1VOKA

Arabidopsis thaliana tbp (dimer)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
192
structure length
192
Chain Sequence
EGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TATA-BOX-BINDING PROTEIN
publication title 2.1 A resolution refined structure of a TATA box-binding protein (TBP).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription factor
total genus 49
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vokA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vokA02
1KY6A 1KYUA 1TBAB 1NGMA 5IYBP 1JFIC 4B0AA 2IV8A 1QNBA 5IYCP 3HS8A 1CDWA 1TGHA 4ROCB 1TBPA 4PY5A 1MP9A 3VN5A 2IV9A 3H1ZA 1E42A 1KYDA 1QN7A 2D0CA 4ROEB 1QN5A 1VTOA 2Z8UA 2G30A 2VJ0A 1B9KA 3OC3C 3EIKA 1RM1A 1D3UA 1QN9A 1VOLB 1NH2A 2MJ7A 1YTFA 1YTBA 1NVPA 1AISA 1KYFA 1QNEA 1QN4A 1KY7A 4WZSD 1QNAA 1PZDA 1QNCA 2D0BA 3HS9A 1W80A 1VTLE 4RODB 1QTPA 1VOKA 3OCIA 1PCZA 1QTSA 1C9BB 1QN6A 5IYDP 3ASMA 2D0AA 1QN8A 1R4XA 1QN3A
chains in the Genus database with same CATH superfamily
1KY6A 1JDYA 5IYBP 1CDWA 2JHJA 2QREA 2DKCA 3N89A 3TDHA 3H1ZA 1E42A 5AN4A 4EAKA 3IH7A 1N3CA 2NOFA 1TUOA 2HZMA 1B9KA 3DPUA 3EIKA 3OC3C 1DIZA 2ZFDB 3CWTA 1D3UA 1YTFA 1YTBA 1KFIA 1QN4A 2HL8A 1KY7A 2QRCA 3CWSA 2NOHA 1N3AA 4C7PA 1W80A 1VTLE 4WXAA 1QTPA 3F10A 1C4GA 3RSMA 1LWYA 3OH6A 5IYDP 1QN6A 2PWWA 2MZ8A 1PCJX 3KRMA 1QN8A 2DKDA 2H4LX 3UW2A 1QN3A 1NGMA 3ENOC 2IV8A 2QLVA 4BJUA 3PMGA 2NOZA 3CWUA 1QN7A 2D0CA 3KTUA 3ENCA 3OLPA 2Z0FA 1VTOA 1P5DX 2FKFA 2G30A 2VJ0A 4IL8A 3D7QA 5JMVD 4EAJA 1RM1A 3I0XA 1QN9A 1YQRA 1NH2A 2MJ7A 1VOLB 4WX8A 5EPCA 2OOYA 4D7QA 1EUVA 3OGDA 1QNEA 1QNAA 1XSZA 5BMPA 3ULXA 1N39A 4RODB 2FKMX 1KO9A 2JHNA 2YH5A 2HKPA 2YA3A 3I3WA 2R5XA 3TE5A 1KYUA 1TBAB 1JFIC 2NOBA 1HU0A 2HZSA 2Y8QA 3CVSA 1C47A 1TGHA 3HS8A 3CW7A 2EHBD 4QG5A 1YQMA 1LWWA 3VN5A 4PY5A 1UT4A 2LAEA 1PCMX 1MPGA 4EJYA 4MRQA 3T4NA 3OSEA 2QR1A 1LWVA 3OSMA 3RPJA 5KL0A 1VKLA 2JOIA 2NOLA 2JPIA 2V8QA 1KYFA 1M3QA 1NVPA 1EBMA 4EALA 4WZSD 3D4VA 1PZDA 4TPSA 2NWVA 2D0BA 5BMNA 3HS9A 4HJHA 1M3HA 4EAGA 5F9CA 1VOKA 1LXTA 1Q9UA 4EAIA 1QTSA 4DULA 1C9BB 1J3MA 2D0AA 4CFFA 5HSHA 1R4XA 1YQLA 2NOIA 2H5AX 3NA5A 2F7LA 4Q11A 3CVTA 1M5Q1 1YQKA 2NVMA 1WJWA 1V5SA 4B0AA 4EJZA 1QNBA 5IYCP 2FUVA 2NLVA 4ROCB 1TBPA 5JN5A 3PDKA 1MP9A 2HL9A 1FN7A 2IV9A 2OOXA 1KYDA 4ROEB 1KFQA 3SNSA 1QN5A 2DKAA 2Z8UA 1P5GX 3DPTA 1UT7A 2QRDA 1AISA 4I8OA 2O3OA 3BKQX 1K2YX 3F0ZA 4D7RA 3CWAA 1QNCA 2Y8LA 2XHIA 2V9JA 3EAYA 3OCIA 3OH9A 1T6AA 1PVSA 1WQAA 1PCZA 2FGTA 2V92A 3ASMA 3OSTA 3C04A 3I0WA 2I5WA 2NOEA 1UL7A 1K35A
chains in the Genus database with same CATH topology
1KY6A 5IYBP 1CDWA 3N89A 3H1ZA 1E42A 5AN4A 3IH7A 1N3CA 2NOFA 2HZMA 1B9KA 3DPUA 3EIKA 3OC3C 1D3UA 1YTFA 1YTBA 1QN4A 1KY7A 2NOHA 1N3AA 1W80A 1VTLE 1QTPA 3F10A 1LWYA 5IYDP 1QN6A 2MZ8A 3KRMA 1QN8A 1QN3A 1NGMA 2IV8A 2NOZA 1QN7A 2D0CA 3KTUA 1VTOA 2G30A 2VJ0A 1RM1A 3I0XA 1QN9A 1YQRA 1NH2A 2MJ7A 1VOLB 1QNEA 1QNAA 3ULXA 1N39A 4RODB 1KO9A 2YH5A 1KYUA 1TBAB 1JFIC 2NOBA 1HU0A 2HZSA 1TGHA 3HS8A 1YQMA 1LWWA 4PY5A 3VN5A 1UT4A 2LAEA 4EJYA 1LWVA 3OSMA 3RPJA 2JOIA 2NOLA 1NVPA 1KYFA 1M3QA 1EBMA 4WZSD 1PZDA 4TPSA 1M3HA 2D0BA 3HS9A 1VOKA 1QTSA 4DULA 1C9BB 2D0AA 1R4XA 1YQLA 2NOIA 4Q11A 1YQKA 4EJZA 4B0AA 1QNBA 5IYCP 4ROCB 1TBPA 1FN7A 1MP9A 2IV9A 1KYDA 4ROEB 3SNSA 1QN5A 2Z8UA 3DPTA 1UT7A 1AISA 4I8OA 2O3OA 3F0ZA 1QNCA 2XHIA 3OCIA 1PCZA 2FGTA 3ASMA 3OSTA 3I0WA 2I5WA 2NOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KY6 A;  1KYU A;  1TBA B;  1NGM A;  5IYB P;  1JFI C;  4B0A A;  2IV8 A;  1QNB A;  5IYC P;  3HS8 A;  1CDW A;  1TGH A;  4ROC B;  1TBP A;  4PY5 A;  1MP9 A;  3VN5 A;  2IV9 A;  3H1Z A;  1E42 A;  1KYD A;  1QN7 A;  2D0C A;  4ROE B;  1QN5 A;  1VTO A;  2Z8U A;  2G30 A;  2VJ0 A;  1B9K A;  3OC3 C;  3EIK A;  1RM1 A;  1D3U A;  1QN9 A;  1VOL B;  1NH2 A;  2MJ7 A;  1YTF A;  1YTB A;  1NVP A;  1AIS A;  1KYF A;  1QNE A;  1QN4 A;  1KY7 A;  4WZS D;  1QNA A;  1PZD A;  1QNC A;  2D0B A;  3HS9 A;  1W80 A;  1VTL E;  4ROD B;  1QTP A;  1VOK A;  3OCI A;  1PCZ A;  1QTS A;  1C9B B;  1QN6 A;  5IYD P;  3ASM A;  2D0A A;  1QN8 A;  1R4X A;  1QN3 A; 
#chains in the Genus database with same CATH topology
 1KY6 A;  1JDY A;  5IYB P;  1CDW A;  2JHJ A;  2QRE A;  2DKC A;  3N89 A;  3TDH A;  3H1Z A;  1E42 A;  5AN4 A;  4EAK A;  3IH7 A;  1N3C A;  2NOF A;  1TUO A;  2HZM A;  1B9K A;  3DPU A;  3EIK A;  3OC3 C;  1DIZ A;  2ZFD B;  3CWT A;  1D3U A;  1YTF A;  1YTB A;  1KFI A;  1QN4 A;  2HL8 A;  1KY7 A;  2QRC A;  3CWS A;  2NOH A;  1N3A A;  4C7P A;  1W80 A;  1VTL E;  4WXA A;  1QTP A;  3F10 A;  1C4G A;  3RSM A;  1LWY A;  3OH6 A;  5IYD P;  1QN6 A;  2PWW A;  2MZ8 A;  1PCJ X;  3KRM A;  1QN8 A;  2DKD A;  2H4L X;  3UW2 A;  1QN3 A;  1NGM A;  3ENO C;  2IV8 A;  2QLV A;  4BJU A;  3PMG A;  2NOZ A;  3CWU A;  1QN7 A;  2D0C A;  3KTU A;  3ENC A;  3OLP A;  2Z0F A;  1VTO A;  1P5D X;  2FKF A;  2G30 A;  2VJ0 A;  4IL8 A;  3D7Q A;  5JMV D;  4EAJ A;  1RM1 A;  3I0X A;  1QN9 A;  1YQR A;  1NH2 A;  2MJ7 A;  1VOL B;  4WX8 A;  5EPC A;  2OOY A;  4D7Q A;  1EUV A;  3OGD A;  1QNE A;  1QNA A;  1XSZ A;  5BMP A;  3ULX A;  1N39 A;  4ROD B;  2FKM X;  1KO9 A;  2JHN A;  2YH5 A;  2HKP A;  2YA3 A;  3I3W A;  2R5X A;  3TE5 A;  1KYU A;  1TBA B;  1JFI C;  2NOB A;  1HU0 A;  2HZS A;  2Y8Q A;  3CVS A;  1C47 A;  1TGH A;  3HS8 A;  3CW7 A;  2EHB D;  4QG5 A;  1YQM A;  1LWW A;  3VN5 A;  4PY5 A;  1UT4 A;  2LAE A;  1PCM X;  1MPG A;  4EJY A;  4MRQ A;  3T4N A;  3OSE A;  2QR1 A;  1LWV A;  3OSM A;  3RPJ A;  5KL0 A;  1VKL A;  2JOI A;  2NOL A;  2JPI A;  2V8Q A;  1KYF A;  1M3Q A;  1NVP A;  1EBM A;  4EAL A;  4WZS D;  3D4V A;  1PZD A;  4TPS A;  2NWV A;  2D0B A;  5BMN A;  3HS9 A;  4HJH A;  1M3H A;  4EAG A;  5F9C A;  1VOK A;  1LXT A;  1Q9U A;  4EAI A;  1QTS A;  4DUL A;  1C9B B;  1J3M A;  2D0A A;  4CFF A;  5HSH A;  1R4X A;  1YQL A;  2NOI A;  2H5A X;  3NA5 A;  2F7L A;  4Q11 A;  3CVT A;  1M5Q 1;  1YQK A;  2NVM A;  1WJW A;  1V5S A;  4B0A A;  4EJZ A;  1QNB A;  5IYC P;  2FUV A;  2NLV A;  4ROC B;  1TBP A;  5JN5 A;  3PDK A;  1MP9 A;  2HL9 A;  1FN7 A;  2IV9 A;  2OOX A;  1KYD A;  4ROE B;  1KFQ A;  3SNS A;  1QN5 A;  2DKA A;  2Z8U A;  1P5G X;  3DPT A;  1UT7 A;  2QRD A;  1AIS A;  4I8O A;  2O3O A;  3BKQ X;  1K2Y X;  3F0Z A;  4D7R A;  3CWA A;  1QNC A;  2Y8L A;  2XHI A;  2V9J A;  3EAY A;  3OCI A;  3OH9 A;  1T6A A;  1PVS A;  1WQA A;  1PCZ A;  2FGT A;  2V92 A;  3ASM A;  3OST A;  3C04 A;  3I0W A;  2I5W A;  2NOE A;  1UL7 A;  1K35 A; 
#chains in the Genus database with same CATH homology
 1KY6 A;  5IYB P;  1CDW A;  3N89 A;  3H1Z A;  1E42 A;  5AN4 A;  3IH7 A;  1N3C A;  2NOF A;  2HZM A;  1B9K A;  3DPU A;  3EIK A;  3OC3 C;  1D3U A;  1YTF A;  1YTB A;  1QN4 A;  1KY7 A;  2NOH A;  1N3A A;  1W80 A;  1VTL E;  1QTP A;  3F10 A;  1LWY A;  5IYD P;  1QN6 A;  2MZ8 A;  3KRM A;  1QN8 A;  1QN3 A;  1NGM A;  2IV8 A;  2NOZ A;  1QN7 A;  2D0C A;  3KTU A;  1VTO A;  2G30 A;  2VJ0 A;  1RM1 A;  3I0X A;  1QN9 A;  1YQR A;  1NH2 A;  2MJ7 A;  1VOL B;  1QNE A;  1QNA A;  3ULX A;  1N39 A;  4ROD B;  1KO9 A;  2YH5 A;  1KYU A;  1TBA B;  1JFI C;  2NOB A;  1HU0 A;  2HZS A;  1TGH A;  3HS8 A;  1YQM A;  1LWW A;  4PY5 A;  3VN5 A;  1UT4 A;  2LAE A;  4EJY A;  1LWV A;  3OSM A;  3RPJ A;  2JOI A;  2NOL A;  1NVP A;  1KYF A;  1M3Q A;  1EBM A;  4WZS D;  1PZD A;  4TPS A;  1M3H A;  2D0B A;  3HS9 A;  1VOK A;  1QTS A;  4DUL A;  1C9B B;  2D0A A;  1R4X A;  1YQL A;  2NOI A;  4Q11 A;  1YQK A;  4EJZ A;  4B0A A;  1QNB A;  5IYC P;  4ROC B;  1TBP A;  1FN7 A;  1MP9 A;  2IV9 A;  1KYD A;  4ROE B;  3SNS A;  1QN5 A;  2Z8U A;  3DPT A;  1UT7 A;  1AIS A;  4I8O A;  2O3O A;  3F0Z A;  1QNC A;  2XHI A;  3OCI A;  1PCZ A;  2FGT A;  3ASM A;  3OST A;  3I0W A;  2I5W A;  2NOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...