1RM1A

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
source organism Saccharomyces cerevisiae
total genus 41
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1rm1A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1rm1A02
1YTFA 4B0AA 2D0AA 1VOKA 1QN7A 1KYDA 1QNCA 1QN3A 3VN5A 4PY5A 5IYDP 1NGMA 5IYBP 2D0CA 4WZSD 1TBPA 4RODB 2IV8A 1QTPA 3H1ZA 1MP9A 4ROEB 1QN4A 1AISA 3OCIA 1QTSA 1PZDA 1W80A 1QNAA 3ASMA 1C9BB 2D0BA 1NVPA 1R4XA 1TBAB 1VOLB 2Z8UA 2MJ7A 1VTLE 1KYUA 3OC3C 1NH2A 1QNBA 1TGHA 1CDWA 1QN5A 2VJ0A 1KY7A 1QN8A 1KY6A 1PCZA 1D3UA 5IYCP 1VTOA 1QN6A 2IV9A 3EIKA 1QNEA 2G30A 1YTBA 3HS9A 3HS8A 1KYFA 1E42A 1RM1A 1QN9A 4ROCB 1JFIC 1B9KA
chains in the Genus database with same CATH superfamily
2NLVA 3D4VA 4I8OA 3DPUA 3OSMA 3DPTA 5JN5A 1XSZA 2HL8A 1VOKA 2V8QA 3I3WA 1QN7A 2NOZA 5IYDP 4BJUA 1PCMX 2MZ8A 3CWAA 2H4LX 3EAYA 4DULA 2DKAA 1TBPA 2NWVA 4IL8A 3RSMA 2DKDA 3UW2A 2IV8A 3I0WA 2QR1A 2NOIA 1M3HA 4ROEB 1QN4A 1M5Q1 1AISA 1N3CA 1PZDA 1QTSA 3I0XA 3ASMA 2HKPA 5HSHA 2QRCA 3CVTA 1VOLB 1VTLE 3OC3C 1WJWA 1KFIA 3OH9A 2VJ0A 1KY7A 1QN8A 1PCZA 2YH5A 1VTOA 3EIKA 4EAKA 1QNEA 3F0ZA 3IH7A 1HU0A 3NA5A 2FGTA 2F7LA 2PWWA 3BKQX 1QN9A 4ROCB 4D7RA 1UT4A 1YTFA 1C4GA 1TUOA 2HZMA 2FKFA 1LWWA 3TDHA 4EAJA 1LWVA 2D0CA 4EAGA 1K2YX 4HJHA 2JHNA 1QTPA 2Y8QA 3N89A 1MP9A 2XHIA 3C04A 3OH6A 1W80A 1PCJX 1C9BB 2V9JA 5JMVD 1NVPA 2Z8UA 2YA3A 2FUVA 1KYUA 1K35A 1NH2A 1QNBA 1KY6A 1Q9UA 2FKMX 4WXAA 2NOBA 2QREA 3SNSA 3OSTA 1KO9A 3KRMA 1V5SA 1E42A 3CWUA 1T6AA 5BMPA 2HL9A 1TGHA 1N3AA 1VKLA 1N39A 1EBMA 4EALA 2DKCA 1WQAA 4EJYA 3ULXA 2HZSA 1YQLA 1FN7A 1KYDA 1QN3A 4PY5A 3ENCA 4CFFA 2NOLA 2NVMA 2R5XA 3OLPA 3CVSA 3D7QA 4Q11A 1LXTA 3T4NA 3CWSA 4C7PA 1C47A 4D7QA 2MJ7A 1YQMA 1M3QA 1MPGA 4WX8A 2JHJA 2NOEA 1YQRA 2H5AX 1KFQA 5IYCP 2IV9A 1YTBA 2G30A 3CWTA 5EPCA 2V92A 1RM1A 1UT7A 2QRDA 1CDWA 1P5DX 1D3UA 2EHBD 1QN5A 1J3MA 4EAIA 2O3OA 1JDYA 2OOYA 3PMGA 5AN4A 3KTUA 3ENOC 4B0AA 2D0AA 1QNCA 3VN5A 5BMNA 2JOIA 2Y8LA 3F10A 5KL0A 5IYBP 1YQKA 1NGMA 5F9CA 4WZSD 2Z0FA 4RODB 4EJZA 2NOHA 3H1ZA 3RPJA 4MRQA 2QLVA 3OCIA 1QNAA 2NOFA 1LWYA 2D0BA 1R4XA 1TBAB 1EUVA 1DIZA 2JPIA 1P5GX 4TPSA 1PVSA 2LAEA 1QN6A 3PDKA 3OGDA 3HS9A 3HS8A 2ZFDB 1UL7A 4QG5A 3TE5A 1JFIC 1KYFA 2I5WA 2OOXA 3CW7A 3OSEA 1B9KA
chains in the Genus database with same CATH topology
4I8OA 3DPUA 3OSMA 3DPTA 1VOKA 1QN7A 2NOZA 5IYDP 2MZ8A 4DULA 1TBPA 3I0WA 2IV8A 2NOIA 1M3HA 4ROEB 1QN4A 1AISA 1N3CA 1QTSA 1PZDA 3I0XA 3ASMA 1VOLB 1VTLE 3OC3C 2VJ0A 1KY7A 1QN8A 1PCZA 2YH5A 1VTOA 3EIKA 1QNEA 3F0ZA 3IH7A 1HU0A 2FGTA 1QN9A 4ROCB 1UT4A 1YTFA 2HZMA 1LWWA 1LWVA 2D0CA 3N89A 1QTPA 2XHIA 1MP9A 1W80A 1C9BB 1NVPA 2Z8UA 1QNBA 1KYUA 1NH2A 1KY6A 2NOBA 3SNSA 3OSTA 1KO9A 3KRMA 1E42A 1TGHA 1N3AA 1N39A 1EBMA 4EJYA 3ULXA 2HZSA 1YQLA 1FN7A 1KYDA 1QN3A 4PY5A 2NOLA 4Q11A 2MJ7A 1YQMA 1M3QA 2NOEA 1YQRA 5IYCP 2IV9A 1YTBA 2G30A 1RM1A 1UT7A 1CDWA 1QN5A 1D3UA 2O3OA 3KTUA 5AN4A 4B0AA 2D0AA 1QNCA 3VN5A 2JOIA 3F10A 1YQKA 5IYBP 1NGMA 4WZSD 4RODB 4EJZA 2NOHA 3H1ZA 3RPJA 3OCIA 1QNAA 2NOFA 1LWYA 2D0BA 1R4XA 1TBAB 4TPSA 2LAEA 1QN6A 3HS9A 3HS8A 1KYFA 2I5WA 1JFIC 1B9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF A;  4B0A A;  2D0A A;  1VOK A;  1QN7 A;  1KYD A;  1QNC A;  1QN3 A;  3VN5 A;  4PY5 A;  5IYD P;  1NGM A;  5IYB P;  2D0C A;  4WZS D;  1TBP A;  4ROD B;  2IV8 A;  1QTP A;  3H1Z A;  1MP9 A;  4ROE B;  1QN4 A;  1AIS A;  3OCI A;  1QTS A;  1PZD A;  1W80 A;  1QNA A;  3ASM A;  1C9B B;  2D0B A;  1NVP A;  1R4X A;  1TBA B;  1VOL B;  2Z8U A;  2MJ7 A;  1VTL E;  1KYU A;  3OC3 C;  1NH2 A;  1QNB A;  1TGH A;  1CDW A;  1QN5 A;  2VJ0 A;  1KY7 A;  1QN8 A;  1KY6 A;  1PCZ A;  1D3U A;  5IYC P;  1VTO A;  1QN6 A;  2IV9 A;  3EIK A;  1QNE A;  2G30 A;  1YTB A;  3HS9 A;  3HS8 A;  1KYF A;  1E42 A;  1RM1 A;  1QN9 A;  4ROC B;  1JFI C;  1B9K A; 
#chains in the Genus database with same CATH topology
 2NLV A;  3D4V A;  4I8O A;  3DPU A;  3OSM A;  3DPT A;  5JN5 A;  1XSZ A;  2HL8 A;  1VOK A;  2V8Q A;  3I3W A;  1QN7 A;  2NOZ A;  5IYD P;  4BJU A;  1PCM X;  2MZ8 A;  3CWA A;  2H4L X;  3EAY A;  4DUL A;  2DKA A;  1TBP A;  2NWV A;  4IL8 A;  3RSM A;  2DKD A;  3UW2 A;  2IV8 A;  3I0W A;  2QR1 A;  2NOI A;  1M3H A;  4ROE B;  1QN4 A;  1M5Q 1;  1AIS A;  1N3C A;  1PZD A;  1QTS A;  3I0X A;  3ASM A;  2HKP A;  5HSH A;  2QRC A;  3CVT A;  1VOL B;  1VTL E;  3OC3 C;  1WJW A;  1KFI A;  3OH9 A;  2VJ0 A;  1KY7 A;  1QN8 A;  1PCZ A;  2YH5 A;  1VTO A;  3EIK A;  4EAK A;  1QNE A;  3F0Z A;  3IH7 A;  1HU0 A;  3NA5 A;  2FGT A;  2F7L A;  2PWW A;  3BKQ X;  1QN9 A;  4ROC B;  4D7R A;  1UT4 A;  1YTF A;  1C4G A;  1TUO A;  2HZM A;  2FKF A;  1LWW A;  3TDH A;  4EAJ A;  1LWV A;  2D0C A;  4EAG A;  1K2Y X;  4HJH A;  2JHN A;  1QTP A;  2Y8Q A;  3N89 A;  1MP9 A;  2XHI A;  3C04 A;  3OH6 A;  1W80 A;  1PCJ X;  1C9B B;  2V9J A;  5JMV D;  1NVP A;  2Z8U A;  2YA3 A;  2FUV A;  1KYU A;  1K35 A;  1NH2 A;  1QNB A;  1KY6 A;  1Q9U A;  2FKM X;  4WXA A;  2NOB A;  2QRE A;  3SNS A;  3OST A;  1KO9 A;  3KRM A;  1V5S A;  1E42 A;  3CWU A;  1T6A A;  5BMP A;  2HL9 A;  1TGH A;  1N3A A;  1VKL A;  1N39 A;  1EBM A;  4EAL A;  2DKC A;  1WQA A;  4EJY A;  3ULX A;  2HZS A;  1YQL A;  1FN7 A;  1KYD A;  1QN3 A;  4PY5 A;  3ENC A;  4CFF A;  2NOL A;  2NVM A;  2R5X A;  3OLP A;  3CVS A;  3D7Q A;  4Q11 A;  1LXT A;  3T4N A;  3CWS A;  4C7P A;  1C47 A;  4D7Q A;  2MJ7 A;  1YQM A;  1M3Q A;  1MPG A;  4WX8 A;  2JHJ A;  2NOE A;  1YQR A;  2H5A X;  1KFQ A;  5IYC P;  2IV9 A;  1YTB A;  2G30 A;  3CWT A;  5EPC A;  2V92 A;  1RM1 A;  1UT7 A;  2QRD A;  1CDW A;  1P5D X;  1D3U A;  2EHB D;  1QN5 A;  1J3M A;  4EAI A;  2O3O A;  1JDY A;  2OOY A;  3PMG A;  5AN4 A;  3KTU A;  3ENO C;  4B0A A;  2D0A A;  1QNC A;  3VN5 A;  5BMN A;  2JOI A;  2Y8L A;  3F10 A;  5KL0 A;  5IYB P;  1YQK A;  1NGM A;  5F9C A;  4WZS D;  2Z0F A;  4ROD B;  4EJZ A;  2NOH A;  3H1Z A;  3RPJ A;  4MRQ A;  2QLV A;  3OCI A;  1QNA A;  2NOF A;  1LWY A;  2D0B A;  1R4X A;  1TBA B;  1EUV A;  1DIZ A;  2JPI A;  1P5G X;  4TPS A;  1PVS A;  2LAE A;  1QN6 A;  3PDK A;  3OGD A;  3HS9 A;  3HS8 A;  2ZFD B;  1UL7 A;  4QG5 A;  3TE5 A;  1JFI C;  1KYF A;  2I5W A;  2OOX A;  3CW7 A;  3OSE A;  1B9K A; 
#chains in the Genus database with same CATH homology
 4I8O A;  3DPU A;  3OSM A;  3DPT A;  1VOK A;  1QN7 A;  2NOZ A;  5IYD P;  2MZ8 A;  4DUL A;  1TBP A;  3I0W A;  2IV8 A;  2NOI A;  1M3H A;  4ROE B;  1QN4 A;  1AIS A;  1N3C A;  1QTS A;  1PZD A;  3I0X A;  3ASM A;  1VOL B;  1VTL E;  3OC3 C;  2VJ0 A;  1KY7 A;  1QN8 A;  1PCZ A;  2YH5 A;  1VTO A;  3EIK A;  1QNE A;  3F0Z A;  3IH7 A;  1HU0 A;  2FGT A;  1QN9 A;  4ROC B;  1UT4 A;  1YTF A;  2HZM A;  1LWW A;  1LWV A;  2D0C A;  3N89 A;  1QTP A;  2XHI A;  1MP9 A;  1W80 A;  1C9B B;  1NVP A;  2Z8U A;  1QNB A;  1KYU A;  1NH2 A;  1KY6 A;  2NOB A;  3SNS A;  3OST A;  1KO9 A;  3KRM A;  1E42 A;  1TGH A;  1N3A A;  1N39 A;  1EBM A;  4EJY A;  3ULX A;  2HZS A;  1YQL A;  1FN7 A;  1KYD A;  1QN3 A;  4PY5 A;  2NOL A;  4Q11 A;  2MJ7 A;  1YQM A;  1M3Q A;  2NOE A;  1YQR A;  5IYC P;  2IV9 A;  1YTB A;  2G30 A;  1RM1 A;  1UT7 A;  1CDW A;  1QN5 A;  1D3U A;  2O3O A;  3KTU A;  5AN4 A;  4B0A A;  2D0A A;  1QNC A;  3VN5 A;  2JOI A;  3F10 A;  1YQK A;  5IYB P;  1NGM A;  4WZS D;  4ROD B;  4EJZ A;  2NOH A;  3H1Z A;  3RPJ A;  3OCI A;  1QNA A;  2NOF A;  1LWY A;  2D0B A;  1R4X A;  1TBA B;  4TPS A;  2LAE A;  1QN6 A;  3HS9 A;  3HS8 A;  1KYF A;  2I5W A;  1JFI C;  1B9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...