1VOKA

Arabidopsis thaliana tbp (dimer)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
192
structure length
192
Chain Sequence
EGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription factor
molecule keywords TATA-BOX-BINDING PROTEIN
publication title 2.1 A resolution refined structure of a TATA box-binding protein (TBP).
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 49
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vokA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vokA02
3HS9A 1QTSA 1QN7A 2IV8A 1YTBA 1VOLB 1RM1A 1YTFA 1C9BB 1NVPA 1R4XA 1TGHA 1QN8A 3OCIA 3H1ZA 3EIKA 1B9KA 3OC3C 1PCZA 3HS8A 3VN5A 5IYBP 1QN3A 1CDWA 1TBAB 4RODB 1KYUA 1NGMA 1AISA 1TBPA 1QTPA 4B0AA 1JFIC 2G30A 2MJ7A 2VJ0A 2D0CA 1D3UA 2D0BA 1VTLE 1MP9A 5IYCP 4WZSD 1QNAA 1QNEA 1QN4A 2D0AA 2IV9A 1QN9A 4ROCB 1VOKA 1NH2A 2Z8UA 4ROEB 1E42A 1KY6A 1KYFA 1QNCA 1QN6A 4PY5A 1W80A 1PZDA 3ASMA 1VTOA 1QNBA 5IYDP 1KY7A 1QN5A 1KYDA
chains in the Genus database with same CATH superfamily
3I0WA 2OOYA 1YTBA 4EAIA 1JDYA 2HZSA 4EAGA 3EAYA 1N39A 2FUVA 3N89A 4I8OA 4D7QA 1QN8A 3ENOC 1KO9A 2YA3A 5EPCA 2DKCA 3VN5A 3I0XA 4EAKA 2MZ8A 2NLVA 2PWWA 1QTPA 1TBPA 3ULXA 2MJ7A 3TDHA 4EAJA 3OSTA 1VTLE 2NOZA 2JHNA 1QNAA 2FKMX 1M5Q1 1PCMX 1WJWA 2R5XA 1QN9A 1VOKA 3PMGA 2NOHA 2Z8UA 1KY6A 3OH9A 2Y8QA 2HKPA 1XSZA 1KYDA 1PVSA 2NOFA 1VOLB 2IV8A 1J3MA 1N3CA 1RM1A 1YTFA 1C9BB 1C4GA 1NVPA 3CWAA 1R4XA 3UW2A 3CW7A 2FGTA 3DPUA 3CWUA 1KFQA 3EIKA 1QN3A 2H5AX 4D7RA 1YQRA 1CDWA 2QLVA 1YQMA 5JMVD 4QG5A 1N3AA 2YH5A 2G30A 1JFIC 2V9JA 1LWYA 1P5DX 2XHIA 1YQLA 1QNEA 2QR1A 1K2YX 2IV9A 1HU0A 3CVTA 1UL7A 3RPJA 2I5WA 1EUVA 4HJHA 1TUOA 2V8QA 1NH2A 4ROEB 1KFIA 2H4LX 2QREA 3RSMA 1QNCA 3SNSA 2NOEA 1QN6A 2V92A 3T4NA 3CWSA 1QN5A 2ZFDB 1TGHA 1V5SA 2JHJA 1UT7A 3D7QA 2DKDA 1QTSA 1QN7A 2EHBD 1Q9UA 3CWTA 3PDKA 3OSMA 4DULA 2NVMA 5JN5A 3OCIA 4WX8A 3OC3C 2QRDA 2DKAA 3BKQX 1TBAB 1NGMA 5AN4A 5BMPA 3D4VA 4B0AA 5F9CA 1K35A 2OOXA 2VJ0A 2D0CA 3KRMA 3CVSA 2D0BA 4WZSD 2NOLA 2NOIA 2D0AA 2F7LA 2FKFA 1VKLA 2HL8A 2HZMA 2JOIA 4MRQA 4BJUA 1KYFA 3I3WA 1DIZA 3KTUA 3F10A 2Z0FA 1W80A 1PZDA 1LWWA 1WQAA 1UT4A 1YQKA 1PCJX 1MPGA 3F0ZA 3HS9A 3OH6A 1M3QA 4EJZA 2JPIA 1LWVA 3OLPA 4CFFA 3ENCA 4EJYA 3NA5A 4Q11A 5KL0A 3H1ZA 3OSEA 1B9KA 4WXAA 1PCZA 3HS8A 4IL8A 5IYBP 3IH7A 2NWVA 1T6AA 4RODB 1KYUA 2HL9A 2Y8LA 4TPSA 4EALA 1AISA 1C47A 2NOBA 3OGDA 1D3UA 5HSHA 1MP9A 5IYCP 2O3OA 3DPTA 4C7PA 5BMNA 3TE5A 1FN7A 1QN4A 3C04A 4ROCB 2QRCA 1E42A 1P5GX 1LXTA 4PY5A 1EBMA 3ASMA 5IYDP 1VTOA 1QNBA 1KY7A 1M3HA 2LAEA
chains in the Genus database with same CATH topology
3I0WA 1YTBA 2HZSA 1N39A 1QN8A 3N89A 4I8OA 1KO9A 3VN5A 3I0XA 2MZ8A 1TBPA 1QTPA 3ULXA 2MJ7A 3OSTA 1VTLE 2NOZA 1QNAA 1QN9A 1VOKA 2NOHA 2Z8UA 1KY6A 1KYDA 2NOFA 1VOLB 2IV8A 1N3CA 1RM1A 1YTFA 1C9BB 1NVPA 1R4XA 2FGTA 3DPUA 3EIKA 1QN3A 1YQRA 1CDWA 1YQMA 1N3AA 2YH5A 2G30A 1JFIC 1LWYA 2XHIA 1YQLA 1QNEA 1HU0A 2IV9A 2I5WA 3RPJA 1NH2A 4ROEB 1QNCA 2NOEA 3SNSA 1QN6A 1QN5A 1TGHA 1UT7A 1QTSA 1QN7A 3OSMA 4DULA 3OCIA 3OC3C 1TBAB 1NGMA 5AN4A 4B0AA 2VJ0A 2D0CA 3KRMA 2D0BA 4WZSD 2NOLA 2NOIA 2D0AA 2HZMA 2JOIA 1KYFA 3KTUA 3F10A 1W80A 1PZDA 1LWWA 1UT4A 1YQKA 4EJZA 3HS9A 3F0ZA 1M3QA 1LWVA 4EJYA 4Q11A 3H1ZA 1B9KA 5IYBP 1PCZA 3HS8A 3IH7A 4RODB 1KYUA 4TPSA 1AISA 2NOBA 1D3UA 1MP9A 5IYCP 2O3OA 3DPTA 1QN4A 1FN7A 4ROCB 1E42A 4PY5A 1EBMA 3ASMA 5IYDP 1VTOA 1QNBA 1KY7A 1M3HA 2LAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HS9 A;  1QTS A;  1QN7 A;  2IV8 A;  1YTB A;  1VOL B;  1RM1 A;  1YTF A;  1C9B B;  1NVP A;  1R4X A;  1TGH A;  1QN8 A;  3OCI A;  3H1Z A;  3EIK A;  1B9K A;  3OC3 C;  1PCZ A;  3HS8 A;  3VN5 A;  5IYB P;  1QN3 A;  1CDW A;  1TBA B;  4ROD B;  1KYU A;  1NGM A;  1AIS A;  1TBP A;  1QTP A;  4B0A A;  1JFI C;  2G30 A;  2MJ7 A;  2VJ0 A;  2D0C A;  1D3U A;  2D0B A;  1VTL E;  1MP9 A;  5IYC P;  4WZS D;  1QNA A;  1QNE A;  1QN4 A;  2D0A A;  2IV9 A;  1QN9 A;  4ROC B;  1VOK A;  1NH2 A;  2Z8U A;  4ROE B;  1E42 A;  1KY6 A;  1KYF A;  1QNC A;  1QN6 A;  4PY5 A;  1W80 A;  1PZD A;  3ASM A;  1VTO A;  1QNB A;  5IYD P;  1KY7 A;  1QN5 A;  1KYD A; 
#chains in the Genus database with same CATH topology
 3I0W A;  2OOY A;  1YTB A;  4EAI A;  1JDY A;  2HZS A;  4EAG A;  3EAY A;  1N39 A;  2FUV A;  3N89 A;  4I8O A;  4D7Q A;  1QN8 A;  3ENO C;  1KO9 A;  2YA3 A;  5EPC A;  2DKC A;  3VN5 A;  3I0X A;  4EAK A;  2MZ8 A;  2NLV A;  2PWW A;  1QTP A;  1TBP A;  3ULX A;  2MJ7 A;  3TDH A;  4EAJ A;  3OST A;  1VTL E;  2NOZ A;  2JHN A;  1QNA A;  2FKM X;  1M5Q 1;  1PCM X;  1WJW A;  2R5X A;  1QN9 A;  1VOK A;  3PMG A;  2NOH A;  2Z8U A;  1KY6 A;  3OH9 A;  2Y8Q A;  2HKP A;  1XSZ A;  1KYD A;  1PVS A;  2NOF A;  1VOL B;  2IV8 A;  1J3M A;  1N3C A;  1RM1 A;  1YTF A;  1C9B B;  1C4G A;  1NVP A;  3CWA A;  1R4X A;  3UW2 A;  3CW7 A;  2FGT A;  3DPU A;  3CWU A;  1KFQ A;  3EIK A;  1QN3 A;  2H5A X;  4D7R A;  1YQR A;  1CDW A;  2QLV A;  1YQM A;  5JMV D;  4QG5 A;  1N3A A;  2YH5 A;  2G30 A;  1JFI C;  2V9J A;  1LWY A;  1P5D X;  2XHI A;  1YQL A;  1QNE A;  2QR1 A;  1K2Y X;  2IV9 A;  1HU0 A;  3CVT A;  1UL7 A;  3RPJ A;  2I5W A;  1EUV A;  4HJH A;  1TUO A;  2V8Q A;  1NH2 A;  4ROE B;  1KFI A;  2H4L X;  2QRE A;  3RSM A;  1QNC A;  3SNS A;  2NOE A;  1QN6 A;  2V92 A;  3T4N A;  3CWS A;  1QN5 A;  2ZFD B;  1TGH A;  1V5S A;  2JHJ A;  1UT7 A;  3D7Q A;  2DKD A;  1QTS A;  1QN7 A;  2EHB D;  1Q9U A;  3CWT A;  3PDK A;  3OSM A;  4DUL A;  2NVM A;  5JN5 A;  3OCI A;  4WX8 A;  3OC3 C;  2QRD A;  2DKA A;  3BKQ X;  1TBA B;  1NGM A;  5AN4 A;  5BMP A;  3D4V A;  4B0A A;  5F9C A;  1K35 A;  2OOX A;  2VJ0 A;  2D0C A;  3KRM A;  3CVS A;  2D0B A;  4WZS D;  2NOL A;  2NOI A;  2D0A A;  2F7L A;  2FKF A;  1VKL A;  2HL8 A;  2HZM A;  2JOI A;  4MRQ A;  4BJU A;  1KYF A;  3I3W A;  1DIZ A;  3KTU A;  3F10 A;  2Z0F A;  1W80 A;  1PZD A;  1LWW A;  1WQA A;  1UT4 A;  1YQK A;  1PCJ X;  1MPG A;  3F0Z A;  3HS9 A;  3OH6 A;  1M3Q A;  4EJZ A;  2JPI A;  1LWV A;  3OLP A;  4CFF A;  3ENC A;  4EJY A;  3NA5 A;  4Q11 A;  5KL0 A;  3H1Z A;  3OSE A;  1B9K A;  4WXA A;  1PCZ A;  3HS8 A;  4IL8 A;  5IYB P;  3IH7 A;  2NWV A;  1T6A A;  4ROD B;  1KYU A;  2HL9 A;  2Y8L A;  4TPS A;  4EAL A;  1AIS A;  1C47 A;  2NOB A;  3OGD A;  1D3U A;  5HSH A;  1MP9 A;  5IYC P;  2O3O A;  3DPT A;  4C7P A;  5BMN A;  3TE5 A;  1FN7 A;  1QN4 A;  3C04 A;  4ROC B;  2QRC A;  1E42 A;  1P5G X;  1LXT A;  4PY5 A;  1EBM A;  3ASM A;  5IYD P;  1VTO A;  1QNB A;  1KY7 A;  1M3H A;  2LAE A; 
#chains in the Genus database with same CATH homology
 3I0W A;  1YTB A;  2HZS A;  1N39 A;  1QN8 A;  3N89 A;  4I8O A;  1KO9 A;  3VN5 A;  3I0X A;  2MZ8 A;  1TBP A;  1QTP A;  3ULX A;  2MJ7 A;  3OST A;  1VTL E;  2NOZ A;  1QNA A;  1QN9 A;  1VOK A;  2NOH A;  2Z8U A;  1KY6 A;  1KYD A;  2NOF A;  1VOL B;  2IV8 A;  1N3C A;  1RM1 A;  1YTF A;  1C9B B;  1NVP A;  1R4X A;  2FGT A;  3DPU A;  3EIK A;  1QN3 A;  1YQR A;  1CDW A;  1YQM A;  1N3A A;  2YH5 A;  2G30 A;  1JFI C;  1LWY A;  2XHI A;  1YQL A;  1QNE A;  1HU0 A;  2IV9 A;  2I5W A;  3RPJ A;  1NH2 A;  4ROE B;  1QNC A;  2NOE A;  3SNS A;  1QN6 A;  1QN5 A;  1TGH A;  1UT7 A;  1QTS A;  1QN7 A;  3OSM A;  4DUL A;  3OCI A;  3OC3 C;  1TBA B;  1NGM A;  5AN4 A;  4B0A A;  2VJ0 A;  2D0C A;  3KRM A;  2D0B A;  4WZS D;  2NOL A;  2NOI A;  2D0A A;  2HZM A;  2JOI A;  1KYF A;  3KTU A;  3F10 A;  1W80 A;  1PZD A;  1LWW A;  1UT4 A;  1YQK A;  4EJZ A;  3HS9 A;  3F0Z A;  1M3Q A;  1LWV A;  4EJY A;  4Q11 A;  3H1Z A;  1B9K A;  5IYB P;  1PCZ A;  3HS8 A;  3IH7 A;  4ROD B;  1KYU A;  4TPS A;  1AIS A;  2NOB A;  1D3U A;  1MP9 A;  5IYC P;  2O3O A;  3DPT A;  1QN4 A;  1FN7 A;  4ROC B;  1E42 A;  4PY5 A;  1EBM A;  3ASM A;  5IYD P;  1VTO A;  1QNB A;  1KY7 A;  1M3H A;  2LAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...