3OC3C

Crystal structure of the mot1 n-terminal domain in complex with tbp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
178
structure length
178
Chain Sequence
SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transcription
molecule keywords HELICASE MOT1
publication title Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
total genus 42
structure length 178
sequence length 178
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3oc3C01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3oc3C02
1VOKA 1JFIC 1YTFA 1CDWA 1RM1A 3OCIA 1KY7A 2D0CA 5IYBP 2G30A 3OC3C 4B0AA 1TBAB 1VTOA 1B9KA 3EIKA 2Z8UA 1QNCA 2IV9A 4PY5A 4ROEB 5IYDP 1QN3A 1QN8A 1QN9A 2VJ0A 1TBPA 5IYCP 1AISA 1VTLE 2D0AA 3H1ZA 1KYFA 1NGMA 1C9BB 3ASMA 1QN5A 1VOLB 1QNAA 1NH2A 1TGHA 1W80A 1E42A 1QTPA 4WZSD 1QNEA 1KYUA 2IV8A 1R4XA 3HS9A 1NVPA 4ROCB 1D3UA 4RODB 1KYDA 1PCZA 3VN5A 1QN4A 2MJ7A 2D0BA 3HS8A 1QN6A 1PZDA 1QN7A 1YTBA 1QNBA 1KY6A 1QTSA 1MP9A
chains in the Genus database with same CATH superfamily
1P5DX 2JHNA 2QRDA 3CW7A 1P5GX 1XSZA 4QG5A 4EJYA 2JPIA 3D7QA 1TUOA 1VTOA 1B9KA 2O3OA 2QR1A 3ENCA 2IV9A 3OGDA 3RPJA 3BKQX 2FUVA 1JDYA 1LWWA 2NVMA 2PWWA 1QN9A 1QN8A 1AISA 4C7PA 2HZSA 4EJZA 1KYFA 1PVSA 1M3QA 2JHJA 2HL8A 1QTPA 5BMNA 3CVSA 3SNSA 1QNEA 1R4XA 2EHBD 3UW2A 2FKFA 2QLVA 1D3UA 1M3HA 1QN4A 1EBMA 3HS8A 3TE5A 1C47A 1PZDA 1QN6A 4CFFA 2NLVA 2V92A 2V9JA 2H4LX 4EAGA 3OCIA 1KFQA 3PDKA 4BJUA 1K35A 2NOLA 1CDWA 2NOFA 3OLPA 1RM1A 1KY7A 2D0CA 5IYBP 1Q9UA 1TBAB 1YQKA 5HSHA 2Z8UA 4D7QA 5IYDP 4EAJA 4D7RA 2DKDA 1QN3A 1YQLA 1N39A 1TBPA 3OSTA 3C04A 3OSMA 1HU0A 1FN7A 5KL0A 4EAKA 1KFIA 3OH9A 3TDHA 3I3WA 3N89A 3CWSA 3ULXA 1PCZA 5EPCA 2FGTA 2QRCA 2H5AX 1MPGA 2XHIA 2QREA 1T6AA 2G30A 1N3AA 2OOYA 4EALA 1UT4A 4PY5A 3PMGA 4ROEB 3OH6A 1WJWA 1PCMX 1V5SA 2VJ0A 3F0ZA 5BMPA 4IL8A 1UL7A 3I0WA 1N3CA 1NGMA 1C9BB 1QN5A 3CWAA 1W80A 1E42A 3T4NA 4WZSD 1LWYA 1KYUA 1UT7A 2IV8A 2NWVA 4EAIA 1NVPA 2LAEA 3CWTA 3CVTA 4I8OA 3IH7A 4WX8A 1KYDA 3I0XA 2V8QA 3RSMA 5JMVD 2NOHA 2MJ7A 2D0BA 2NOZA 1YTBA 1LWVA 1C4GA 4HJHA 1MP9A 3OC3C 1VOKA 3ENOC 4WXAA 5JN5A 1JFIC 1EUVA 1YTFA 2MZ8A 3NA5A 2I5WA 2Z0FA 2YH5A 5F9CA 3EAYA 1LXTA 4B0AA 1K2YX 3CWUA 1DIZA 3EIKA 4TPSA 1QNCA 3KTUA 2DKAA 1KO9A 2HKPA 4MRQA 2R5XA 2NOEA 2NOIA 3DPTA 2YA3A 2ZFDB 5IYCP 2HL9A 2OOXA 4Q11A 3F10A 1VTLE 2D0AA 3H1ZA 3KRMA 3D4VA 3ASMA 1J3MA 1VOLB 1QNAA 2Y8LA 1NH2A 2Y8QA 1TGHA 2HZMA 1VKLA 2JOIA 3HS9A 2FKMX 1PCJX 1WQAA 4ROCB 5AN4A 4RODB 4DULA 1YQMA 1M5Q1 3VN5A 1YQRA 2DKCA 1QN7A 2NOBA 3OSEA 1QNBA 1KY6A 3DPUA 1QTSA 2F7LA
chains in the Genus database with same CATH topology
4EJYA 1VTOA 1B9KA 2O3OA 2IV9A 3RPJA 1LWWA 1QN8A 1QN9A 1AISA 2HZSA 4EJZA 1KYFA 1M3QA 1KY6A 1QTPA 1QNEA 3SNSA 1R4XA 1D3UA 1M3HA 1QN4A 1EBMA 3HS8A 1QN6A 1PZDA 3OCIA 2NOLA 1CDWA 2NOFA 1KY7A 2D0CA 5IYBP 1TBAB 1YQKA 2Z8UA 5IYDP 1QN3A 1YQLA 1N39A 1TBPA 3OSTA 3OSMA 1HU0A 1FN7A 3N89A 3ULXA 1PCZA 2FGTA 2XHIA 2G30A 1N3AA 1UT4A 4PY5A 4ROEB 2VJ0A 3F0ZA 3I0WA 1N3CA 1NGMA 1C9BB 1QN5A 1W80A 1E42A 1LWYA 4WZSD 1KYUA 1UT7A 2IV8A 1NVPA 2LAEA 4I8OA 3IH7A 1KYDA 3I0XA 2NOHA 2MJ7A 2D0BA 2NOZA 1YTBA 1LWVA 3OC3C 1MP9A 1VOKA 1JFIC 1YTFA 2MZ8A 2I5WA 2YH5A 4B0AA 3EIKA 4TPSA 1QNCA 3KTUA 1KO9A 2NOEA 2NOIA 3DPTA 5IYCP 1VTLE 4Q11A 3F10A 2D0AA 3H1ZA 3KRMA 3ASMA 1VOLB 1QNAA 1NH2A 1TGHA 2HZMA 2JOIA 3HS9A 4ROCB 5AN4A 4RODB 4DULA 1YQMA 3VN5A 1YQRA 1QN7A 2NOBA 1QNBA 1RM1A 3DPUA 1QTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VOK A;  1JFI C;  1YTF A;  1CDW A;  1RM1 A;  3OCI A;  1KY7 A;  2D0C A;  5IYB P;  2G30 A;  3OC3 C;  4B0A A;  1TBA B;  1VTO A;  1B9K A;  3EIK A;  2Z8U A;  1QNC A;  2IV9 A;  4PY5 A;  4ROE B;  5IYD P;  1QN3 A;  1QN8 A;  1QN9 A;  2VJ0 A;  1TBP A;  5IYC P;  1AIS A;  1VTL E;  2D0A A;  3H1Z A;  1KYF A;  1NGM A;  1C9B B;  3ASM A;  1QN5 A;  1VOL B;  1QNA A;  1NH2 A;  1TGH A;  1W80 A;  1E42 A;  1QTP A;  4WZS D;  1QNE A;  1KYU A;  2IV8 A;  1R4X A;  3HS9 A;  1NVP A;  4ROC B;  1D3U A;  4ROD B;  1KYD A;  1PCZ A;  3VN5 A;  1QN4 A;  2MJ7 A;  2D0B A;  3HS8 A;  1QN6 A;  1PZD A;  1QN7 A;  1YTB A;  1QNB A;  1KY6 A;  1QTS A;  1MP9 A; 
#chains in the Genus database with same CATH topology
 1P5D X;  2JHN A;  2QRD A;  3CW7 A;  1P5G X;  1XSZ A;  4QG5 A;  4EJY A;  2JPI A;  3D7Q A;  1TUO A;  1VTO A;  1B9K A;  2O3O A;  2QR1 A;  3ENC A;  2IV9 A;  3OGD A;  3RPJ A;  3BKQ X;  2FUV A;  1JDY A;  1LWW A;  2NVM A;  2PWW A;  1QN9 A;  1QN8 A;  1AIS A;  4C7P A;  2HZS A;  4EJZ A;  1KYF A;  1PVS A;  1M3Q A;  2JHJ A;  2HL8 A;  1QTP A;  5BMN A;  3CVS A;  3SNS A;  1QNE A;  1R4X A;  2EHB D;  3UW2 A;  2FKF A;  2QLV A;  1D3U A;  1M3H A;  1QN4 A;  1EBM A;  3HS8 A;  3TE5 A;  1C47 A;  1PZD A;  1QN6 A;  4CFF A;  2NLV A;  2V92 A;  2V9J A;  2H4L X;  4EAG A;  3OCI A;  1KFQ A;  3PDK A;  4BJU A;  1K35 A;  2NOL A;  1CDW A;  2NOF A;  3OLP A;  1RM1 A;  1KY7 A;  2D0C A;  5IYB P;  1Q9U A;  1TBA B;  1YQK A;  5HSH A;  2Z8U A;  4D7Q A;  5IYD P;  4EAJ A;  4D7R A;  2DKD A;  1QN3 A;  1YQL A;  1N39 A;  1TBP A;  3OST A;  3C04 A;  3OSM A;  1HU0 A;  1FN7 A;  5KL0 A;  4EAK A;  1KFI A;  3OH9 A;  3TDH A;  3I3W A;  3N89 A;  3CWS A;  3ULX A;  1PCZ A;  5EPC A;  2FGT A;  2QRC A;  2H5A X;  1MPG A;  2XHI A;  2QRE A;  1T6A A;  2G30 A;  1N3A A;  2OOY A;  4EAL A;  1UT4 A;  4PY5 A;  3PMG A;  4ROE B;  3OH6 A;  1WJW A;  1PCM X;  1V5S A;  2VJ0 A;  3F0Z A;  5BMP A;  4IL8 A;  1UL7 A;  3I0W A;  1N3C A;  1NGM A;  1C9B B;  1QN5 A;  3CWA A;  1W80 A;  1E42 A;  3T4N A;  4WZS D;  1LWY A;  1KYU A;  1UT7 A;  2IV8 A;  2NWV A;  4EAI A;  1NVP A;  2LAE A;  3CWT A;  3CVT A;  4I8O A;  3IH7 A;  4WX8 A;  1KYD A;  3I0X A;  2V8Q A;  3RSM A;  5JMV D;  2NOH A;  2MJ7 A;  2D0B A;  2NOZ A;  1YTB A;  1LWV A;  1C4G A;  4HJH A;  1MP9 A;  3OC3 C;  1VOK A;  3ENO C;  4WXA A;  5JN5 A;  1JFI C;  1EUV A;  1YTF A;  2MZ8 A;  3NA5 A;  2I5W A;  2Z0F A;  2YH5 A;  5F9C A;  3EAY A;  1LXT A;  4B0A A;  1K2Y X;  3CWU A;  1DIZ A;  3EIK A;  4TPS A;  1QNC A;  3KTU A;  2DKA A;  1KO9 A;  2HKP A;  4MRQ A;  2R5X A;  2NOE A;  2NOI A;  3DPT A;  2YA3 A;  2ZFD B;  5IYC P;  2HL9 A;  2OOX A;  4Q11 A;  3F10 A;  1VTL E;  2D0A A;  3H1Z A;  3KRM A;  3D4V A;  3ASM A;  1J3M A;  1VOL B;  1QNA A;  2Y8L A;  1NH2 A;  2Y8Q A;  1TGH A;  2HZM A;  1VKL A;  2JOI A;  3HS9 A;  2FKM X;  1PCJ X;  1WQA A;  4ROC B;  5AN4 A;  4ROD B;  4DUL A;  1YQM A;  1M5Q 1;  3VN5 A;  1YQR A;  2DKC A;  1QN7 A;  2NOB A;  3OSE A;  1QNB A;  1KY6 A;  3DPU A;  1QTS A;  2F7L A; 
#chains in the Genus database with same CATH homology
 4EJY A;  1VTO A;  1B9K A;  2O3O A;  2IV9 A;  3RPJ A;  1LWW A;  1QN8 A;  1QN9 A;  1AIS A;  2HZS A;  4EJZ A;  1KYF A;  1M3Q A;  1KY6 A;  1QTP A;  1QNE A;  3SNS A;  1R4X A;  1D3U A;  1M3H A;  1QN4 A;  1EBM A;  3HS8 A;  1QN6 A;  1PZD A;  3OCI A;  2NOL A;  1CDW A;  2NOF A;  1KY7 A;  2D0C A;  5IYB P;  1TBA B;  1YQK A;  2Z8U A;  5IYD P;  1QN3 A;  1YQL A;  1N39 A;  1TBP A;  3OST A;  3OSM A;  1HU0 A;  1FN7 A;  3N89 A;  3ULX A;  1PCZ A;  2FGT A;  2XHI A;  2G30 A;  1N3A A;  1UT4 A;  4PY5 A;  4ROE B;  2VJ0 A;  3F0Z A;  3I0W A;  1N3C A;  1NGM A;  1C9B B;  1QN5 A;  1W80 A;  1E42 A;  1LWY A;  4WZS D;  1KYU A;  1UT7 A;  2IV8 A;  1NVP A;  2LAE A;  4I8O A;  3IH7 A;  1KYD A;  3I0X A;  2NOH A;  2MJ7 A;  2D0B A;  2NOZ A;  1YTB A;  1LWV A;  3OC3 C;  1MP9 A;  1VOK A;  1JFI C;  1YTF A;  2MZ8 A;  2I5W A;  2YH5 A;  4B0A A;  3EIK A;  4TPS A;  1QNC A;  3KTU A;  1KO9 A;  2NOE A;  2NOI A;  3DPT A;  5IYC P;  1VTL E;  4Q11 A;  3F10 A;  2D0A A;  3H1Z A;  3KRM A;  3ASM A;  1VOL B;  1QNA A;  1NH2 A;  1TGH A;  2HZM A;  2JOI A;  3HS9 A;  4ROC B;  5AN4 A;  4ROD B;  4DUL A;  1YQM A;  3VN5 A;  1YQR A;  1QN7 A;  2NOB A;  1QNB A;  1RM1 A;  3DPU A;  1QTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...