4EAKA

Co-crystal structure of an ampk core with atp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
92
Chain Sequence
WHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 92
sequence length 99
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 4eakA01
2QLVA 2QRCA 3TDHA 3OSEA 2V8QA 2QREA 1UL7A 2V92A 4EAJA 4EALA 2OOXA 2OOYA 2YA3A 2EHBD 4EAGA 2V9JA 4EAIA 1V5SA 3TE5A 2QRDA 3T4NA 2Y8QA 2Y8LA 2ZFDB 4CFFA 4EAKA 2QR1A
chains in the Genus database with same CATH superfamily
1KY6A 2PWWA 3OSEA 3I3WA 4EAJA 4HJHA 4I8OA 3OSMA 3VN5A 1VKLA 5JMVD 3OH9A 2NLVA 1B9KA 4BJUA 1QTSA 3HS8A 2OOYA 2YA3A 1QTPA 3OH6A 1KFQA 3RPJA 2D0CA 4D7RA 3ASMA 1LWVA 1QN7A 1QN5A 3SNSA 5IYBP 4ROEB 1QN8A 4EAGA 5AN4A 3N89A 5EPCA 1KY7A 3F10A 1FN7A 1DIZA 3ENCA 2NOHA 2O3OA 4MRQA 4B0AA 5F9CA 2JHNA 1JDYA 3C04A 5IYCP 1QN3A 1VOLB 1KO9A 4EJYA 2NOEA 3OC3C 3ULXA 3CWTA 2H5AX 2VJ0A 2F7LA 1M3HA 2ZFDB 3I0XA 3PDKA 1QNEA 2I5WA 3KTUA 2QR1A 5KL0A 1YTFA 2QLVA 1QN6A 1KYFA 2QRCA 2NOLA 3TDHA 1PCJX 1P5DX 1R4XA 2QREA 2V8QA 4D7QA 2Z0FA 1LWYA 1C4GA 4RODB 3HS9A 1NGMA 2OOXA 2D0AA 1K2YX 2EHBD 5JN5A 2G30A 1WQAA 1N3AA 1PCMX 1UT7A 1YQMA 3DPUA 3OSTA 4TPSA 1EUVA 1QNBA 3UW2A 2FKMX 1P5GX 2QRDA 3BKQX 2FGTA 1YQRA 1YQKA 2MJ7A 1N3CA 1C9BB 3EAYA 3F0ZA 2Y8LA 3DPTA 5IYDP 3CWAA 1D3UA 2FUVA 1KYUA 1QNCA 1MP9A 3CVSA 1N39A 1M3QA 1CDWA 5HSHA 1C47A 2V92A 3OGDA 4EALA 2IV9A 2HL8A 1QN4A 3CWSA 2DKAA 3EIKA 3KRMA 2DKDA 2NOIA 2NVMA 2FKFA 2LAEA 4DULA 3PMGA 2JPIA 3D4VA 1VOKA 4WZSD 5BMNA 1RM1A 1NVPA 1QN9A 2DKCA 1W80A 2Z8UA 3OLPA 4EJZA 4WXAA 2JHJA 4EAIA 1HU0A 1M5Q1 1PZDA 1KFIA 2HL9A 2Y8QA 1QNAA 1T6AA 4IL8A 1PVSA 2D0BA 1NH2A 1VTOA 4QG5A 3OCIA 1PCZA 1EBMA 3H1ZA 2XHIA 3CW7A 1UL7A 2NWVA 2HZSA 3IH7A 1XSZA 2HKPA 3D7QA 2HZMA 1JFIC 2NOFA 3ENOC 1J3MA 2IV8A 1LXTA 1UT4A 2NOBA 4PY5A 1K35A 2H4LX 3NA5A 1WJWA 5BMPA 1VTLE 1TBAB 4C7PA 2V9JA 1TGHA 1YQLA 1E42A 2JOIA 1V5SA 1TUOA 2MZ8A 3TE5A 3T4NA 3CWUA 1Q9UA 4Q11A 3CVTA 1YTBA 1LWWA 2NOZA 1KYDA 4ROCB 1TBPA 1MPGA 2R5XA 4WX8A 3RSMA 4CFFA 4EAKA 1AISA 2YH5A 3I0WA
chains in the Genus database with same CATH topology
2QLVA 2QRCA 3TDHA 3OSEA 2V8QA 2QREA 1UL7A 2V92A 4EAJA 4EALA 2OOXA 2OOYA 2YA3A 2EHBD 4EAGA 2V9JA 4EAIA 1V5SA 3TE5A 2QRDA 3T4NA 2Y8QA 2Y8LA 2ZFDB 4CFFA 4EAKA 2QR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLV A;  2QRC A;  3TDH A;  3OSE A;  2V8Q A;  2QRE A;  1UL7 A;  2V92 A;  4EAJ A;  4EAL A;  2OOX A;  2OOY A;  2YA3 A;  2EHB D;  4EAG A;  2V9J A;  4EAI A;  1V5S A;  3TE5 A;  2QRD A;  3T4N A;  2Y8Q A;  2Y8L A;  2ZFD B;  4CFF A;  4EAK A;  2QR1 A; 
#chains in the Genus database with same CATH topology
 1KY6 A;  2PWW A;  3OSE A;  3I3W A;  4EAJ A;  4HJH A;  4I8O A;  3OSM A;  3VN5 A;  1VKL A;  5JMV D;  3OH9 A;  2NLV A;  1B9K A;  4BJU A;  1QTS A;  3HS8 A;  2OOY A;  2YA3 A;  1QTP A;  3OH6 A;  1KFQ A;  3RPJ A;  2D0C A;  4D7R A;  3ASM A;  1LWV A;  1QN7 A;  1QN5 A;  3SNS A;  5IYB P;  4ROE B;  1QN8 A;  4EAG A;  5AN4 A;  3N89 A;  5EPC A;  1KY7 A;  3F10 A;  1FN7 A;  1DIZ A;  3ENC A;  2NOH A;  2O3O A;  4MRQ A;  4B0A A;  5F9C A;  2JHN A;  1JDY A;  3C04 A;  5IYC P;  1QN3 A;  1VOL B;  1KO9 A;  4EJY A;  2NOE A;  3OC3 C;  3ULX A;  3CWT A;  2H5A X;  2VJ0 A;  2F7L A;  1M3H A;  2ZFD B;  3I0X A;  3PDK A;  1QNE A;  2I5W A;  3KTU A;  2QR1 A;  5KL0 A;  1YTF A;  2QLV A;  1QN6 A;  1KYF A;  2QRC A;  2NOL A;  3TDH A;  1PCJ X;  1P5D X;  1R4X A;  2QRE A;  2V8Q A;  4D7Q A;  2Z0F A;  1LWY A;  1C4G A;  4ROD B;  3HS9 A;  1NGM A;  2OOX A;  2D0A A;  1K2Y X;  2EHB D;  5JN5 A;  2G30 A;  1WQA A;  1N3A A;  1PCM X;  1UT7 A;  1YQM A;  3DPU A;  3OST A;  4TPS A;  1EUV A;  1QNB A;  3UW2 A;  2FKM X;  1P5G X;  2QRD A;  3BKQ X;  2FGT A;  1YQR A;  1YQK A;  2MJ7 A;  1N3C A;  1C9B B;  3EAY A;  3F0Z A;  2Y8L A;  3DPT A;  5IYD P;  3CWA A;  1D3U A;  2FUV A;  1KYU A;  1QNC A;  1MP9 A;  3CVS A;  1N39 A;  1M3Q A;  1CDW A;  5HSH A;  1C47 A;  2V92 A;  3OGD A;  4EAL A;  2IV9 A;  2HL8 A;  1QN4 A;  3CWS A;  2DKA A;  3EIK A;  3KRM A;  2DKD A;  2NOI A;  2NVM A;  2FKF A;  2LAE A;  4DUL A;  3PMG A;  2JPI A;  3D4V A;  1VOK A;  4WZS D;  5BMN A;  1RM1 A;  1NVP A;  1QN9 A;  2DKC A;  1W80 A;  2Z8U A;  3OLP A;  4EJZ A;  4WXA A;  2JHJ A;  4EAI A;  1HU0 A;  1M5Q 1;  1PZD A;  1KFI A;  2HL9 A;  2Y8Q A;  1QNA A;  1T6A A;  4IL8 A;  1PVS A;  2D0B A;  1NH2 A;  1VTO A;  4QG5 A;  3OCI A;  1PCZ A;  1EBM A;  3H1Z A;  2XHI A;  3CW7 A;  1UL7 A;  2NWV A;  2HZS A;  3IH7 A;  1XSZ A;  2HKP A;  3D7Q A;  2HZM A;  1JFI C;  2NOF A;  3ENO C;  1J3M A;  2IV8 A;  1LXT A;  1UT4 A;  2NOB A;  4PY5 A;  1K35 A;  2H4L X;  3NA5 A;  1WJW A;  5BMP A;  1VTL E;  1TBA B;  4C7P A;  2V9J A;  1TGH A;  1YQL A;  1E42 A;  2JOI A;  1V5S A;  1TUO A;  2MZ8 A;  3TE5 A;  3T4N A;  3CWU A;  1Q9U A;  4Q11 A;  3CVT A;  1YTB A;  1LWW A;  2NOZ A;  1KYD A;  4ROC B;  1TBP A;  1MPG A;  2R5X A;  4WX8 A;  3RSM A;  4CFF A;  4EAK A;  1AIS A;  2YH5 A;  3I0W A; 
#chains in the Genus database with same CATH homology
 2QLV A;  2QRC A;  3TDH A;  3OSE A;  2V8Q A;  2QRE A;  1UL7 A;  2V92 A;  4EAJ A;  4EAL A;  2OOX A;  2OOY A;  2YA3 A;  2EHB D;  4EAG A;  2V9J A;  4EAI A;  1V5S A;  3TE5 A;  2QRD A;  3T4N A;  2Y8Q A;  2Y8L A;  2ZFD B;  4CFF A;  4EAK A;  2QR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...