4EAKA

Co-crystal structure of an ampk core with atp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
92
Chain Sequence
WHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 21
structure length 92
sequence length 99
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 4eakA01
2QR1A 2Y8QA 4EAGA 3T4NA 2OOYA 2QRCA 2ZFDB 2EHBD 2V9JA 2QREA 2V8QA 4EAIA 2QRDA 2OOXA 4CFFA 1UL7A 2QLVA 4EAJA 3TDHA 3TE5A 3OSEA 2V92A 2Y8LA 2YA3A 4EALA 4EAKA 1V5SA
chains in the Genus database with same CATH superfamily
2D0BA 1KYFA 2YH5A 3DPUA 2Z0FA 4WXAA 1N3AA 1QNBA 1K2YX 5IYCP 2D0AA 3RPJA 2PWWA 3ASMA 2QRCA 1MPGA 2F7LA 4C7PA 2ZFDB 4D7RA 4ROEB 1NH2A 2NOBA 1XSZA 2NOEA 1VKLA 1LWYA 2EHBD 2HZMA 4ROCB 3HS9A 3PMGA 3CWSA 1WQAA 1EBMA 2JOIA 5KL0A 3N89A 5AN4A 1P5DX 1N39A 1QNEA 2FKMX 1VTLE 1WJWA 1KFIA 1MP9A 3BKQX 3H1ZA 3TE5A 1C9BB 3CW7A 3F0ZA 1TBPA 1QNAA 3EAYA 3UW2A 3ENCA 5EPCA 5IYBP 1K35A 2LAEA 1QN5A 1QTPA 1C4GA 1V5SA 3OC3C 1RM1A 2FKFA 2QR1A 2NLVA 2Y8QA 1YTBA 1EUVA 1YQKA 3RSMA 4EJYA 3D7QA 3NA5A 4WX8A 2G30A 1P5GX 1E42A 2DKCA 1VOKA 1YQMA 1M3HA 3C04A 1JFIC 1M3QA 1DIZA 2NOLA 1PCZA 1TGHA 3IH7A 2NWVA 1LWVA 4QG5A 2FGTA 4PY5A 4EAIA 1FN7A 2QRDA 3VN5A 5HSHA 1QNCA 3OCIA 3OLPA 3CWTA 2DKDA 1QN6A 1KY7A 1LWWA 4HJHA 2NOZA 4EALA 2DKAA 2MZ8A 2MJ7A 3OSTA 4D7QA 2IV8A 2NVMA 1KY6A 1KYDA 1W80A 3ENOC 4EAGA 2D0CA 4I8OA 1HU0A 2XHIA 3CVSA 2NOIA 4DULA 3I0XA 2H5AX 5JN5A 4EJZA 4BJUA 1QN7A 3CWUA 1D3UA 3HS8A 2HL8A 2R5XA 2V9JA 2V8QA 3SNSA 1Q9UA 1TBAB 3DPTA 5BMPA 4MRQA 1CDWA 1YQLA 1UL7A 3D4VA 4EAJA 2JHJA 3TDHA 1LXTA 1UT4A 1JDYA 1QTSA 3OH9A 2YA3A 3CVTA 4TPSA 1PCMX 1KFQA 2HZSA 2JPIA 3KTUA 2HKPA 1T6AA 2NOHA 1N3CA 1PVSA 1YQRA 3OSMA 4RODB 5JMVD 2NOFA 3I0WA 3ULXA 3PDKA 1KO9A 5F9CA 1QN8A 3T4NA 3OH6A 2VJ0A 2OOYA 1J3MA 1B9KA 3EIKA 1QN3A 4B0AA 2Z8UA 1M5Q1 1NVPA 1VTOA 4WZSD 2O3OA 1UT7A 2FUVA 1QN4A 2QREA 2H4LX 5BMNA 2OOXA 3F10A 4CFFA 2IV9A 2QLVA 3CWAA 1PZDA 3OSEA 4IL8A 1PCJX 2V92A 2Y8LA 2JHNA 3OGDA 1AISA 2HL9A 1TUOA 5IYDP 1YTFA 4Q11A 2I5WA 3I3WA 1QN9A 1VOLB 1NGMA 1C47A 3KRMA 1KYUA 4EAKA 1R4XA
chains in the Genus database with same CATH topology
2QR1A 2Y8QA 4EAGA 3T4NA 2OOYA 2QRCA 2ZFDB 2EHBD 2V9JA 2QREA 2V8QA 4EAIA 2QRDA 2OOXA 4CFFA 1UL7A 2QLVA 4EAJA 3TDHA 3TE5A 3OSEA 2V92A 2Y8LA 2YA3A 4EALA 4EAKA 1V5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QR1 A;  2Y8Q A;  4EAG A;  3T4N A;  2OOY A;  2QRC A;  2ZFD B;  2EHB D;  2V9J A;  2QRE A;  2V8Q A;  4EAI A;  2QRD A;  2OOX A;  4CFF A;  1UL7 A;  2QLV A;  4EAJ A;  3TDH A;  3TE5 A;  3OSE A;  2V92 A;  2Y8L A;  2YA3 A;  4EAL A;  4EAK A;  1V5S A; 
#chains in the Genus database with same CATH topology
 2D0B A;  1KYF A;  2YH5 A;  3DPU A;  2Z0F A;  4WXA A;  1N3A A;  1QNB A;  1K2Y X;  5IYC P;  2D0A A;  3RPJ A;  2PWW A;  3ASM A;  2QRC A;  1MPG A;  2F7L A;  4C7P A;  2ZFD B;  4D7R A;  4ROE B;  1NH2 A;  2NOB A;  1XSZ A;  2NOE A;  1VKL A;  1LWY A;  2EHB D;  2HZM A;  4ROC B;  3HS9 A;  3PMG A;  3CWS A;  1WQA A;  1EBM A;  2JOI A;  5KL0 A;  3N89 A;  5AN4 A;  1P5D X;  1N39 A;  1QNE A;  2FKM X;  1VTL E;  1WJW A;  1KFI A;  1MP9 A;  3BKQ X;  3H1Z A;  3TE5 A;  1C9B B;  3CW7 A;  3F0Z A;  1TBP A;  1QNA A;  3EAY A;  3UW2 A;  3ENC A;  5EPC A;  5IYB P;  1K35 A;  2LAE A;  1QN5 A;  1QTP A;  1C4G A;  1V5S A;  3OC3 C;  1RM1 A;  2FKF A;  2QR1 A;  2NLV A;  2Y8Q A;  1YTB A;  1EUV A;  1YQK A;  3RSM A;  4EJY A;  3D7Q A;  3NA5 A;  4WX8 A;  2G30 A;  1P5G X;  1E42 A;  2DKC A;  1VOK A;  1YQM A;  1M3H A;  3C04 A;  1JFI C;  1M3Q A;  1DIZ A;  2NOL A;  1PCZ A;  1TGH A;  3IH7 A;  2NWV A;  1LWV A;  4QG5 A;  2FGT A;  4PY5 A;  4EAI A;  1FN7 A;  2QRD A;  3VN5 A;  5HSH A;  1QNC A;  3OCI A;  3OLP A;  3CWT A;  2DKD A;  1QN6 A;  1KY7 A;  1LWW A;  4HJH A;  2NOZ A;  4EAL A;  2DKA A;  2MZ8 A;  2MJ7 A;  3OST A;  4D7Q A;  2IV8 A;  2NVM A;  1KY6 A;  1KYD A;  1W80 A;  3ENO C;  4EAG A;  2D0C A;  4I8O A;  1HU0 A;  2XHI A;  3CVS A;  2NOI A;  4DUL A;  3I0X A;  2H5A X;  5JN5 A;  4EJZ A;  4BJU A;  1QN7 A;  3CWU A;  1D3U A;  3HS8 A;  2HL8 A;  2R5X A;  2V9J A;  2V8Q A;  3SNS A;  1Q9U A;  1TBA B;  3DPT A;  5BMP A;  4MRQ A;  1CDW A;  1YQL A;  1UL7 A;  3D4V A;  4EAJ A;  2JHJ A;  3TDH A;  1LXT A;  1UT4 A;  1JDY A;  1QTS A;  3OH9 A;  2YA3 A;  3CVT A;  4TPS A;  1PCM X;  1KFQ A;  2HZS A;  2JPI A;  3KTU A;  2HKP A;  1T6A A;  2NOH A;  1N3C A;  1PVS A;  1YQR A;  3OSM A;  4ROD B;  5JMV D;  2NOF A;  3I0W A;  3ULX A;  3PDK A;  1KO9 A;  5F9C A;  1QN8 A;  3T4N A;  3OH6 A;  2VJ0 A;  2OOY A;  1J3M A;  1B9K A;  3EIK A;  1QN3 A;  4B0A A;  2Z8U A;  1M5Q 1;  1NVP A;  1VTO A;  4WZS D;  2O3O A;  1UT7 A;  2FUV A;  1QN4 A;  2QRE A;  2H4L X;  5BMN A;  2OOX A;  3F10 A;  4CFF A;  2IV9 A;  2QLV A;  3CWA A;  1PZD A;  3OSE A;  4IL8 A;  1PCJ X;  2V92 A;  2Y8L A;  2JHN A;  3OGD A;  1AIS A;  2HL9 A;  1TUO A;  5IYD P;  1YTF A;  4Q11 A;  2I5W A;  3I3W A;  1QN9 A;  1VOL B;  1NGM A;  1C47 A;  3KRM A;  1KYU A;  4EAK A;  1R4X A; 
#chains in the Genus database with same CATH homology
 2QR1 A;  2Y8Q A;  4EAG A;  3T4N A;  2OOY A;  2QRC A;  2ZFD B;  2EHB D;  2V9J A;  2QRE A;  2V8Q A;  4EAI A;  2QRD A;  2OOX A;  4CFF A;  1UL7 A;  2QLV A;  4EAJ A;  3TDH A;  3TE5 A;  3OSE A;  2V92 A;  2Y8L A;  2YA3 A;  4EAL A;  4EAK A;  1V5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...