4EAKA

Co-crystal structure of an ampk core with atp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
92
Chain Sequence
WHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 21
structure length 92
sequence length 99
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 4eakA01
2OOYA 4EAIA 2EHBD 4CFFA 4EAKA 3TDHA 2OOXA 1UL7A 2QREA 2V92A 2V8QA 4EAJA 4EALA 3OSEA 1V5SA 4EAGA 2V9JA 2Y8QA 2YA3A 2QLVA 2Y8LA 2ZFDB 2QRCA 3TE5A 3T4NA 2QR1A 2QRDA
chains in the Genus database with same CATH superfamily
3C04A 2HL8A 4RODB 2H4LX 3CVTA 2NOEA 4CFFA 1R4XA 1K2YX 1KFIA 1LWVA 2YH5A 1PCMX 2H5AX 4PY5A 3EIKA 4I8OA 3VN5A 3PDKA 3ENCA 3NA5A 1VKLA 1C47A 2PWWA 1YQKA 1MP9A 1TBAB 1V5SA 1KFQA 2JOIA 2D0AA 2DKCA 1UT4A 2JHJA 2QLVA 2O3OA 5HSHA 3CWUA 1NH2A 2NOHA 1Q9UA 3OLPA 1N3CA 3CW7A 2QR1A 1QTPA 4QG5A 3EAYA 2Z8UA 1YQMA 2HKPA 1PVSA 1M3QA 2MJ7A 3OC3C 4WX8A 4EAIA 2EHBD 5IYCP 2F7LA 4MRQA 5JN5A 3F10A 1AISA 2IV9A 2FKMX 5AN4A 1UL7A 1W80A 1N3AA 1PCZA 4ROEB 3OCIA 4C7PA 1TUOA 5BMPA 1JDYA 1D3UA 2FKFA 3OSMA 5EPCA 2I5WA 3I0WA 4EJZA 2V8QA 3PMGA 2NLVA 4EAJA 4EALA 3OSEA 2NWVA 3CWSA 1LWWA 2XHIA 3F0ZA 4EAGA 1M5Q1 1QTSA 4BJUA 2NOLA 3KRMA 1T6AA 2JPIA 1DIZA 3RSMA 1RM1A 1C4GA 1QN7A 3ASMA 3HS9A 1KO9A 1YTFA 2DKAA 2HZMA 2QRDA 3H1ZA 3OSTA 3IH7A 1FN7A 2HL9A 2LAEA 2OOYA 3RPJA 5JMVD 1M3HA 1VOKA 3DPTA 4EAKA 4ROCB 3D4VA 2NOBA 2OOXA 2JHNA 4Q11A 3OH6A 4D7QA 4EJYA 1MPGA 2QREA 1YQRA 1KYUA 1B9KA 4HJHA 1PCJX 1VTLE 2NOIA 1WQAA 3KTUA 2Z0FA 1QNEA 1QNBA 1KY6A 2V9JA 4TPSA 2YA3A 1LWYA 3UW2A 5F9CA 1J3MA 1HU0A 3SNSA 1NGMA 1P5DX 3D7QA 3TE5A 1XSZA 1QNAA 4B0AA 4IL8A 3T4NA 1NVPA 3OGDA 1CDWA 1QNCA 1KYDA 3BKQX 3ULXA 1YTBA 2G30A 1JFIC 1QN9A 1QN5A 5IYBP 1N39A 3DPUA 2D0CA 1EUVA 1QN8A 1VOLB 1WJWA 4WXAA 3TDHA 1LXTA 1YQLA 1QN4A 3N89A 5KL0A 3HS8A 1K35A 2V92A 1KYFA 3OH9A 2HZSA 1TGHA 3ENOC 1QN6A 2IV8A 2DKDA 2FUVA 3CVSA 2NOFA 1E42A 1QN3A 2MZ8A 2R5XA 1VTOA 1KY7A 1TBPA 1PZDA 2VJ0A 2Y8QA 1C9BB 4WZSD 2D0BA 2Y8LA 2NOZA 5IYDP 2ZFDB 4D7RA 2QRCA 1EBMA 4DULA 3I3WA 1UT7A 2FGTA 3CWAA 3I0XA 5BMNA 1P5GX 3CWTA 2NVMA
chains in the Genus database with same CATH topology
2OOYA 4EAIA 2EHBD 4CFFA 4EAKA 3TDHA 2OOXA 1UL7A 2QREA 2V92A 2V8QA 4EAJA 4EALA 3OSEA 1V5SA 4EAGA 2V9JA 2Y8QA 2YA3A 2QLVA 2Y8LA 2ZFDB 2QRCA 3TE5A 3T4NA 2QR1A 2QRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOY A;  4EAI A;  2EHB D;  4CFF A;  4EAK A;  3TDH A;  2OOX A;  1UL7 A;  2QRE A;  2V92 A;  2V8Q A;  4EAJ A;  4EAL A;  3OSE A;  1V5S A;  4EAG A;  2V9J A;  2Y8Q A;  2YA3 A;  2QLV A;  2Y8L A;  2ZFD B;  2QRC A;  3TE5 A;  3T4N A;  2QR1 A;  2QRD A; 
#chains in the Genus database with same CATH topology
 3C04 A;  2HL8 A;  4ROD B;  2H4L X;  3CVT A;  2NOE A;  4CFF A;  1R4X A;  1K2Y X;  1KFI A;  1LWV A;  2YH5 A;  1PCM X;  2H5A X;  4PY5 A;  3EIK A;  4I8O A;  3VN5 A;  3PDK A;  3ENC A;  3NA5 A;  1VKL A;  1C47 A;  2PWW A;  1YQK A;  1MP9 A;  1TBA B;  1V5S A;  1KFQ A;  2JOI A;  2D0A A;  2DKC A;  1UT4 A;  2JHJ A;  2QLV A;  2O3O A;  5HSH A;  3CWU A;  1NH2 A;  2NOH A;  1Q9U A;  3OLP A;  1N3C A;  3CW7 A;  2QR1 A;  1QTP A;  4QG5 A;  3EAY A;  2Z8U A;  1YQM A;  2HKP A;  1PVS A;  1M3Q A;  2MJ7 A;  3OC3 C;  4WX8 A;  4EAI A;  2EHB D;  5IYC P;  2F7L A;  4MRQ A;  5JN5 A;  3F10 A;  1AIS A;  2IV9 A;  2FKM X;  5AN4 A;  1UL7 A;  1W80 A;  1N3A A;  1PCZ A;  4ROE B;  3OCI A;  4C7P A;  1TUO A;  5BMP A;  1JDY A;  1D3U A;  2FKF A;  3OSM A;  5EPC A;  2I5W A;  3I0W A;  4EJZ A;  2V8Q A;  3PMG A;  2NLV A;  4EAJ A;  4EAL A;  3OSE A;  2NWV A;  3CWS A;  1LWW A;  2XHI A;  3F0Z A;  4EAG A;  1M5Q 1;  1QTS A;  4BJU A;  2NOL A;  3KRM A;  1T6A A;  2JPI A;  1DIZ A;  3RSM A;  1RM1 A;  1C4G A;  1QN7 A;  3ASM A;  3HS9 A;  1KO9 A;  1YTF A;  2DKA A;  2HZM A;  2QRD A;  3H1Z A;  3OST A;  3IH7 A;  1FN7 A;  2HL9 A;  2LAE A;  2OOY A;  3RPJ A;  5JMV D;  1M3H A;  1VOK A;  3DPT A;  4EAK A;  4ROC B;  3D4V A;  2NOB A;  2OOX A;  2JHN A;  4Q11 A;  3OH6 A;  4D7Q A;  4EJY A;  1MPG A;  2QRE A;  1YQR A;  1KYU A;  1B9K A;  4HJH A;  1PCJ X;  1VTL E;  2NOI A;  1WQA A;  3KTU A;  2Z0F A;  1QNE A;  1QNB A;  1KY6 A;  2V9J A;  4TPS A;  2YA3 A;  1LWY A;  3UW2 A;  5F9C A;  1J3M A;  1HU0 A;  3SNS A;  1NGM A;  1P5D X;  3D7Q A;  3TE5 A;  1XSZ A;  1QNA A;  4B0A A;  4IL8 A;  3T4N A;  1NVP A;  3OGD A;  1CDW A;  1QNC A;  1KYD A;  3BKQ X;  3ULX A;  1YTB A;  2G30 A;  1JFI C;  1QN9 A;  1QN5 A;  5IYB P;  1N39 A;  3DPU A;  2D0C A;  1EUV A;  1QN8 A;  1VOL B;  1WJW A;  4WXA A;  3TDH A;  1LXT A;  1YQL A;  1QN4 A;  3N89 A;  5KL0 A;  3HS8 A;  1K35 A;  2V92 A;  1KYF A;  3OH9 A;  2HZS A;  1TGH A;  3ENO C;  1QN6 A;  2IV8 A;  2DKD A;  2FUV A;  3CVS A;  2NOF A;  1E42 A;  1QN3 A;  2MZ8 A;  2R5X A;  1VTO A;  1KY7 A;  1TBP A;  1PZD A;  2VJ0 A;  2Y8Q A;  1C9B B;  4WZS D;  2D0B A;  2Y8L A;  2NOZ A;  5IYD P;  2ZFD B;  4D7R A;  2QRC A;  1EBM A;  4DUL A;  3I3W A;  1UT7 A;  2FGT A;  3CWA A;  3I0X A;  5BMN A;  1P5G X;  3CWT A;  2NVM A; 
#chains in the Genus database with same CATH homology
 2OOY A;  4EAI A;  2EHB D;  4CFF A;  4EAK A;  3TDH A;  2OOX A;  1UL7 A;  2QRE A;  2V92 A;  2V8Q A;  4EAJ A;  4EAL A;  3OSE A;  1V5S A;  4EAG A;  2V9J A;  2Y8Q A;  2YA3 A;  2QLV A;  2Y8L A;  2ZFD B;  2QRC A;  3TE5 A;  3T4N A;  2QR1 A;  2QRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...