1V5SA

Solution structure of kinase associated domain 1 of mouse map/microtubule affinity-regulating kinase 3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
126
structure length
126
Chain Sequence
MKDHLIHNVHKEEHAHAHNKDYDIPTTENLYFQGSSGSSGDMMREIRKVLGANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Solution structure of kinase associated domain 1 of mouse MAP/microtubule affinity-regulating kinase 3
rcsb
source organism Mus musculus
total genus 16
structure length 126
sequence length 126
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02149 KA1 Kinase associated domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 1v5sA00
1V5SA 4EAJA 2QRCA 2OOYA 3TDHA 2V9JA 4CFFA 2QLVA 3TE5A 2QREA 3T4NA 3OSEA 2Y8QA 4EALA 2YA3A 4EAKA 2EHBD 2OOXA 1UL7A 4EAGA 2Y8LA 4EAIA 2V92A 2V8QA 2QRDA 2ZFDB 2QR1A
chains in the Genus database with same CATH superfamily
1W80A 1KYUA 2Z0FA 5JN5A 1YQMA 1LXTA 2OOYA 3HS8A 3KTUA 1DIZA 1AISA 4EJZA 1K35A 2IV8A 3N89A 2NOEA 3CWTA 1PCJX 2DKCA 2DKAA 2D0AA 2DKDA 2NLVA 1TBAB 3OCIA 3SNSA 3T4NA 3OSEA 5IYCP 3IH7A 3CWUA 3CWSA 1QN9A 3CWAA 1VOKA 1TGHA 1MP9A 1KO9A 2Y8QA 1UT7A 2JPIA 5BMNA 4EAKA 4WX8A 2EHBD 1VTOA 3EAYA 2OOXA 3OC3C 1NVPA 1HU0A 3CVSA 1Q9UA 1WJWA 4EAIA 3C04A 1VKLA 4I8OA 1MPGA 4BJUA 1YTFA 4DULA 2V92A 3HS9A 1D3UA 2QR1A 3CVTA 3UW2A 3I3WA 1V5SA 2HL8A 1KYDA 3DPTA 2NVMA 1N3AA 1PVSA 4D7RA 1XSZA 3TDHA 3OH6A 1YQKA 2R5XA 1PZDA 1EUVA 2QLVA 2I5WA 5HSHA 1N3CA 1JFIC 1KFIA 1QTPA 4ROCB 1KYFA 2VJ0A 1P5DX 3D7QA 4EJYA 2YA3A 1KFQA 1JDYA 1EBMA 1PCZA 1FN7A 3PMGA 2NOZA 4IL8A 4QG5A 4EAGA 2NOIA 3CW7A 2LAEA 2D0CA 4WZSD 1KY6A 2JHJA 3I0WA 5JMVD 3EIKA 2NOHA 2H5AX 3ENCA 1QNAA 2V8QA 1TBPA 1CDWA 1YQRA 1QNEA 1WQAA 5IYDP 5EPCA 2PWWA 2NOFA 1R4XA 2JOIA 2IV9A 2NWVA 4B0AA 1B9KA 3I0XA 1M5Q1 2V9JA 3H1ZA 3RPJA 1NGMA 1UT4A 4MRQA 2HZMA 2NOBA 2QREA 1LWVA 1QN8A 4RODB 4PY5A 1QTSA 2HKPA 2MJ7A 3KRMA 4HJHA 1QN7A 4EALA 3ULXA 3VN5A 1J3MA 2MZ8A 1NH2A 5IYBP 1QN6A 3D4VA 3ASMA 3OSMA 1E42A 5KL0A 3OGDA 3DPUA 4D7QA 3OH9A 2Z8UA 3NA5A 2ZFDB 2XHIA 1LWWA 1C9BB 2HZSA 4ROEB 2NOLA 3ENOC 1RM1A 5F9CA 5AN4A 5BMPA 4EAJA 2QRCA 4TPSA 1PCMX 3BKQX 1K2YX 1M3QA 2FKFA 4WXAA 1KY7A 1P5GX 4CFFA 1LWYA 3TE5A 1C47A 1M3HA 2FKMX 1YTBA 2HL9A 2FGTA 2O3OA 1QNBA 1QN3A 2JHNA 3OLPA 1C4GA 2YH5A 4C7PA 4Q11A 1VTLE 1UL7A 1QN5A 2F7LA 1YQLA 3PDKA 2Y8LA 1QN4A 1QNCA 3RSMA 1N39A 1VOLB 2D0BA 2H4LX 3F0ZA 2QRDA 2FUVA 3F10A 3OSTA 1TUOA 2G30A 1T6AA
chains in the Genus database with same CATH topology
1V5SA 4EAJA 2QRCA 2OOYA 3TDHA 2V9JA 4CFFA 2QLVA 3TE5A 2QREA 3T4NA 3OSEA 2Y8QA 4EALA 2YA3A 4EAKA 2EHBD 2OOXA 1UL7A 4EAGA 2Y8LA 4EAIA 2V92A 2V8QA 2QRDA 2ZFDB 2QR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5S A;  4EAJ A;  2QRC A;  2OOY A;  3TDH A;  2V9J A;  4CFF A;  2QLV A;  3TE5 A;  2QRE A;  3T4N A;  3OSE A;  2Y8Q A;  4EAL A;  2YA3 A;  4EAK A;  2EHB D;  2OOX A;  1UL7 A;  4EAG A;  2Y8L A;  4EAI A;  2V92 A;  2V8Q A;  2QRD A;  2ZFD B;  2QR1 A; 
#chains in the Genus database with same CATH topology
 1W80 A;  1KYU A;  2Z0F A;  5JN5 A;  1YQM A;  1LXT A;  2OOY A;  3HS8 A;  3KTU A;  1DIZ A;  1AIS A;  4EJZ A;  1K35 A;  2IV8 A;  3N89 A;  2NOE A;  3CWT A;  1PCJ X;  2DKC A;  2DKA A;  2D0A A;  2DKD A;  2NLV A;  1TBA B;  3OCI A;  3SNS A;  3T4N A;  3OSE A;  5IYC P;  3IH7 A;  3CWU A;  3CWS A;  1QN9 A;  3CWA A;  1VOK A;  1TGH A;  1MP9 A;  1KO9 A;  2Y8Q A;  1UT7 A;  2JPI A;  5BMN A;  4EAK A;  4WX8 A;  2EHB D;  1VTO A;  3EAY A;  2OOX A;  3OC3 C;  1NVP A;  1HU0 A;  3CVS A;  1Q9U A;  1WJW A;  4EAI A;  3C04 A;  1VKL A;  4I8O A;  1MPG A;  4BJU A;  1YTF A;  4DUL A;  2V92 A;  3HS9 A;  1D3U A;  2QR1 A;  3CVT A;  3UW2 A;  3I3W A;  1V5S A;  2HL8 A;  1KYD A;  3DPT A;  2NVM A;  1N3A A;  1PVS A;  4D7R A;  1XSZ A;  3TDH A;  3OH6 A;  1YQK A;  2R5X A;  1PZD A;  1EUV A;  2QLV A;  2I5W A;  5HSH A;  1N3C A;  1JFI C;  1KFI A;  1QTP A;  4ROC B;  1KYF A;  2VJ0 A;  1P5D X;  3D7Q A;  4EJY A;  2YA3 A;  1KFQ A;  1JDY A;  1EBM A;  1PCZ A;  1FN7 A;  3PMG A;  2NOZ A;  4IL8 A;  4QG5 A;  4EAG A;  2NOI A;  3CW7 A;  2LAE A;  2D0C A;  4WZS D;  1KY6 A;  2JHJ A;  3I0W A;  5JMV D;  3EIK A;  2NOH A;  2H5A X;  3ENC A;  1QNA A;  2V8Q A;  1TBP A;  1CDW A;  1YQR A;  1QNE A;  1WQA A;  5IYD P;  5EPC A;  2PWW A;  2NOF A;  1R4X A;  2JOI A;  2IV9 A;  2NWV A;  4B0A A;  1B9K A;  3I0X A;  1M5Q 1;  2V9J A;  3H1Z A;  3RPJ A;  1NGM A;  1UT4 A;  4MRQ A;  2HZM A;  2NOB A;  2QRE A;  1LWV A;  1QN8 A;  4ROD B;  4PY5 A;  1QTS A;  2HKP A;  2MJ7 A;  3KRM A;  4HJH A;  1QN7 A;  4EAL A;  3ULX A;  3VN5 A;  1J3M A;  2MZ8 A;  1NH2 A;  5IYB P;  1QN6 A;  3D4V A;  3ASM A;  3OSM A;  1E42 A;  5KL0 A;  3OGD A;  3DPU A;  4D7Q A;  3OH9 A;  2Z8U A;  3NA5 A;  2ZFD B;  2XHI A;  1LWW A;  1C9B B;  2HZS A;  4ROE B;  2NOL A;  3ENO C;  1RM1 A;  5F9C A;  5AN4 A;  5BMP A;  4EAJ A;  2QRC A;  4TPS A;  1PCM X;  3BKQ X;  1K2Y X;  1M3Q A;  2FKF A;  4WXA A;  1KY7 A;  1P5G X;  4CFF A;  1LWY A;  3TE5 A;  1C47 A;  1M3H A;  2FKM X;  1YTB A;  2HL9 A;  2FGT A;  2O3O A;  1QNB A;  1QN3 A;  2JHN A;  3OLP A;  1C4G A;  2YH5 A;  4C7P A;  4Q11 A;  1VTL E;  1UL7 A;  1QN5 A;  2F7L A;  1YQL A;  3PDK A;  2Y8L A;  1QN4 A;  1QNC A;  3RSM A;  1N39 A;  1VOL B;  2D0B A;  2H4L X;  3F0Z A;  2QRD A;  2FUV A;  3F10 A;  3OST A;  1TUO A;  2G30 A;  1T6A A; 
#chains in the Genus database with same CATH homology
 1V5S A;  4EAJ A;  2QRC A;  2OOY A;  3TDH A;  2V9J A;  4CFF A;  2QLV A;  3TE5 A;  2QRE A;  3T4N A;  3OSE A;  2Y8Q A;  4EAL A;  2YA3 A;  4EAK A;  2EHB D;  2OOX A;  1UL7 A;  4EAG A;  2Y8L A;  4EAI A;  2V92 A;  2V8Q A;  2QRD A;  2ZFD B;  2QR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...