1VOKA

Arabidopsis thaliana tbp (dimer)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
192
structure length
192
Chain Sequence
EGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TATA-BOX-BINDING PROTEIN
publication title 2.1 A resolution refined structure of a TATA box-binding protein (TBP).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription factor
total genus 49
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vokA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vokA02
2G30A 1QN9A 1QNCA 1PZDA 1KY6A 4PY5A 1QN7A 4ROCB 3OCIA 5IYCP 4WZSD 4RODB 1TBAB 1QN4A 1VOKA 1B9KA 3ASMA 2IV9A 1NVPA 1YTBA 1KYDA 1QN8A 1QTPA 1YTFA 1TBPA 1NH2A 4ROEB 1VOLB 2Z8UA 1KY7A 1QNAA 5IYDP 1QTSA 1VTOA 3VN5A 1QNEA 3EIKA 1R4XA 2IV8A 1KYFA 3HS9A 2D0BA 1QNBA 2VJ0A 1QN3A 1QN6A 1KYUA 1PCZA 2D0AA 3H1ZA 1JFIC 1RM1A 1QN5A 2D0CA 1W80A 3OC3C 1NGMA 3HS8A 4B0AA 1AISA 1CDWA 1MP9A 1TGHA 1C9BB 2MJ7A 1D3UA 1E42A 5IYBP 1VTLE
chains in the Genus database with same CATH superfamily
1PZDA 2QRCA 1YQRA 4D7RA 1M3HA 2DKCA 4CFFA 4WZSD 1YQKA 4RODB 1TBAB 1QN4A 1KO9A 1VOKA 1K2YX 2QR1A 4WXAA 1N3AA 3CW7A 3KRMA 1KFQA 3NA5A 3OSMA 1QN8A 2QLVA 4EAIA 3EAYA 1YTFA 4EJZA 2XHIA 4ROEB 2Y8LA 2OOYA 1KY7A 1UT4A 2Z8UA 2Y8QA 2QRDA 1N39A 1YQLA 2HKPA 1EUVA 1JDYA 2LAEA 1WQAA 2IV8A 4MRQA 3CWTA 1LWWA 3OLPA 1KYUA 2D0AA 2O3OA 2YH5A 4EALA 2PWWA 1RM1A 2NOBA 1W80A 2NVMA 3CWUA 2JHJA 2OOXA 1LXTA 1MP9A 3ENCA 1PCJX 2FGTA 1C9BB 2FUVA 1NH2A 3F0ZA 1N3CA 1VTLE 1QN9A 1XSZA 3C04A 4PY5A 1PCMX 2F7LA 2FKMX 1QN7A 1C47A 4ROCB 3OCIA 5IYCP 5EPCA 2NOZA 1TUOA 1FN7A 1B9KA 3ASMA 2IV9A 5F9CA 1KYDA 2NOFA 2NLVA 4DULA 2ZFDB 2H4LX 1LWVA 1KFIA 1QNAA 1VTOA 1V5SA 2MZ8A 1Q9UA 5HSHA 1QNEA 3I0WA 3EIKA 1R4XA 1M3QA 1EBMA 3TE5A 1P5GX 2Z0FA 1PCZA 3H1ZA 3RPJA 3OGDA 4QG5A 1YQMA 3CVTA 3HS8A 4EAJA 5JN5A 1CDWA 1D3UA 4IL8A 3TDHA 2NOIA 3UW2A 5IYBP 2G30A 3D7QA 1QNCA 1MPGA 3KTUA 3PMGA 3RSMA 5AN4A 3T4NA 4HJHA 3OSEA 1UL7A 2EHBD 5BMPA 3CWAA 3F10A 5JMVD 1QTPA 2JPIA 2H5AX 2JOIA 5IYDP 4C7PA 2HZMA 2V92A 3DPUA 3PDKA 4BJUA 1M5Q1 3DPTA 2JHNA 1KYFA 3OSTA 3IH7A 1QN6A 3ENOC 4I8OA 2YA3A 1LWYA 2NOHA 1T6AA 2FKFA 1UT7A 5KL0A 3BKQX 1TGHA 2I5WA 1E42A 2DKAA 1J3MA 2V9JA 1QNBA 1KY6A 4EAGA 2V8QA 2HL8A 5BMNA 1VKLA 2NOEA 4D7QA 3SNSA 3CVSA 1DIZA 2R5XA 3N89A 1NVPA 3OH9A 1HU0A 1YTBA 2NOLA 3D4VA 2DKDA 1TBPA 3CWSA 2HL9A 2NWVA 1VOLB 2QREA 1WJWA 1QTSA 3I0XA 1K35A 3ULXA 3VN5A 2HZSA 3HS9A 1QN3A 1PVSA 2D0BA 2VJ0A 3OH6A 3I3WA 1JFIC 4EJYA 1QN5A 2D0CA 3OC3C 4Q11A 4WX8A 4B0AA 1NGMA 1AISA 2MJ7A 1P5DX 4EAKA 1C4GA 4TPSA
chains in the Genus database with same CATH topology
1PZDA 1YQRA 1M3HA 4WZSD 1YQKA 4RODB 1TBAB 1QN4A 1KO9A 1VOKA 1N3AA 3KRMA 3OSMA 1QN8A 1YTFA 4EJZA 2XHIA 4ROEB 2Z8UA 1UT4A 1KY7A 1N39A 1YQLA 2LAEA 2IV8A 1LWWA 1KYUA 2D0AA 2O3OA 2YH5A 2NOBA 1RM1A 1W80A 1MP9A 2FGTA 1C9BB 1NH2A 3F0ZA 1N3CA 1VTLE 1QN9A 4PY5A 1QN7A 4ROCB 3OCIA 5IYCP 2NOZA 1FN7A 1B9KA 3ASMA 2IV9A 1KYDA 2NOFA 4DULA 1LWVA 1QNAA 1VTOA 2MZ8A 1QNEA 3I0WA 3EIKA 1R4XA 1M3QA 1EBMA 1PCZA 3H1ZA 3RPJA 1YQMA 3HS8A 1CDWA 1D3UA 2NOIA 5IYBP 2G30A 1QNCA 3KTUA 5AN4A 3F10A 1QTPA 2JOIA 5IYDP 2HZMA 3DPUA 3DPTA 1KYFA 3OSTA 3IH7A 1QN6A 4I8OA 1LWYA 2NOHA 1UT7A 1TGHA 2I5WA 1E42A 1QNBA 1KY6A 2NOEA 3SNSA 3N89A 1NVPA 1HU0A 1YTBA 2NOLA 1TBPA 1VOLB 1QTSA 3I0XA 3ULXA 3VN5A 2HZSA 3HS9A 1QN3A 2D0BA 2VJ0A 1JFIC 4EJYA 1QN5A 2D0CA 3OC3C 4Q11A 1NGMA 4B0AA 1AISA 2MJ7A 4TPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G30 A;  1QN9 A;  1QNC A;  1PZD A;  1KY6 A;  4PY5 A;  1QN7 A;  4ROC B;  3OCI A;  5IYC P;  4WZS D;  4ROD B;  1TBA B;  1QN4 A;  1VOK A;  1B9K A;  3ASM A;  2IV9 A;  1NVP A;  1YTB A;  1KYD A;  1QN8 A;  1QTP A;  1YTF A;  1TBP A;  1NH2 A;  4ROE B;  1VOL B;  2Z8U A;  1KY7 A;  1QNA A;  5IYD P;  1QTS A;  1VTO A;  3VN5 A;  1QNE A;  3EIK A;  1R4X A;  2IV8 A;  1KYF A;  3HS9 A;  2D0B A;  1QNB A;  2VJ0 A;  1QN3 A;  1QN6 A;  1KYU A;  1PCZ A;  2D0A A;  3H1Z A;  1JFI C;  1RM1 A;  1QN5 A;  2D0C A;  1W80 A;  3OC3 C;  1NGM A;  3HS8 A;  4B0A A;  1AIS A;  1CDW A;  1MP9 A;  1TGH A;  1C9B B;  2MJ7 A;  1D3U A;  1E42 A;  5IYB P;  1VTL E; 
#chains in the Genus database with same CATH topology
 1PZD A;  2QRC A;  1YQR A;  4D7R A;  1M3H A;  2DKC A;  4CFF A;  4WZS D;  1YQK A;  4ROD B;  1TBA B;  1QN4 A;  1KO9 A;  1VOK A;  1K2Y X;  2QR1 A;  4WXA A;  1N3A A;  3CW7 A;  3KRM A;  1KFQ A;  3NA5 A;  3OSM A;  1QN8 A;  2QLV A;  4EAI A;  3EAY A;  1YTF A;  4EJZ A;  2XHI A;  4ROE B;  2Y8L A;  2OOY A;  1KY7 A;  1UT4 A;  2Z8U A;  2Y8Q A;  2QRD A;  1N39 A;  1YQL A;  2HKP A;  1EUV A;  1JDY A;  2LAE A;  1WQA A;  2IV8 A;  4MRQ A;  3CWT A;  1LWW A;  3OLP A;  1KYU A;  2D0A A;  2O3O A;  2YH5 A;  4EAL A;  2PWW A;  1RM1 A;  2NOB A;  1W80 A;  2NVM A;  3CWU A;  2JHJ A;  2OOX A;  1LXT A;  1MP9 A;  3ENC A;  1PCJ X;  2FGT A;  1C9B B;  2FUV A;  1NH2 A;  3F0Z A;  1N3C A;  1VTL E;  1QN9 A;  1XSZ A;  3C04 A;  4PY5 A;  1PCM X;  2F7L A;  2FKM X;  1QN7 A;  1C47 A;  4ROC B;  3OCI A;  5IYC P;  5EPC A;  2NOZ A;  1TUO A;  1FN7 A;  1B9K A;  3ASM A;  2IV9 A;  5F9C A;  1KYD A;  2NOF A;  2NLV A;  4DUL A;  2ZFD B;  2H4L X;  1LWV A;  1KFI A;  1QNA A;  1VTO A;  1V5S A;  2MZ8 A;  1Q9U A;  5HSH A;  1QNE A;  3I0W A;  3EIK A;  1R4X A;  1M3Q A;  1EBM A;  3TE5 A;  1P5G X;  2Z0F A;  1PCZ A;  3H1Z A;  3RPJ A;  3OGD A;  4QG5 A;  1YQM A;  3CVT A;  3HS8 A;  4EAJ A;  5JN5 A;  1CDW A;  1D3U A;  4IL8 A;  3TDH A;  2NOI A;  3UW2 A;  5IYB P;  2G30 A;  3D7Q A;  1QNC A;  1MPG A;  3KTU A;  3PMG A;  3RSM A;  5AN4 A;  3T4N A;  4HJH A;  3OSE A;  1UL7 A;  2EHB D;  5BMP A;  3CWA A;  3F10 A;  5JMV D;  1QTP A;  2JPI A;  2H5A X;  2JOI A;  5IYD P;  4C7P A;  2HZM A;  2V92 A;  3DPU A;  3PDK A;  4BJU A;  1M5Q 1;  3DPT A;  2JHN A;  1KYF A;  3OST A;  3IH7 A;  1QN6 A;  3ENO C;  4I8O A;  2YA3 A;  1LWY A;  2NOH A;  1T6A A;  2FKF A;  1UT7 A;  5KL0 A;  3BKQ X;  1TGH A;  2I5W A;  1E42 A;  2DKA A;  1J3M A;  2V9J A;  1QNB A;  1KY6 A;  4EAG A;  2V8Q A;  2HL8 A;  5BMN A;  1VKL A;  2NOE A;  4D7Q A;  3SNS A;  3CVS A;  1DIZ A;  2R5X A;  3N89 A;  1NVP A;  3OH9 A;  1HU0 A;  1YTB A;  2NOL A;  3D4V A;  2DKD A;  1TBP A;  3CWS A;  2HL9 A;  2NWV A;  1VOL B;  2QRE A;  1WJW A;  1QTS A;  3I0X A;  1K35 A;  3ULX A;  3VN5 A;  2HZS A;  3HS9 A;  1QN3 A;  1PVS A;  2D0B A;  2VJ0 A;  3OH6 A;  3I3W A;  1JFI C;  4EJY A;  1QN5 A;  2D0C A;  3OC3 C;  4Q11 A;  4WX8 A;  4B0A A;  1NGM A;  1AIS A;  2MJ7 A;  1P5D X;  4EAK A;  1C4G A;  4TPS A; 
#chains in the Genus database with same CATH homology
 1PZD A;  1YQR A;  1M3H A;  4WZS D;  1YQK A;  4ROD B;  1TBA B;  1QN4 A;  1KO9 A;  1VOK A;  1N3A A;  3KRM A;  3OSM A;  1QN8 A;  1YTF A;  4EJZ A;  2XHI A;  4ROE B;  2Z8U A;  1UT4 A;  1KY7 A;  1N39 A;  1YQL A;  2LAE A;  2IV8 A;  1LWW A;  1KYU A;  2D0A A;  2O3O A;  2YH5 A;  2NOB A;  1RM1 A;  1W80 A;  1MP9 A;  2FGT A;  1C9B B;  1NH2 A;  3F0Z A;  1N3C A;  1VTL E;  1QN9 A;  4PY5 A;  1QN7 A;  4ROC B;  3OCI A;  5IYC P;  2NOZ A;  1FN7 A;  1B9K A;  3ASM A;  2IV9 A;  1KYD A;  2NOF A;  4DUL A;  1LWV A;  1QNA A;  1VTO A;  2MZ8 A;  1QNE A;  3I0W A;  3EIK A;  1R4X A;  1M3Q A;  1EBM A;  1PCZ A;  3H1Z A;  3RPJ A;  1YQM A;  3HS8 A;  1CDW A;  1D3U A;  2NOI A;  5IYB P;  2G30 A;  1QNC A;  3KTU A;  5AN4 A;  3F10 A;  1QTP A;  2JOI A;  5IYD P;  2HZM A;  3DPU A;  3DPT A;  1KYF A;  3OST A;  3IH7 A;  1QN6 A;  4I8O A;  1LWY A;  2NOH A;  1UT7 A;  1TGH A;  2I5W A;  1E42 A;  1QNB A;  1KY6 A;  2NOE A;  3SNS A;  3N89 A;  1NVP A;  1HU0 A;  1YTB A;  2NOL A;  1TBP A;  1VOL B;  1QTS A;  3I0X A;  3ULX A;  3VN5 A;  2HZS A;  3HS9 A;  1QN3 A;  2D0B A;  2VJ0 A;  1JFI C;  4EJY A;  1QN5 A;  2D0C A;  3OC3 C;  4Q11 A;  1NGM A;  4B0A A;  1AIS A;  2MJ7 A;  4TPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...