1RM1A

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 41
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1rm1A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1rm1A02
1TGHA 1C9BB 5IYCP 1MP9A 4PY5A 2Z8UA 1KY6A 1TBPA 1NGMA 2IV8A 1QN3A 3ASMA 2D0AA 4ROEB 1NVPA 2MJ7A 1KY7A 1R4XA 1W80A 2G30A 2D0BA 1VTLE 1E42A 1PZDA 1QN4A 1QNEA 3HS8A 1VOKA 5IYDP 3OC3C 1VTOA 1D3UA 1QTPA 1QTSA 3OCIA 1QN6A 1QN5A 3HS9A 1B9KA 4B0AA 1CDWA 2D0CA 5IYBP 2IV9A 1QN7A 4WZSD 1RM1A 1VOLB 2VJ0A 1QNBA 1QN8A 1KYDA 1PCZA 4ROCB 3EIKA 4RODB 1QNAA 1NH2A 1AISA 1JFIC 3VN5A 1QN9A 1QNCA 3H1ZA 1YTFA 1YTBA 1KYUA 1TBAB 1KYFA
chains in the Genus database with same CATH superfamily
1YQRA 3EAYA 1C9BB 4PY5A 2Z8UA 3I0XA 4D7RA 1KFIA 1TBPA 4TPSA 4EALA 2NOBA 3BKQX 1EUVA 2DKAA 1FN7A 3I0WA 1C47A 2H4LX 1P5GX 1W80A 1PCJX 3OSTA 1K35A 1QNEA 1YQLA 2O3OA 3OH9A 1QTSA 5EPCA 1LWYA 3OCIA 1VKLA 2I5WA 1QN5A 1B9KA 3PDKA 4WZSD 2NVMA 1RM1A 2HL9A 4EAGA 5HSHA 1HU0A 2VJ0A 4EJYA 1KYDA 4RODB 5F9CA 3RPJA 3OH6A 2Y8QA 1QNCA 1N39A 1YTFA 2NOIA 1KYUA 1C4GA 1TBAB 1MP9A 1UT7A 2DKDA 1M3HA 2LAEA 1LWVA 4BJUA 1QN3A 2D0AA 2QRCA 1J3MA 2Z0FA 2V9JA 1KY7A 4WXAA 1VTLE 1WJWA 4WX8A 2YH5A 5IYDP 5AN4A 2FGTA 3OC3C 3OLPA 4QG5A 1QTPA 3OSEA 1QN6A 3F0ZA 2QRDA 1T6AA 1CDWA 2D0CA 2IV9A 1LWWA 1YQKA 2R5XA 1N3CA 4HJHA 2DKCA 3N89A 3OSMA 1QNBA 1PVSA 5BMPA 3F10A 2JOIA 1JFIC 1XSZA 3H1ZA 3DPUA 1YTBA 2HZSA 1Q9UA 2V8QA 4I8OA 1PCMX 1KO9A 4MRQA 3TDHA 4CFFA 4EAJA 3CWUA 3D7QA 1KY6A 2NWVA 1NGMA 2IV8A 3TE5A 3CWSA 2HL8A 2YA3A 4EAKA 2NOLA 3ASMA 4Q11A 4ROEB 3D4VA 2MJ7A 3NA5A 3PMGA 2G30A 3CVSA 1E42A 1YQMA 1M5Q1 4EAIA 1QN4A 3HS8A 2NOFA 1EBMA 2HZMA 3CWAA 1VTOA 1D3UA 3C04A 4DULA 2FKMX 3KTUA 3CVTA 2Y8LA 3OGDA 2ZFDB 2QLVA 3RSMA 1JDYA 2QREA 1MPGA 4EJZA 3UW2A 1VOLB 1WQAA 1QN8A 1PCZA 3DPTA 1UT4A 1NH2A 4IL8A 3T4NA 2F7LA 3VN5A 3KRMA 3SNSA 4D7QA 5IYCP 2JHNA 1TGHA 3I3WA 2NOZA 1UL7A 1P5DX 2OOYA 1LXTA 2PWWA 1K2YX 2NOHA 2JPIA 5JN5A 1NVPA 1R4XA 2OOXA 2EHBD 2D0BA 2JHJA 2FKFA 4C7PA 1PZDA 2MZ8A 1M3QA 2HKPA 3ENCA 1VOKA 1N3AA 2XHIA 3ULXA 2QR1A 3ENOC 1DIZA 1V5SA 2FUVA 3HS9A 4B0AA 5IYBP 5BMNA 1QN7A 2V92A 2H5AX 1KFQA 3CW7A 2NLVA 4ROCB 3CWTA 3EIKA 1TUOA 5JMVD 1QNAA 1AISA 5KL0A 3IH7A 1QN9A 2NOEA 1KYFA
chains in the Genus database with same CATH topology
1YQRA 1C9BB 4PY5A 2Z8UA 3I0XA 1TBPA 4TPSA 2NOBA 1FN7A 3I0WA 1W80A 3OSTA 1QNEA 1YQLA 2O3OA 1QTSA 1LWYA 3OCIA 2I5WA 1QN5A 1B9KA 4WZSD 1RM1A 1HU0A 4EJYA 2VJ0A 1KYDA 4RODB 3RPJA 1QNCA 1N39A 1YTFA 2NOIA 1KYUA 1TBAB 1MP9A 1UT7A 1M3HA 2LAEA 1LWVA 1QN3A 2D0AA 1KY7A 1VTLE 5IYDP 2YH5A 5AN4A 2FGTA 3OC3C 1QTPA 1QN6A 3F0ZA 1CDWA 2D0CA 2IV9A 1LWWA 1YQKA 1N3CA 1QNBA 3N89A 3OSMA 3F10A 2JOIA 1JFIC 3H1ZA 3DPUA 1YTBA 2HZSA 4I8OA 1KO9A 1KY6A 1NGMA 2IV8A 2NOLA 3ASMA 4Q11A 4ROEB 2MJ7A 2G30A 1E42A 1YQMA 1QN4A 3HS8A 2NOFA 1EBMA 2HZMA 1VTOA 1D3UA 4DULA 3KTUA 4EJZA 1VOLB 1QN8A 1PCZA 3DPTA 1UT4A 1NH2A 3VN5A 3KRMA 3SNSA 5IYCP 1TGHA 2NOZA 2NOHA 1NVPA 1R4XA 2D0BA 1PZDA 2MZ8A 1M3QA 1N3AA 1VOKA 2XHIA 3ULXA 3HS9A 4B0AA 5IYBP 1QN7A 4ROCB 3EIKA 1QNAA 1AISA 3IH7A 1QN9A 2NOEA 1KYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGH A;  1C9B B;  5IYC P;  1MP9 A;  4PY5 A;  2Z8U A;  1KY6 A;  1TBP A;  1NGM A;  2IV8 A;  1QN3 A;  3ASM A;  2D0A A;  4ROE B;  1NVP A;  2MJ7 A;  1KY7 A;  1R4X A;  1W80 A;  2G30 A;  2D0B A;  1VTL E;  1E42 A;  1PZD A;  1QN4 A;  1QNE A;  3HS8 A;  1VOK A;  5IYD P;  3OC3 C;  1VTO A;  1D3U A;  1QTP A;  1QTS A;  3OCI A;  1QN6 A;  1QN5 A;  3HS9 A;  1B9K A;  4B0A A;  1CDW A;  2D0C A;  5IYB P;  2IV9 A;  1QN7 A;  4WZS D;  1RM1 A;  1VOL B;  2VJ0 A;  1QNB A;  1QN8 A;  1KYD A;  1PCZ A;  4ROC B;  3EIK A;  4ROD B;  1QNA A;  1NH2 A;  1AIS A;  1JFI C;  3VN5 A;  1QN9 A;  1QNC A;  3H1Z A;  1YTF A;  1YTB A;  1KYU A;  1TBA B;  1KYF A; 
#chains in the Genus database with same CATH topology
 1YQR A;  3EAY A;  1C9B B;  4PY5 A;  2Z8U A;  3I0X A;  4D7R A;  1KFI A;  1TBP A;  4TPS A;  4EAL A;  2NOB A;  3BKQ X;  1EUV A;  2DKA A;  1FN7 A;  3I0W A;  1C47 A;  2H4L X;  1P5G X;  1W80 A;  1PCJ X;  3OST A;  1K35 A;  1QNE A;  1YQL A;  2O3O A;  3OH9 A;  1QTS A;  5EPC A;  1LWY A;  3OCI A;  1VKL A;  2I5W A;  1QN5 A;  1B9K A;  3PDK A;  4WZS D;  2NVM A;  1RM1 A;  2HL9 A;  4EAG A;  5HSH A;  1HU0 A;  2VJ0 A;  4EJY A;  1KYD A;  4ROD B;  5F9C A;  3RPJ A;  3OH6 A;  2Y8Q A;  1QNC A;  1N39 A;  1YTF A;  2NOI A;  1KYU A;  1C4G A;  1TBA B;  1MP9 A;  1UT7 A;  2DKD A;  1M3H A;  2LAE A;  1LWV A;  4BJU A;  1QN3 A;  2D0A A;  2QRC A;  1J3M A;  2Z0F A;  2V9J A;  1KY7 A;  4WXA A;  1VTL E;  1WJW A;  4WX8 A;  2YH5 A;  5IYD P;  5AN4 A;  2FGT A;  3OC3 C;  3OLP A;  4QG5 A;  1QTP A;  3OSE A;  1QN6 A;  3F0Z A;  2QRD A;  1T6A A;  1CDW A;  2D0C A;  2IV9 A;  1LWW A;  1YQK A;  2R5X A;  1N3C A;  4HJH A;  2DKC A;  3N89 A;  3OSM A;  1QNB A;  1PVS A;  5BMP A;  3F10 A;  2JOI A;  1JFI C;  1XSZ A;  3H1Z A;  3DPU A;  1YTB A;  2HZS A;  1Q9U A;  2V8Q A;  4I8O A;  1PCM X;  1KO9 A;  4MRQ A;  3TDH A;  4CFF A;  4EAJ A;  3CWU A;  3D7Q A;  1KY6 A;  2NWV A;  1NGM A;  2IV8 A;  3TE5 A;  3CWS A;  2HL8 A;  2YA3 A;  4EAK A;  2NOL A;  3ASM A;  4Q11 A;  4ROE B;  3D4V A;  2MJ7 A;  3NA5 A;  3PMG A;  2G30 A;  3CVS A;  1E42 A;  1YQM A;  1M5Q 1;  4EAI A;  1QN4 A;  3HS8 A;  2NOF A;  1EBM A;  2HZM A;  3CWA A;  1VTO A;  1D3U A;  3C04 A;  4DUL A;  2FKM X;  3KTU A;  3CVT A;  2Y8L A;  3OGD A;  2ZFD B;  2QLV A;  3RSM A;  1JDY A;  2QRE A;  1MPG A;  4EJZ A;  3UW2 A;  1VOL B;  1WQA A;  1QN8 A;  1PCZ A;  3DPT A;  1UT4 A;  1NH2 A;  4IL8 A;  3T4N A;  2F7L A;  3VN5 A;  3KRM A;  3SNS A;  4D7Q A;  5IYC P;  2JHN A;  1TGH A;  3I3W A;  2NOZ A;  1UL7 A;  1P5D X;  2OOY A;  1LXT A;  2PWW A;  1K2Y X;  2NOH A;  2JPI A;  5JN5 A;  1NVP A;  1R4X A;  2OOX A;  2EHB D;  2D0B A;  2JHJ A;  2FKF A;  4C7P A;  1PZD A;  2MZ8 A;  1M3Q A;  2HKP A;  3ENC A;  1VOK A;  1N3A A;  2XHI A;  3ULX A;  2QR1 A;  3ENO C;  1DIZ A;  1V5S A;  2FUV A;  3HS9 A;  4B0A A;  5IYB P;  5BMN A;  1QN7 A;  2V92 A;  2H5A X;  1KFQ A;  3CW7 A;  2NLV A;  4ROC B;  3CWT A;  3EIK A;  1TUO A;  5JMV D;  1QNA A;  1AIS A;  5KL0 A;  3IH7 A;  1QN9 A;  2NOE A;  1KYF A; 
#chains in the Genus database with same CATH homology
 1YQR A;  1C9B B;  4PY5 A;  2Z8U A;  3I0X A;  1TBP A;  4TPS A;  2NOB A;  1FN7 A;  3I0W A;  1W80 A;  3OST A;  1QNE A;  1YQL A;  2O3O A;  1QTS A;  1LWY A;  3OCI A;  2I5W A;  1QN5 A;  1B9K A;  4WZS D;  1RM1 A;  1HU0 A;  4EJY A;  2VJ0 A;  1KYD A;  4ROD B;  3RPJ A;  1QNC A;  1N39 A;  1YTF A;  2NOI A;  1KYU A;  1TBA B;  1MP9 A;  1UT7 A;  1M3H A;  2LAE A;  1LWV A;  1QN3 A;  2D0A A;  1KY7 A;  1VTL E;  5IYD P;  2YH5 A;  5AN4 A;  2FGT A;  3OC3 C;  1QTP A;  1QN6 A;  3F0Z A;  1CDW A;  2D0C A;  2IV9 A;  1LWW A;  1YQK A;  1N3C A;  1QNB A;  3N89 A;  3OSM A;  3F10 A;  2JOI A;  1JFI C;  3H1Z A;  3DPU A;  1YTB A;  2HZS A;  4I8O A;  1KO9 A;  1KY6 A;  1NGM A;  2IV8 A;  2NOL A;  3ASM A;  4Q11 A;  4ROE B;  2MJ7 A;  2G30 A;  1E42 A;  1YQM A;  1QN4 A;  3HS8 A;  2NOF A;  1EBM A;  2HZM A;  1VTO A;  1D3U A;  4DUL A;  3KTU A;  4EJZ A;  1VOL B;  1QN8 A;  1PCZ A;  3DPT A;  1UT4 A;  1NH2 A;  3VN5 A;  3KRM A;  3SNS A;  5IYC P;  1TGH A;  2NOZ A;  2NOH A;  1NVP A;  1R4X A;  2D0B A;  1PZD A;  2MZ8 A;  1M3Q A;  1N3A A;  1VOK A;  2XHI A;  3ULX A;  3HS9 A;  4B0A A;  5IYB P;  1QN7 A;  4ROC B;  3EIK A;  1QNA A;  1AIS A;  3IH7 A;  1QN9 A;  2NOE A;  1KYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...