM A;  1PCM X;  1QN3 A;  2D0A A;  3PMG A;  4I8O A;  3RSM A;  1QN7 A;  3ASM A;  3OCI A;  1W80 A;  2Y8Q A;  1WJW A;  2JPI A;  2LAE A;  3C04 A;  3IH7 A;  1TGH A;  4ROC B;  5HSH A;  4EAK A;  3KTU A;  1NVP A;  1CDW A;  2JHJ A;  3OSE A;  2DKA A;  1JDY A;  2H5A X;  2OOY A;  3KRM A;  3CVT A;  1V5S A;  1VKL A;  1VOL B;  1YQM A;  4EAI A;  3OGD A;  1PCZ A;  3CW7 A;  1QN5 A;  4WX8 A;  1YTF A;  5JN5 A;  5AN4 A;  1K35 A;  2MZ8 A;  2H4L X;  1JFI C;  1QN4 A;  3EAY A;  4C7P A;  1PVS A;  4EAL A;  1HU0 A;  2FKM X;  3ULX A;  2XHI A;  4ROE B;  2YA3 A;  2D0C A;  4Q11 A;  3N89 A;  4BJU A;  4IL8 A;  1QNE A;  2JHN A;  1QTP A;  3HS9 A;  3D7Q A;  5IYC P;  2Z0F A;  2V92 A;  3OH9 A;  2YH5 A;  2Y8L A;  1D3U A;  2F7L A;  2IV9 A;  1RM1 A;  2FKF A;  1TBA B;  2HL9 A;  2QLV A;  3DPU A;  2NOE A;  2NOI A;  2FUV A;  2Z8U A;  2PWW A;  3CVS A;  1M5Q 1;  1YTB A;  3OLP A;  3H1Z A;  2D0B A;  5KL0 A;  5EPC A;  5BMP A;  3I0W A;  1KFI A;  1XSZ A;  1MP9 A;  1UT4 A;  3CWS A;  4ROD B;  2DKC A;  1KY6 A;  5F9C A;  3OST A;  2MJ7 A;  4MRQ A;  2EHB D;  1YQK A;  3VN5 A;  3T4N A;  2QRC A;  1KFQ A;  1C4G A;  3DPT A;  5IYB P;  1NH2 A;  1J3M A;  3CWA A;  2OOX A;  3ENO C;  4CFF A;  4EAG A;  1LWV A;  1LWY A;  1FN7 A;  1LXT A;  2JOI A;  4PY5 A;  2DKD A;  3BKQ X;  2QR1 A;  2ZFD B;  2V9J A;  3F0Z A;  1KY7 A;  4TPS A;  4D7R A;  2NOB A;  3PDK A;  1QN9 A;  1KYU A;  2HZM A;  1VOK A;  2VJ0 A; 
#chains in the Genus database with same CATH homology
 1E42 A;  1M3H A;  1N3A A;  2NOH A;  1R4X A;  4WZS D;  1KYF A;  1VTO A;  1QNB A;  3SNS A;  1QNC A;  3HS8 A;  4B0A A;  2IV8 A;  1VTL E;  1QTS A;  2O3O A;  1M3Q A;  4DUL A;  2NOF A;  3I0X A;  1YQR A;  5IYD P;  1B9K A;  1PZD A;  4EJY A;  3OC3 C;  1N3C A;  1AIS A;  1KO9 A;  1TBP A;  1UT7 A;  3EIK A;  1YQL A;  1C9B B;  1QN8 A;  3RPJ A;  2NOL A;  1LWW A;  3OSM A;  1NGM A;  1QNA A;  1N39 A;  2I5W A;  1QN6 A;  1KYD A;  2HZS A;  2FGT A;  4EJZ A;  2NOZ A;  3F10 A;  2G30 A;  1EBM A;  1QN3 A;  2D0A A;  4I8O A;  1QN7 A;  3ASM A;  3OCI A;  1W80 A;  2LAE A;  3IH7 A;  1TGH A;  4ROC B;  3KTU A;  1NVP A;  1CDW A;  3KRM A;  1VOL B;  1YQM A;  1PCZ A;  1QN5 A;  1YTF A;  5AN4 A;  2MZ8 A;  1JFI C;  1QN4 A;  1HU0 A;  3ULX A;  2XHI A;  4ROE B;  2D0C A;  4Q11 A;  3N89 A;  1QNE A;  1QTP A;  3HS9 A;  5IYC P;  2YH5 A;  1D3U A;  2IV9 A;  1RM1 A;  1TBA B;  3DPU A;  2NOE A;  2NOI A;  2Z8U A;  1YTB A;  3H1Z A;  2D0B A;  3I0W A;  1MP9 A;  1UT4 A;  4ROD B;  1KY6 A;  3OST A;  2MJ7 A;  1YQK A;  3VN5 A;  3DPT A;  5IYB P;  1NH2 A;  1LWV A;  1LWY A;  1FN7 A;  4PY5 A;  2JOI A;  4TPS A;  2NOB A;  3F0Z A;  1KY7 A;  1QN9 A;  1KYU A;  2HZM A;  1VOK A;  2VJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...