1E42A

Beta2-adaptin appendage domain, from clathrin adaptor ap2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 COMPLEX SUBUNIT BETA
publication title The Structure and Function of the Beta2-Adaptin Appendage Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 60
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e42A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1e42A02
1VOKA 1D3UA 1TBPA 1E42A 2D0CA 1JFIC 4WZSD 2VJ0A 1CDWA 1KYUA 1TBAB 1VTLE 1AISA 1QTSA 3VN5A 1QTPA 3ASMA 1QNBA 1QN4A 3OC3C 1QN7A 4PY5A 2IV9A 1KY7A 1QN3A 1YTBA 1VOLB 1TGHA 1R4XA 2D0BA 5IYCP 1YTFA 1KYFA 3HS9A 1PZDA 3EIKA 1NGMA 1QN9A 1PCZA 1QN8A 1C9BB 2G30A 3H1ZA 3OCIA 4ROCB 1VTOA 2MJ7A 1QN6A 1MP9A 1NVPA 1KY6A 1B9KA 4RODB 5IYDP 1RM1A 3HS8A 2D0AA 4ROEB 1NH2A 2Z8UA 1QNCA 1QNAA 2IV8A 1QNEA 4B0AA 1KYDA 1W80A 1QN5A 5IYBP
chains in the Genus database with same CATH superfamily
2K7PA 2YA0A 5KVGL 5IQNA 1G0DA 3KWTA 4JKWA 2BSTB 4GAGH 4G6JH 2GSIB 2Y7QB 1LD9A 4LSDA 4NRZA 4QRUB 1J1XH 1HHKB 1TDQA 4LLVB 3WS3B 1AGBA 2XFXB 4J3SA 1X5GA 4UTBA 4PBXA 3LDBB 3DYMA 1MIEH 1N3NA 2YD4A 2HXAA 1ACCA 3ROOA 3FK3A 2QPUA 3EDKA 4G6KH 2WNXA 3PWLA 4HAKA 5KVDH 4FZEH 1D6EB 4LSPL 1JHTB 3NIDF 1SXAA 4N2EA 1EAPA 2QQLH 4XO8A 4XXWC 2PCFA 2BVTA 3IVKA 3REVB 2BP5M 2IPKB 4YDIL 4KKCD 2AJXL 2FWLB 2VDLL 1ADQA 5DZ9A 4Z7AA 2DLIA 4OLWH 4ZOAA 1CLYL 1IL1B 1YAIA 4HUVB 1LP9F 2BVUA 1FUNA 2XG5B 1JF1B 1PCZA 5KSBF 4CA4A 3FHQA 5D1QC 4GUOA 3QUMA 1AE6L 1TU2A 1IGJA 4HUXB 5E8EB 1XGUA 2UXGA 3P54A 2BSEA 3CZFA 4YOKA 4KTGA 3QUYC 3IPFA 3VNYA 3ZYIA 2EDXA 5HGAB 1MQKL 3VWJC 1O7VA 1MJJA 1FCGA 3RG1C 5DJXA 2Q6WA 4CDHA 3EYUL 1PZSA 4HOZA 3QQ9D 3O4OB 2D9QB 3OG4B 4QRSB 5BZDA 1FGVH 2AK4B 2FLBT 1MEXL 3KMDA 3NJMA 1YPZE 3OL2A 1ASQA 1I8KB 4M7KH 4NPKA 4G6MH 4F7PA 4AMXA 12E8H 4D3CH 3TL5A 5M95B 3H7LA 1QW8A 2XCMC 5E95B 2YARA 4A1RA 2W88A 2BVEA 3NCYS 5L88H 1AZRA 4XNXH 3MUY1 3O9WD 3AS0A 1TNMA 3POHA 4TSBL 4HHAB 3TN0A 1Z9SB 3GXDA 3V4VB 1RHHB 1AP2B 1KCLA 4XPGH 5K9JH 1L6ZA 3N0AA 3IJ7A 3HKZA 4KUZH 3RJOA 4ZPVB 1ZEAH 2L8AA 1KWGA 1Y6NR 3LNDA 3WN5A 4Y9FA 5FYJU 5IFHH 3R0NA 1JYWA 1BZ9A 4I18B 2VLRB 1E65A 2WLLB 4QJ4B 1KGYE 4BDVB 2QPEB 1JPSL 4NIYE 2F18A 3JT0A 4XBGB 4ECNA 5IOPA 1RPKA 1U8CA 2Y07L 1WFUA 5GRYA 2ZOWA 5D6CB 2NUTA 1X5XA 1OEZW 4A6YB 4E42B 2HKHL 2V2TA 2JHJA 4UILH 3ATEA 4KZDH 3JXAA 5F1NA 2DTMH 3A4FA 3LRHA 4ODVL 3UTSA 1J1PL 3Q8BA 4LLUA 1R3JB 4X7EC 1A1NB 1QBBA 2GK2A 3GS7A 4FQXB 4UI2A 3BFWA 3BQUB 3QCTH 2WBJC 1ZK5A 4LVHB 5DDHB 5D70H 3PU7A 4L3EB 2X2YA 3DPDA 3MC0A 3T3ME 3EJJX 4XN4A 3SY6A 3M6DA 4IOFD 3DTUB 5HHXL 4WI0A 4RBPK 2CGRL 3GBLA 5IB2B 4LOUC 1WK0A 3FQNA 4OSUH 4WW1B 3SE4C 3ZE0F 3BKJH 4OKVA 3ARFD 4RAVA 1GKEA 1KXVC 1UOWA 2P5EE 2H3NA 4GYBA 3GXFA 3IAPA 4OI9A 1U8LB 3TZVD 1HDMA 5KEZA 3PV6A 4TSCL 1NCBH 2DLFH 2R0KL 4O02A 4G8EA 3T4AC 3DO7B 2A4CA 1TTBA 4PI0A 2OSLA 4F1ZA 4JQIH 4F7EA 4NC1E 3T1FB 5BUGA 4M6OH 2B39A 3MV7D 3T6XA 3TFKD 1I7TB 3KBEA 4PW3A 1UZGA 3S37L 3WJLC 1U2YA 5IV2B 4JKLA 4D94A 1N0XH 1YNKL 2K4WA 4OZGE 1AS7A 3QIUB 2H0EA 2CHNA 2YK1L 3TF4A 3UMTA 2D3NA 4G6FB 4HCGA 4X6CA 1P2CA 2BMKA 1MW1A 3QXDA 2JTDA 3AT0A 2YBGA 3C8KA 5L4FA 2CUAA 1HIML 4AIOA 2C1OA 1QLEL 4FQCL 5K93A 1RUML 3D09A 4QTIH 4FHKA 4HGKC 4GIOA 2YD7A 4OCLC 4EZLA 5JOPE 2WBXA 1BXVA 4UAOC 1RULL 1MF2L 4YPGA 2BJMH 3VFGL 3KPSE 2BSSA 2ZSWA 1TZHB 4OBRA 1E4KC 4UQIM 5CGBA 2DBLH 3MODL 4LCWE 1DZ0A 3CCHB 5DC4B 3BIAX 2E7LC 4P2RB 2A74A 2DJSA 2HPOA 3Q6GL 3WNKA 4ZMAT 3TYGH 4U1GC 3FU8A 5CHNA 1GAFH 4KNTA 4EVNA 3PUUA 3GXIA 4GKNA 3KYOA 4EI5C 4P9HL 3RDTB 3ZDWA 3O6LL 4N2KA 4XB3A 3MLWH 1XH2A 4ZXBB 3TCXA 3HE6C 1TEGA 5CIPB 4LFHD 3WUWB 4ZMVA 5ANMB 2WZ5A 2R8SL 4YZWA 1A1OA 2EJ1A 3QI9C 1FI8C 4LKCB 4IOSA 3RWFB 5JDJA 5I82A 2Y22A 4HHGA 2JIXB 4X0KA 4X5XA 2WN3A 4HIXL 5I2IA 3WOVA 4GP4B 5DHMC 1SDAB 3NJIA 3S5LB 2BRQA 3E80A 4N1CA 1LE9B 4YDNA 1OAKH 4PJFE 5C6TL 3OHXA 3AQXA 4JRXE 4M9PA 5IBUG 5IK3A 2MPVA 5FAAA 2IAMC 3MLZL 2CDEB 2A4EA 2ATPB 1VHPA 2IXQA 3MCLL 1FVCB 3I9GL 3ARVA 3PGCA 1EERB 5EBGA 5C0IB 4GS7B 4ABUA 2IANA 1JVOA 2X4RA 3RX8A 4J39A 3RNQA 1IFHH 1VADB 3CUPA 4MA8H 4XOEA 1QSFD 3WTVA 1IE5A 3FO0H 1CLVA 1F3RB 1YYCA 1MFDH 2VDPB 1UXLA 1F00I 4EALA 1E9PB 3LHAA 5MENB 3CBJB 3AZUA 3MSPA 4HC1A 1B2YA 3UZQA 1BVNP 1CFSB 4K7PH 2BIPA 5I1GH 5IUCA 1I8MA 4OGQC 1S8DB 5HDWA 1HFUA 1FCCA 3QJXA 4EJYA 1NGPL 2BHUA 4NZFA 1NDMA 3MBEB 3MMEA 4WJ5A 3D4CA 4O4YL 4L8CA 4CAGA 1HU0A 3BIBX 3HG2A 1A02N 5EO0B 1O6TA 1LE5B 4GW4A 1JFQL 2XKNB 5I1HL 1PDKA 4W9EC 5A2LH 3VFTA 2PYEA 3IF1B 1SRDA 3X17A 1CIDA 3P3UA 5ADPL 1P7QB 2JSFA 4PV8A 4TSAH 1GHFL 2CSPA 5KWYC 1XF5A 3DUSB 2X4OB 1QG3A 4TF4A 5EBLB 3GI8L 1DQJB 1LP9E 1KLUA 1Q9WA 3ARYA 2FWUA 5HGBB 4L5FH 1Z5YD 2FDBP 4NUGL 4UUJA 3CDFA 1FVDB 2KKQA 2GJ6E 1U6AL 2J88H 2HLFC 3D3VB 3FNKA 4Y9EA 3MGOA 4X4KA 2NY7L 2FJFB 4W68A 1K85A 2KDGA 4ZS7H 4PJ6A 1C5DA 3K6SB 2Y7LA 5E1QA 5J8OA 5DLLA 3ESOA 4DP9X 1TTFA 3TH2T 5DFVC 1X44A 3VCLB 4AYDC 2VXSH 2WLHA 1QVOA 3CLFH 4DTGL 1TZIB 3B9DA 3COOA 5HHMB 2FECI 3BKCL 5D1ZC 1L7IL 2OMNA 5AW5B 1S7VA 2BH0A 2CCWA 3OMZA 4LLYA 4PJ8A 4RGOH 1KN4H 4OGAC 2BOBB 4N8VB 1A1MB 5E0FA 3MRLB 4F57H 4ORGB 4YE4L 1IAKB 4OLVH 4PB9L 3ZT7A 3OXSB 3APFA 5I66B 5JZ7D 1WHOA 1OAZH 3QJHB 1VAHA 3C6LA 4KDTC 1I82A 2CKBL 3BSZL 2OTPA 1SOXA 2E9WA 4FHJA 2DQCL 1L0YA 1UYWL 3GMRB 1U2HA 2WYTA 1PCJX 2RFXB 3RZCA 2B1OA 2LFGA 4GRWH 4MJJA 3T0WA 1HYSD 4H25B 3FO9A 5DJZA 4A67A 2HMIC 4MJID 1EVUA 1KOAA 5TTRA 3ORJA 1AHKA 1S9XA 2IQAB 2WQ8A 2WVVB 4O58L 1AGFA 2GTWA 2X12A 5I73B 2V6HA 2A0LD 3L4TA 4RGNB 3MXVL 2UZYB 4GLRI 1DO6A 4J1UA 2I07A 4CU6A 1KT2A 3O6MH 1Q9KB 1RU9H 4JX0A 4YQXH 3IRPX 2AEPL 3I6SA 3LEVL 3MLVL 4ABVA 1B4JH 1ZPLA 3PDDA 1CLOL 5F7NC 1D9KB 3I6KA 3S8GB 1CGYA 4KNUA 4JG0L 5AD0A 4MA1C 4Y5VC 4NM4L 1B90A 2DQUH 4XE0A 5GGSB 3ZHKA 1RZKL 5IVXA 2VXQH 3PFUA 3V5KA 5I1EL 1HZKA 1AGEA 4GRLD 1G7JB 3RWCB 1FFOA 3H53A 1W72H 5CGMA 1SGKA 1OZUA 2NSMA 1CMOA 1R5VA 3HAEA 1AIZA 5I30L 4M8QB 2LR4A 3NDYE 3V0VB 2H2PD 3S9DB 3MRPB 4G8IB 4QRPE 4UV7H 3VXSA 1Y0LB 4G6AD 4OV5A 3C08H 2BHZA 3FSAA 1BVKB 4TUKL 4P2OA 3W1ZA 1H3PL 3IRZA 3HC0B 5CJXA 5DA4A 4ZFZA 1RZFH 3FB5A 3P4OA 5DJYA 3F5WA 5BRQA 1GSKA 4AEFA 2OV0A 1MN4A 3QCVH 1IC4L 4HJ0C 1YTFA 1PZ2A 5BZWA 4PJ5E 2I60L 2JWYA 2ZXBA 4Z0XA 4N8PA 3RTQA 5IB3B 5CJQH 1GGCH 4CVUA 5B3JF 3DBSA 3GXNA 3LXBA 3SDAD 3G08B 2WHVA 2ZYSA 3DHMA 3DKHA 1IAIH 5I1LA 4RETB 2APVA 4XNAA 1ID2A 2HT4D 4G43A 4YHIA 4JCLA 3V6OE 2YRZA 4Z7OB 2QKIB 1E3XA 2RCSH 3CQFA 5IW6B 3L2NA 5DD5H 3ZQXA 2DD8L 2IO5A 5DSCB 3QDGA 4XPAL 1OP5H 3BRDA 4TNWK 4P4RA 5DA0B 5E1HB 2C26A 5AB0A 1QAWA 5I6KA 1WT5C 1OTSD 2NLJA 3HE7B 4QHMA 1FBIH 2G9KA 1OAUH 5L2JB 1PZAA 3CFDA 5TK2A 4YO0A 2CRZA 2W1NA 3VGDA 2ZUWA 4PJXB 5A2AA 5CJ8A 5I1AA 1MREL 3MRBA 3OPZL 1J8HB 3T0EC 3BLBA 1DVUA 4NQED 1R75A 1S78C 5E94A 4RSYA 2VLME 3PGDA 3EH4B 4MAYD 2X6CA 4GMTH 2D7PA 4X4YA 3IDJA 1H6UA 4I1PA 3E3QE 1DQQB 3EYOA 4FNTA 4J8QA 1BJMA 4CU8A 5F0JB 5GGUB 1FZOB 1FLTX 1X4ZA 5AG9A 4R8WH 3ZKMD 2X88A 2YXWA 4TUJB 4BE6A 1JXGA 4PG2C 5GGQL 1S9YB 2WXPA 1UASA 3BWUC 3FUJA 4HJJL 4KRNA 3EJZD 3NZHL 1OD7A 1WRFA 2PPFA 1CL7I 4G8GB 2R2EB 3TVMB 4IBTA 5BS0E 1INQA 4PJ7B 1CG9A 3GSNA 5DS8B 1CR9L 1FC2D 1J9QA 3JWNC 3L3IB 2DQFB 3NIFB 4G9FE 4K7FA 4KO6A 3DXAB 4TKWA 5E1GA 5ES4B 4HW6A 4MZIA 4UZUA 5LGHL 4LCCB 4NGHL 1TBAB 3CVIH 2E74C 4ZBJA 4PY7B 3T65A 3FH7A 3EO1B 3ULVL 5C70A 1GY1A 2CIKB 1MFCH 1CXIA 3N44F 1QTSA 4KMQA 4J6RL 1RUAH 4CVXB 4TTGA 1E4XI 4I2XA 3SKMB 5AYUH 4LO9A 1MG2C 4JNXA 5D2NE 1C9BB 1IBGL 5F3HA 3HEIB 5JHDE 4PW4A 3D69A 2MQCA 1BVZA 5AAWC 2PNDA 4CJ1A 5INDB 1RVFL 3CVSA 1EFXD 3VFRA 3GIVB 1O6SB 5EUOA 3KPMB 4JY5H 3QJFA 2A6IB 4H26A 4OQTH 2IPTL 1FNEA 1B0RB 3DOHA 3UP6A 2NNAA 5SWZD 3BGFC 3DMMC 3BYYA 4A7GA 1H8SA 1EJ8A 5E7BA 4N24A 2XUWA 4ZUWA 1R3LB 4MVBC 3A47A 2P8PB 3QEUA 4JHUA 1LEIA 2CWRA 15C8H 2NTFA 3CHQA 1IM9A 3ARDA 4I8DA 1M2OA 5F9WC 1FO0A 3LKPA 3NH7H 4FTDA 4TLKA 2Q7YB 1NIEA 3A6CH 3OGDA 1M3JA 4LEXH 2J6WA 4Y2NA 1AI1L 2APFA 2ZX7A 4HETA 1EV2E 3QC6X 4JPIB 5I5MA 2EYRA 1MCDA 2IGFH 3FW6A 3KWUA 3V6ZB 5DI8A 3I2CH 1TSRA 2AMGA 3VM5A 4U6TA 5FB8A 3POCA 4A6YL 2MQ0A 4P46C 4F8PA 2CHZA 3AU1A 2E8ZA 5C08E 1QW9A 4HKJA 3H9HB 4WO4C 3DX6B 3JWNH 1OE1A 4OFYD 1BMZA 1HH6A 4KH9A 3VI3B 3EDJA 1D5XA 3X1EA 5HJ3B 2HT3D 3G7TA 2NDFA 1N39A 2NNFA 3FAWA 3W39B 3UG5A 3FQWA 3BKYL 2K70A 2DIAA 4Z7UF 5ID0A 2A9DA 4N28A 2NY6B 3JTBA 5DK0A 5TE6H 5FGBC 5DXWA 2BZDA 2WQWA 3U30C 4PCYA 4TPRH 3QFJB 4PLJC 3V6BR 3R1GH 3WCYA 2F5BL 3A4DA 5D5MA 2ZXQA 2E8YA 2XXCB 1OTTD 1S3KH 4P4KD 2X1QA 4HIHB 5ERWA 3ZL4H 1RLBA 3VTAA 1JI1A 2G5BB 3L6FA 2E5EA 3IDGB 2QSQA 1FLRH 5F6IC 4TQEL 1K8IA 1NC4B 5CUSL 3QNYB 3TCLA 4HEPG 5DZAA 2EIJB 2ITEA 3N43B 3VTMA 1GPOL 3VXUD 4LSSH 1RJZB 2X4PB 2YLHA 2BY3A 5CFAA 1NGWB 4G42B 4K9EH 4DP7X 1TJHL 4QHNB 3UIZA 4GG6E 2ZG2A 2ZX6A 4U05A 1S6NA 4M3HA 5EU6B 3SGEH 3QORB 1GXEA 1BZ8A 1K2DA 3RUGA 1E6OL 3LV3A 5C0ND 4BSWA 3FFCE 4N0UA 3VQ2C 3VXOA 4X98B 1JZEA 2N0KA 4MD0B 5I8KL 3F64A 4RGMC 4A7VA 4I9WE 4DGVH 1MXDA 1XX9C 1CGXA 3L16A 4UQ3A 3V8OA 4OZIB 3KG5A 1JRHH 4N0RA 4PVMA 3D0VA 4W9DC 1SLXA 2LU4A 4MS6A 2HJLB 3BPCA 4MXQD 5L0QC 4WI7A 4LF3B 2CLVB 3MLXH 4PJIB 2IG2H 1M53A 2FX8H 3RB5A 3BE1L 3VG0H 4RESB 2ED7A 4LGPB 1YVLA 2C9UA 1E67A 3QWQB 4NQXB 2DL9A 1I9EA 1AXSA 3MV9D 4MCZA 3EF4A 5B1AB 5EWIL 5B3JE 4YSRA 3HG1A 4R26H 4BSVA 1DTUA 3WKPA 1A4JB 4QD2E 5DVLA 2WQRA 5KS9E 1TUPA 3D48R 1N10A 3RBGA 2A6KA 2X2HA 3I84A 4CVZB 2D0FA 4A2DA 2V2XB 3O11A 3MRFB 5I5RA 2BS9A 3U0PA 1KJ3L 2XZQH 3DRTA 2WTRB 4H1LH 2JKSA 5FF6A 5DGQA 3LVTA 3ENCA 2X4TB 5F7DA 5KUMA 1M7DB 1HILB 1O9WA 3ABGA 5ESAA 1QR1A 1PZ3A 2C7FA 2W9DH 3L8QA 3LHPH 3PNWA 2MIZA 3MROB 3ZQ9A 2EUWA 1JGDB 2EICA 3PWPD 3WEMA 3HRZA 5DVMA 3UC2A 5FV1L 3ULUC 3PAZA 5GSRB 4NFDA 3NTCL 4N1HB 4ZPTB 4LOEA 4XAKD 2O1AA 3WN5C 2DQMA 1FL3A 4YC2B 2DI7A 3V55A 3H8NA 5HVFB 5C9KA 3GFUA 3L4ZA 4UTBH 1IBDA 4ZFOB 5A43C 1AZBA 1XR9A 2LU5A 2XC8A 4JFQA 4HK0B 1SZNA 4XC3H 1CYXA 4AYFB 4OGYH 2P1YA 2JMRA 2W9EH 2VDPL 5DFWH 1MVUB 1NGXA 2Y25A 4M7ZC 4YVNA 2OSWA 1K4DB 2CO7B 3RVTD 4R5XA 3SQOL 2R0WH 4BFOA 2A77L 4K3DH 3D18A 5B39G 4CC1A 5C92A 5T3XH 4HJ1A 4BGLA 1RIUL 1FYTD 43CAB 5JMOC 2E46A 4E9LA 5LCVL 1DUZB 4WHTB 1ADQH 2EIDA 3BVNA 1PKOA 5GS0L 2XV6B 3DETC 3T2OA 3IJYB 1SLWA 3IGUA 4XO4A 4GO6B 2XY1A 5E8DH 2QEJA 2QQKH 4JRYA 1W0VA 2JE8A 5B3SB 1C9SA 2EDOA 4F33A 2QADD 4AQEB 3QUMH 2EP6A 1JXDA 5KVFH 5D2LA 4AMWA 1V7ML 5FYKL 5HHOA 2X87A 4QXWA 2BP0B 1BEXA 4LCYB 2QBWA 3WE6A 2PXYA 3KXFD 4GO9A 3G5WA 4PRIB 4FQIL 3T8XB 5EN3A 3RJQB 4IJ3C 1MAML 2AXHA 3CMGA 3JWOL 4ELDA 1NOAA 3EFFB 1F11A 3F84A 1BM3H 4F7CA 1EHLL 2FSEB 1O7DC 4OJYA 1ZT4A 1VFAB 1JWSA 2FQDA 4HS3B 4UINL 3NRQA 2JQZA 5LJYH 1UG9A 4L4VD 4TULL 5EN2A 1BMGA 4X5QA 1BF5A 5FUCE 4MNGB 4AM0B 1P4IL 1Q9LA 4FXTA 4UTAL 3D2UD 4OH2A 5CZVH 3K4AA 4J3VA 1HVXA 4K7PY 4XZUA 4AENA 2O61B 5A6LA 4XMVA 3S37X 4N6QA 1KIRB 3WIFB 4DHLA 1PLCA 5CEZD 3ULUH 2NW3B 5BMNA 1I31A 2Z31D 2Y0SA 4M5YL 4N6RB 1BIIA 3QO1A 3BGMA 3MRIA 4MMXA 5AOIA 4PR5B 1QNZL 4JANA 3MPCA 2VJ0A 3ZW3A 1X5FA 3T2PA 1EAQA 3GSVB 3WE1A 1JZ4A 2BNUB 1CT8B 1KBPA 4KVCH 3R19A 4D9LL 4EZKA 2FEJA 2B77A 3B9KB 3SO3C 1X7SA 4AEIH 1UWEL 3L54A 5LN8A 2EAEA 4AV4A 4TOYL 3KPQB 4F2ME 3RWHA 3PJSA 1NH6A 4BFNA 1MNNA 1IGTA 3SBWA 3VACA 2QDWA 4NN5C 5TPWL 3KLQA 5AOMA 4Z8FH 3IFNL 2A74C 5J1AA 4PJGB 5EC2A 4UANA 3Q5YA 1EUTA 1P5UB 1Q4NX 2W65B 4DO5A 1MJUH 3IFPB 4EZJA 3T6WA 1ZV5A 3AQZA 5IKCB 4FG6C 4KPHL 5I0ZA 3W57A 2VM3A 1XMWA 3OKOB 2VQUA 4B50A 3FU5A 4PG9A 4HJTA 2CRYA 2D2CC 4I0PA 2Z0BA 3LZFH 5FS5A 2VDKB 4OJEH 5IEKA 3PWJA 3PUCA 5AAPA 5DRWB 3DJZA 2VB5A 4HBCL 3MV7E 3AT9A 4Z7UE 5TDPA 1NM4A 2JVUA 1OGAD 5KG9B 1H6FA 4ZTOL 1MCFA 2WUCL 4GINA 5IHLB 3FYIB 3MGAA 1GC1H 2DLTA 3OHXC 4X7SH 4Z78A 2J8UA 3E7JA 4P23B 4U3SB 2GJPA 4FFYL 4L9LA 4ODUB 4O02H 4K8RL 4C59B 4OGXL 4YWGH 3MA7A 4FYSA 4GXVH 4Y16B 2FLMA 2YGPA 3BEWA 3WY3A 1K4CB 4C56A 1MHEA 4AT6B 3RVUD 4RMVA 2IWFA 4HUNB 4GI6A 3HS8A 3FRUA 4ZMQA 3B2VL 2OL3B 4FC3E 5AW8B 3LH2H 5DJ0B 3NYKA 3QJZA 1PLAA 5AVQB 3BAJA 3KHOA 3CMOH 5ALBL 5FFGA 3RILA 2QFRA 5B1CA 1M05A 3GMMB 4IKIA 2ADGB 3P30L 2BFGA 3ZO9A 1HE7A 3P11L 5F8QC 2A6DB 3EADA 5IW1B 2G60L 4ODTH 1HSBB 4JFYB 4MSWA 4DP2X 1OF2B 3AAZA 3KR3H 4G3YH 1JXFA 5I76A 4KK6C 2CO4A 3BVDB 3LQAC 4UQCA 1I7ZB 3WLWC 3CWSA 2IBBA 4LU5H 1NFDE 1L9PA 5I5JA 4A2FA 2EYSA 4GKZA 4OI7A 1QLRB 4Z3TA 2VLJB 5AAMC 3AACA 2ZG1A 3V0DA 4EOWH 5F9CA 2AZUA 1UFGA 4PGBB 5CR1A 5HYEA 1NJ9A 5AOLA 4AQ8A 4XHJC 3UTZB 1E5ZA 3O0RL 4AIEA 3GS0A 4Z76B 2YSTA 4UMGA 1NDGA 4GQZA 3QXAA 4LAJH 2NY2D 1EJ6A 1A4KA 3QZWG 5BXFA 3ULVD 1U2CA 1PKQB 5E8OB 1XR8A 2ITDB 2R2HA 3B3BA 1QSFE 4UBDD 1BD2B 3BLPX 3TBTA 2ZE0A 4LSUH 1J88A 5M94B 1JDYA 1VFMA 1XT5A 2W07B 1OK8A 2JJSA 3L7EB 2Y36H 2AK4D 3C5ZA 2ZXEB 3CSYA 1AHWC 4NQUA 4LVNB 4NYLB 4ZS6D 1ZHNA 3X14A 3IDMB 1AR1B 1BQLH 1MCRA 5A16B 1H9DA 1QUNA 3GIZL 4X8GA 4KI1A 3C6LC 3EJSA 2F9BT 3VD7A 1RZJL 5HHPA 3INOA 4HZLA 4MCYA 3S36H 5B4MD 5FO7A 1M7IB 3RZCC 1RQ5A 35C8H 4JFOB 4C8XA 5IESL 3KRMA 3TBSA 3ARBB 3OR7B 4CSPA 3IFLH 4L4VA 1IVTA 1OCWL 4KI5C 4HC1H 43C9B 4X8XA 3NSCA 4HS6B 1TETL 4ZOCA 2C7UB 1KGUA 1KIUB 3ABKB 4LMQE 2ADFH 3OWEA 4GUCA 2Y3AA 4XWOD 5T1DH 1IEBA 2HG0A 3MJ9L 3K6OA 1ZTXE 2VLRD 4TV3A 2Y69B 3AQYA 4IMKA 2EO9A 5BV7H 1C5CL 5L4IA 3PG2A 3ELAT 1QBLL 4PGEA 2XG4B 4P59H 1SJHA 1BJ1H 3F2LA 2CCVA 4KNSA 1EMTL 1RIVH 4B9YA 1UCBH 1T2QL 3CZGA 1PTZA 4G7YL 3SE6A 2J7LA 5ICXB 1UD6A 1ZA6A 2VH5H 1OM9A 5J11B 4AW7A 1J5IA 5KSBA 1M57B 3CC5A 2E6QA 2NXYB 1ECZA 1JGUL 4P0DA 2WVTA 4FQXD 3BQUD 2BX5A 3E2HB 4S2SA 5EULV 3TT3L 5LGYA 1N68A 4L3ED 3BRGC 3P9LA 1BPLB 1F4WL 4N2DA 4ZX3A 1D2PA 2X4SB 2V33A 4C54A 4HWZB 1OT4A 2CXGA 2ZXAA 3KW8A 4L1SA 1SYVB 2Z35A 5F7EH 3TURA 3C60A 1KG0B 4P2OC 4N85A 4OUUB 2K1MA 3G9VA 5CJXC 2GTQA 5I24A 1R0AL 1F58H 1ZDQA 1I4FB 5TQ0H 4NQTA 2XZZA 1FH2A 2WGXA 4PYHA 2AK1L 2K6WA 4IRJA 3NEOA 4Q0XL 3R7QA 4F58L 4MJIE 3SEPA 3RTQC 2DY2A 1C8QA 1FNSH 2R1YA 1IQWH 1YAZA 1NIDA 4JKNA 2OMWB 5KYYB 1NGMA 3IXAA 3L3DB 1NA8A 3TONA 4GO8A 2JKIS 4ZTPH 1BFVH 3BLKA 5DJAA 1S7RB 1E2WA 4J3OC 2NOYA 3MNMA 4QXGH 2A9BA 3QIUD 4ELME 3FSWA 5IROA 3NSYA 3VGFA 4BWWA 4QRRB 1ZT7B 2ZP0T 4M6NL 1Z9OA 3PWUB 2VQ1A 4XMKL 5FECA 4G6FD 1CGWA 5C0GB 2OQJA 3BH8B 3VYNA 3U6XS 4AQ1A 4DEPC 4EQ3A 1XGYL 4PGJA 3CN4A 1Q1JH 1W0WA 1CFQA 1JP5A 1NZRA 5TD4A 4NNYB 1JN6B 4U6VL 3Q3GB 1Y7VA 5EIIG 1SLVA 2P5WA 4MB1A 4B5ZA 2XZCL 3AG3B 1TXKA 4JGNA 5EB9A 1NCWL 3TESA 1MCOH 5EU7E 4IDLA 5H8DA 4FN0A 4FNLH 3WDHA 4P2RD 2MCG1 4I3SH 4F7TB 2FGTA 5C0AB 1VPOH 2Y9RT 4CJ0A 4KK9D 5I0XA 3SHSA 4Y9BA 4Z3GA 3LEXB 5JO5B 1JPEA 1ACYL 3HAEH 3RDTD 1EDYA 4ZXBD 1KJ2L 5HDQL 1WZ1L 3T2LA 2NY5L 3WFEL 2XTLA 3M07A 2D7MA 2H3XC 5KSAB 4X6BA 4XP9H 2H45A 3C8HA 3H9SB 4U1SA 3O6FA 2JIXD 1IL1A 1H6EA 5DJ2B 2DICA 1ZHKB 4U6XA 4G2AA 3PHQB 2EO1A 3NZ8A 5KVEL 1L9NA 2XV0A 5EV7A 4Y1TA 1G6RB 3ZDYF 1F13A 3MTXA 5C09B 2CDGA 5AVVB 4EN3B 1VKXA 2R83A 2VC2H 1ORQB 1HKFA 2F61A 3KLSA 3IDUA 3IDYB 4HCIA 3VD2A 3GGWA 3BPLC 5H94A 5KBDA 5C0RH 2LFEA 3F6JA 1SXSA 3NCFB 1Y07A 1IKFL 4WEEA 2E86A 1D5MB 1BVNT 4HQQL 3TIEA 3RSMA 4YHKL 5MEND 2QLVA 4Z6AT 3L1EA 3NFPA 5DMGD 1OB0A 4PP1C 2NPLX 1ZLSH 5GGVL 1IIKA 4NIKB 4NQEE 1J0KA 2LU7A 3FQRB 4BFIB 4IIQB 3MBED 4QHKJ 3JWNG 3U7WL 2PYFA 1V3LA 3VFPB 5KYWA 3Q06A 3UTPD 4GKOA 1WAAA 2W95A 4GAAA 4PGZA 1X4XA 1DBBH 2YN3A 2K78A 4OLUL 4Q2ZB 5DD6A 2KERA 1V7NL 3LN4B 1UA6L 3AWEA 1SMDA 1EXHA 1BLIA 1P7QD 2Z92B 3PLYA 5GQBA 1XH3B 2V9RA 3DTDA 4OZHF 1EVTC 1NPNA 2ADJB 4NZJA 4BDVA 1AC0A 1U8IB 1V27A 2VDNB 1ID5I 1SHWA 1QA9B 4DP8X 1JYXA 3BFQG 1D5IH 4ZO7A 2IH1B 2DOCA 3D3VD 3ARDC 2C34A 5K1JA 4XVOA 1Q38A 4MZ2A 1KF9B 3QIWB 4EDXA 1PW3A 3CSBA 1AOZA 2IPUG 3FUIA 5CCKH 5F88B 1CE6A 3FJTA 5J89A 3KM1A 4TTDC 2D7TH 4GAJH 2JI3A 4KTDH 5HHMD 4Q4IA 1MFEH 3N04A 1HXMA 1KB5A 5I8EB 4JPWL 2HJKB 1UUNA 5E99H 1Q0XH 4F37K 5IMLB 4IHOB 2CLZB 3GSNH 2ADYA 1TEFA 3LNEA 2A83A 1GGYA 4NXKA 5D72L 2BRRH 3GB7B 4JPVL 2EHBD 4MYWB 1FDLH 4TUUA 3L5WB 2EKSA 3IB4A 5LO7A 2YRPA 1TG8A 2Y1AA 3KYMB 4FABL 4PJBF 1KENL 1DHKA 1WD8A 2GSGB 2RAMA 4NRXB 5FW6A 4ZNCD 5BVJB 4YGVB 4BZ1L 3Q7JA 1XBDA 3JVFC 3D4ZA 5E6ZA 5SWZE 1XZ0A 2ZPKL 2YQ3A 1U3JA 2MRYA 4G8FA 4OT1H 4S1RL 3S35H 4DGYL 2F58H 4TNEA 5KTEL 4PJHB 1ED3A 3BUQA 3OKNA 2ENSA 4RGND 5FW8A 3NQIA 5DZPA 2UZPA 3CLEH 2R23B 1ZLUK 5HYSA 2G30A 3I3DA 3WKMH 2VR3A 1UT9A 3T0DA 4L18A 3FKUS 5JIPA 4Q97A 5D2LE 1S7UB 4LKXA 1D9KD 2PCPA 1TKWA 2P3YA 4D0CA 3JTTB 3I9IA 1PQZA 2E75C 4HH9A 2PPEA 3L3GB 4JO4H 1DJZA 2JCCB 3CZKA 4H1LG 1ZGLP 2J43A 1GCFA 1BG9A 4Z77A 2IALB 4WTQA 1UM5L 3T08A 1YN6B 5E2TL 1SHMA 2VR5A 5L4MA 3W9EA 1XXFC 3G5YA 1Y1DA 5EU4B 1L9OA 4M1DL 3GSUA 1ZGLA 1UEMA 3MLRL 4IDJL 2VZUA 3FBKA 5J9PB 1IGYA 1PZDA 1FO0H 1MSPA 1YEKL 2X9WA 4POZD 4I88A 3TO4C 1NVPA 1LEGA 3KPOA 4PV9A 2CLRB 3O2DL 4NPJA 4K8RD 1CGSL 3ME0B 4E9RA 2IQ9H 1PS3A 2DWXA 2GK0B 2O26U 4MB3A 5EIVA 1KTRL 3T3PB 4RX4D 2DMHA 4M4PA 2QR1A 3PXJA 2PTTB 3SDDA 4WUUA 1A6WL 4OTXH 2JOIA 1JXKA 3N41B 3H0TB 1F4YH 1N59B 1AIFB 3QAZC 1YYMH 3Q48A 4BFEA 3EJRA 1I85A 4ZO9A 2YGVA 5JHMA 5GGRA 3ZGHA 3MXWL 2HH0H 2G75A 1FNGB 5AOKA 4XRCB 5B21A 2KLRA 4QOKA 1R17A 4BQBA 1YEGL 2AJYL 2FVNA 4ZYKA 3BT2L 3IYLW 2ZCKL 5TE7L 2JKJA 1WBYB 2CM6A 4TVSa 1EXUA 4JB9L 2BFVL 4M5ZL 2BP8A 1HKLL 4LCVA 3VXUE 2EIZB 5ESVA 5AW9B 4NO2A 3D0LA 2NDGA 1EBPA 5D8JH 2FEDC 5E2WL 2VSKB 1AH1A 3RWDB 1NFIA 3C6EA 1QFWL 3VJ6A 3UPAA 1NEZA 5E6RB 4ADGA 3QUXA 5LGJB 2JJTA 3HRZC 4C4UA 3GRBA 4CN1A 4XOCA 5FGCB 1RZGA 2O6DA 2X5PA 4G1EA 2WSKA 4RCAA 3BAWA 4KV5E 3HE7D 2I9LB 1A4BA 2B5IC 3G6JF 3QDAA 4TRPH 5LKNA 3BZEB 3L5IA 2IPUK 4WTXA 4H88L 2AXGB 3BXNB 4PB0L 4YAQA 4Z7VB 1I7RA 3WJMB 4F2EA 1J8HD 5T1MB 4Q8BA 1A6UH 2F54B 4IS6A 1ZXQA 2BC4B 1AHMA 2OL3L 4L2YA 3PRZA 1RUKH 2WNKA 4NT6A 3W9DB 5LWYL 1R47A 1CE1L 2BS8A 2F68X 2VDQH 2FEEL 2Z8VC 4QWWC 1FJ1A 1I9JL 1U93B 4AQOA 4Z7WA 2BIQA 3MV9E 2V7NB 3KL0A 5C8JA 1MRFL 4YR6B 4UT9L 2AEQL 2W60A 4S0TD 5AZUA 2ATKA 2Y72A 3CFKB 3VAEA 1YY9D 5BQ7B 4LCIH 1AGCA 3ULVF 2BNQB 2GY5A 4KAQH 2BWDA 4XN7A 3VRJB 5K1VA 5GGTL 2A9AA 4KKPA 3J8F7 4HF5L 4NDMA 2Q9OA 1IGML 3CPLB 3ZDYE 5IIEA 4MNQB 1M56B 1BEYH 4IBZA 4P5SA 4G8GD 3EBIA 3TVMD 1CI5A 1AG0A 1MFVA 2PXYC 4GQ9L 5CEYA 4B27A 1WQVT 3DSNA 3K2KA 2VL5A 4X6FB 4MQ7A 4QHLB 3VMNA 5L7XL 3BZFA 4PRHB 5E2VL 5DC9B 3UYPB 2HUHA 3L4VA 4MQXD 4R4NC 5E5UB 4ZD3H 4XP1H 3GC3A 3X13A 3PWPE 2WYHA 4PJEB 3U4BL 2CU9A 2R56H 4FA7B 4ZUTA 3DXAD 5FYJL 2V9QA 3AU0A 2LGNA 5DT1H 1MI5B 4R6UA 1DCEA 1U21A 5F1OB 1JZDC 3J7HA 5MEPA 3K6IA 3GUTB 4XAKE 2F53B 3KWWA 3CDGB 1Q0YL 3FTVA 1H8OA 2QGBA 2V17L 4LHJB 2HFFB 4Y2LA 4GSRA 1XTLA 3E9UA 5D1QB 3KEHA 2L7EA 2DWDA 2AC0A 1E40A 1HXYB 1SM3L 2P9RA 3FMGL 4HS8H 1NAMH 3GSOA 3FT3B 3QUYB 2ZUQC 4UT6A 1XSKA 3VWJB 4Y2DC 4MA3A 3R8QA 4G7VH 4NP9A 1W0YT 2FO8A 2EEDA 1FYTE 2C4FT 2FGWL 4JM0A 4YBQC 3INUL 1CF1A 2EXTA 1U8QA 4O51A 3A6BL 5IT2L 1EXGA 3OLDA 1ZHLA 3FQ1A 1TQTA 3SD5A 3QH3A 2HRHA 2FB4H 1CF8H 2YAPA 4V1DB 2ICWJ 5IMOA 4O2FB 1A6TB 2MNJB 3DHUA 2X7LB 3SBWC 4S1DC 2JCWA 5JLZB 2VMJA 1NWPA 3OC8A 1MZZA 3CFEA 3NIGB 3QUZB 5KOVC 1PSKH 4GBXA 3KXFE 3U4KA 4KQ3H 3ABMB 3I02B 5DUPH 1KY6A 1HEJC 3LRKA 3AY2A 4FF9A 1EO8H 1KPUA 4PIBA 4X7CC 1WWWX 4N0FA 1DIZA 1KTLA 1V54B 3ZKQD 1XF1A 5HHNB 1S7TA 3E6HB 1ZRUA 2CBTA 3WFCH 1DR9A 4I0PC 4L4VE 2ERJC 3O8XA 3OJ2C 1FPTH 3NP3A 4KMTL 2B9BA 3QWNA 2DI8A 5DC0A 3VRIB 4MHHG 2QHRH 1R3IL 2DKUA 1DP0A 4LRNH 1ZLWH 1F42A 3IJ8A 4PJBE 4X7TA 2E3VA 4BXSV 5CEZE 3O45B 2OK0L 2WXRA 1QWUA 1JGVH 1H3GA 3O81A 1VFOA 3U6RA 5CJ5A 3F00A 5IJBC 1SN5A 3VW3L 2NY6D 3CN2A 4L9LC 4AL8L 2NOIA 3CE1A 2O6EA 3EFOB 2I9TB 4BIKA 3GSXA 2HFEB 2WBJB 3O4LA 3QFJD 2G4EA 4M6AA 3BT0A 1INDH 3V5DA 3STLA 4HJUA 3QXWA 2Z64C 4P99A 2VITA 3CFQA 1PEZA 4N5UA 2PR9A 4HD9A 4CGUB 3KYKL 2KT6A 5TH2A 1IJNA 2RQ8A 8CGTA 3IWUA 3QIBA 5A2CA 1AYOA 4FE9A 1NC4D 2XWZA 4GKSB 4DZBB 2J2ZA 3QJOA 1AKJB 1KPVA 1U8PA 4XXCC 3MU3A 3QRLA 1JDAA 2GIMA 3U1SL 3BESR 2C1PA 1QFPA 5EU6D 3QORD 1SOQA 3P9MA 4GG8B 3R7RA 3T4AB 5F96H 4AYBA 4ZW3A 4HCFA 1D5RA 4XOBA 4JK0D 2VE6A 1S5IL 5IVNA 1NBCA 1RLWA 4FFVC 1YJDL 3RWGA 1ND0B 3LS5H 3LZRA 3NJVA 4EKJA 1QASA 1I8IA 2CR3A 3PABB 3GTVA 4IBVA 5D9SA 2WXKA 1TYEB 3TA3A 4UQBA 4KHXL 3TV8A 1QNIA 2VISB 3EYQC 3CQQA 1OGAE 2EC8A 4AG4L 2OTWA 3ILQD 4PJDE 5HGHB 2AQSA 4XCEB 3TEZA 3HG5A 4ZTEA 3TWCH 6PCYA 3PGFH 3CWAA 3ML8A 1WZMA 4F5CE 2YOCA 4AQ8C 3NMEA 2O5XL 4G7QB 3AABA 4X4ME 4H2AA 4AUUA 4RFEB 3D4YA 1A66A 2HAZA 3CG8A 2FATH 4UAOB 2EDHA 5LLIC 3CH8A 4X42A 1MW0A 4XO5A 2Y24A 3V0JA 2YMOA 1CD1A 3GHBH 1LO3L 4LP8A 2NYYC 5DU7A 2DWEA 2WINB 4Y19A 3SKOB 4DP1X 2FR4A 2OZ4A 2EDBA 5KJ4A 2JJSC 3FN0H 3C5ZC 5E6YA 1DFBH 4JPKL 3U48A 4U1GB 4G83A 1CS6A 4ZQKB 3ZU8A 2YZ8A 1EANA 3LYRA 4EI5B 1FA4A 1ZSHA 4LSTH 3DX7B 3HE6B 5E2UH 2ITFA 3DOIA 2XWBB 2TAAA 3ECWA 1F3DH 4NNPL 5JHLA 3QI9B 1G9MC 4PJ9A 2HKAA 2E7MA 1NTDA 1J0JA 4LZKA 4AH2B 1G6RL 4JFPA 1QKZH 4J3UA 5IBTH 2CMRL 3W0WA 4RNRA 2Y5EA 4NO3B 5EZLA 2HKFH 4JY6B 4R3SA 1A5FH 4XX5A 3Q9PA 4IOIA 2V8LA 2IAMB 4IMKC 4WW2A 5KSVB 4UIMA 4KH2A 5I6PA 1LWYA 1JCKA 3ABZA 3FN3A 1ZT1B 3AMKA 2A9NH 3U7YL 5KVMC 4X80L 3VFNA 2KH2B 2YN5A 1T83A 3ZYJA 3B2DC 3K3QA 2VXUL 1W6WA 1OB1A 2AVFA 3X1BA 3I50L 5HI5D 4ONFL 1VGEH 4A7UA 1QRNA 3QA3A 3DYPA 1AJ7L 3ULVE 5DK3A 4GRWB 4RFOL 4WWOA 1MH5B 4Z0BH 1JG9A 4PRPA 1LDPL 3EBAA 2DYPA 2EEFA 4G1MB 2V3EA 4AIXA 4J3TA 3BISA 3DJ9A 2N7AA 3WFHB 1JS4A 5J6GB 2AK4E 5FYLD 5LG1A 3C2AL 4M43L 3ISRA 4M4RB 3SE8L 2X4QA 1CFVL 2Q8AH 2X10A 4EAIA 3IDXH 2EEBA 2GTZB 3QWRA 4LPWA 4ONGH 4N2CA 3C60C 3S0PA 3QZWB 3SZ6A 4PRID 1YMMA 4RZKA 4XX1G 1HSAB 2G0KA 1OTUD 3CZUB 3D07A 2B59A 1JIBA 4YHOL 5GJSH 5F7YC 4YHLH 5JQ6L 3DV6A 4IRJC 4WEBL 3BHBB 3TJEH 4WTZA 2P49B 4O00A 1F4AA 3UCQA 2KBGA 1MRDL 3HAEG 5K9KB 1YQ2A 3QQXA 4J4PD 3EYSH 4FTVA 3ULSA 4NQQA 2PW2A 5KOMC 5C9JB 5HP5A 5HJ3A 3RX7A 2VLRE 5T5FA 4LQ1A 1PNCA 1G9MH 1G7MB 2AFNA 3LD8C 3EBHA 3RBSA 4DVRL 3CQPA 3THML 1PU0A 2FWSA 3KCPB 4NZUL 3DX4A 5IROC 2YMXL 5EF0A 2CJUH 5D1ZB 3UPRB 1PZ5B 1HJBC 3O3UN 4UNVA 2CGYA 1OY3B 4KK5C 4LFHG 1G9EA 1D7CA 4OCYH 4JFEA 4AQ1C 4CMMA 4HPYL 4ZSOB 2D0CA 1QI5A 2Z8SA 5CEZH 1T5WA 4WHYH 5LAXB 1HHJB 1BFSA 3L08A 1OKEA 2X70B 1YUHB 3B9KD 1MJ8L 3MJ6A 4BQ8A 2VN3A 4TS6A 4MDJB 1WEJL 4IHBA 2DAVA 3NJXA 1G0YR 2BVYA 3SZKC 2PR4H 4L3EE 5JXED 2IFGA 4EIZC 1KNOA 2IH8A 4LPVA 4G80A 1IC7L 2HRPH 2OMZB 4DVBA 2W91A 4PTUA 5GZND 4YFLI 1P1ZA 4FA8A 1KC5H 3AY4A 4BFFA 2BNRA 1HHGA 4JFFA 4TQPA 1HWGB 3FCBA 4XOAA 1G7HB 4JO3L 3KLHD 1S7SB 3OKEA 3RKDD 5E9DA 5D1XA 1BYPA 3DX8A 1BP3B 1RSFA 2C9PA 3MRDB 4FCHA 3SDCC 5JIQA 1HZLA 4XP4H 4NNXA 1QSVA 1MHHB 3DBXB 5CN1A 5A6IA 1E4XH 3PQYB 5IM7A 4MA1B 4Y5VB 3IMUA 4BFGA 5CCGE 3F83A 1GGTA 2QGDA 7FABH 2ALAA 2FKFA 4J28A 4PGDB 4E5XG 1DEEA 1K8DB 3ZMEA 2D7OA 4KZ0A 3BSGA 1WJWA 3QDMA 4WU7B 3APCA 1VEPA 2P8MA 4NM8L 4P23D 5KAQF 3FB7A 4GAGL 2FZ3B 3DO4A 2ARJB 3BD3A 4FFZA 4HT1H 1VTLE 1GS7A 3B7RL 3LRSA 3OR6B 4Z7OF 4B96A 3VD0A 3M1BA 1JHKH 4Y16D 3EGXA 5FDWA 1MIEL 3I3WA 3ZE1B 1RURH 4IIZA 5D71H 3IDNB 3NFSL 4G6KL 4P57B 3V6OC 1NMAL 4FZEL 4BKLB 1G1KA 2UY7A 3SPVA 1UTDA 1HCFX 1SEQH 2LLNA 2X0UA 2Z91B 4NXSA 1YZZA 2W0FB 4BH8B 1UKQA 2YFOA 4GQPH 2YC1B 3P2DA 4P2RE 1JGDA 1AMXA 1FG2A 2HLAA 2O72A 3K4ZA 4FQHA 5DQ9A 3RGVA 2G5RA 4PWGA 1KZQA 4M3JA 1UHVA 4OLWL 4PBVC 3PHOB 3FO1B 4APXA 5DEZA 4U1MB 5D6DA 5E8PA 2M1KA 4XGZA 2DKSA 3S88H 2ZUUA 3X3GH 5ANME 1BCIA 1OANA 4LHUB 4QO1A 1BJ1J 5C6PB 3ZBMA 4S0SD 2HVKB 1WIUA 3BP6B 1MW2A 4DW2H 4JO8A 5KJRH 1C7TA 4N87A 2WLJA 1CZ8H 1QLFA 2HG5A 4NUMA 4L8DA 4PJCA 4APQC 1AO7A 1J10A 5EC1A 1V3MA 3G5XA 2CUIA 2VLJD 1MHPH 1Z0NA 1DVYA 2DQJH 5F7AA 1KIQA 1Z7JA 2Z93A 3CC1A 1X3DA 1FGVL 1P4UA 1O0VA 3F12A 3T8MA 2P7TB 3FTYA 3WTUA 3KGUA 2XY2A 1MQ8A 4PJ7F 4Z3EA 3V7AE 12E8L 1NOLA 4D3CL 3SGDI 1W15A 1NLDH 3NIFF 2WO4A 1HK6A 5L88L 5FO8A 1T6AA 3IAQA 1ODAA 4XNXL 4XVUD 1JHLH 1BD2D 3UZEA 5IJVB 3T0EB 5AVUB 4HVBA 2GAZA 5MENE 5J1TC 5EO9A 4F7MA 5K9JL 4TNVF 3HJ0A 4XPGL 4KUZL 1AR1D 1HQRA 1CLZH 2VJ8A 4JHWH 4QAWA 1VFUA 2WQUA 5GZOD 3Q1EA 2VRAA 4F2FA 3RY6A 2BIIA 2DQEH 1XB3A 4WVRA 1TJMA 3U0WH 3OKMA 4U31A 4YMPA 5F1KC 5BO0D 4RAUA 3UTPE 1YEWA 1I7UB 3QK0A 1V05A 3FBQA 3RL1A 8PAZA 2X3AA 1BZOA 1A47A 3ARBD 2FWOA 4MAUH 4YDJA 4MDIB 2R0ZH 4OJCA 4ZAKD 4XI5D 4R4BA 5IBLC 2YPLB 3PDKA 4YSUA 2ZOLB 4KZDL 4XTRD 2DTML 1DBMH 4JDZB 5BCAA 3FT0A 3O3AA 5LDUA 1VJSA 4IU3A 2MCPL 3QJQB 4N0CD 1FC1A 2I85A 2ARWA 1H15B 3D3VE 3QCTL 4HGMA 1YQVH 4LESA 3U2JA 3ZT6A 5I18H 1P5DX 1E9QB 3TU6A 2OZNA 4EXKA 3EGSB 2JLLA 3QQ3B 3R4RA 3V2AR 4PBDA 3RWEB 3FO2A 1KDJA 2BSCA 3ESPA 4OSUL 4R7DA 5AYTA 4LPTA 5HHME 1P69B 4BA0A 2GJZB 4E41A 1B4LA 2YO3A 1G5AA 4U49A 4Y2OB 3HFMH 1XGQA 2D7NA 3JV5A 4BQ9A 5LNDA 4I8OA 2NXYD 1IGFH 4XB7A 2QGCA 4NKIH 1RZ8A 3EH1A 2V92A 5FOJA 1W6LA 5DRNB 4FNUA 1YDPA 5B3NA 3UJTH 1GS8A 3S98A 4HFUH 5ESQB 1L6XA 1G7PB 4YHNA 1HQ4A 2XBTA 3EJYC 3P4MB 2BSBA 5AZEH 3KGRA 4PJ5B 3U7AA 5IGXH 3ES6B 3GSWB 3PY9A 1O6VA 4JL1A 4R83A 4CMHC 2NX5B 4M6OL 1X9UA 4HFWB 3VI3F 1ORSA 5BMPA 1KB5H 2DJMA 3BGFB 3RWJA 3DMMB 3DV4A 4F3FB 2CO6A 3DDFA 3EYVA 4OCNC 1I85C 1QSEB 3QS3A 4DGIH 4AITA 5BMFH 5C0CA 2HB0A 5EEUA 3HVDA 4PHZA 4MBRA 3HBQA 2W0LA 1FN4A 5EORL 3MN8A 4XNQB 3T04D 4RGNE 1C1EH 3MRHA 1IM3B 1MLCA 3UJJL 4CU7A 2QVTA 4AYGA 5HPMA 1UD8A 2WBKA 1DQML 2B16A 4HGWA 4NQDB 3EYFB 2MKLC 3FCTA 2XKSA 2BJML 5HXMA 4W6YB 3B7YA 4KJWD 1MUJB 1YY8A 2EQDA 4KXZI 4QRRD 5BO1H 3N43F 2QV2A 1U95A 4NO0A 2WXQA 3QUXC 4OZFA 1EJFA 3LSOB 3T5WA 1O9VA 1VKLA 5INCA 1LHZA 1TVHB 4P46B 4K2UH 3WY4A 3QG6A 4QF1A 3M46A 3Q2LA 4WO4B 5IB4B 1USQA 1VIWA 4AGQA 1MFAL 3PWNB 1YCSA 2ZWNA 4UQ2B 1IJ9A 1NBZB 1H5BA 1JGLH 5FUOH 3MLWL 1GOGA 2Y6SD 4H40A 4OFPA 3MKGA 3CHXA 4MD4B 1VGKA 3TBVB 5F7UA 4OZIF 3V7MA 1X9QA 2OOYA 4H1LB 5DHVA 4YLBA 1UXWB 3U30B 2QSCH 4ACTA 2MNUA 5C0AD 1F2XK 5J6SA 2H9GA 4PJIF 2SEBB 2MJWA 4MS8C 5I6LA 1J7VR 1OAKL 2LTQC 3BP4B 4I77H 1LEKA 3ZY7A 1JI2A 1INEH 1G6VK 4HCRA 5FWRA 3SO5A 4NC0B 3GPSA 2ZNWA 4BELD 2Q7NA 4TQHA 3S3JA 1SDYA 3UAFA 3BC9A 4NRZB 1LD9B 5KSAD 1A7QH 2OM5A 1XH0A 3H9SD 3VYPA 2FJHA 4D7BA 1IFHL 5TE4H 1E28A 3N91A 1H3XA 1N3NB 4M62H 4MA8L 5ETUA 5FM4A 1VCAA 3FO0L 4P2QA 3ROOB 3UIYA 3ET9F 1MFDL 3PWLB 3U0TA 2EH8L 3SPCA 4Z7OE 4RGMB 3JUYA 5C09D 1PX4A 4MQTB 5IB1A 4EN3D 1EAPB 1NMCC 4GXFA 5I1GL 4ETQA 2L4OA 1P7KA 1UB5A 3AS1A 4GSQA 5K59F 2VW6A 3DJSA 2PCFB 4I13B 5LQBH 2YBRA 3IVKB 4L3CA 3FRPA 5A1AA 3GINA 5L0QB 4A38A 2HTLC 2YKLH 4D8OA 1YYLL 2W0PA 3L7EA 4I3RH 1UQSA 1DQLH 2EZ0D 3D9AH 3EUUA 3KVPA 1FIEA 2PWWA 1UD5A 1LQSR 4PJXE 1IT9H 2ZFDB 2X6MA 5FO2A 2UZXA 3QUMB 2MSPA 3DPUA 3WNIA 4TSAL 1TU2B 1IGJB 3QZMA 4D0BA 1XGUB 4LVEA 1J8HE 3CZFB 1CD8A 3L48A 1X5JA 1DN0A 1B0GA 4IBLT 4L5FL 4E9SA 1MJJB 3CVCA 5DJXB 2Q6WB 4GP5B 3HG0A 2ENJA 2J88L 1WWAX 4ZI8A 1V8HA 3CK0H 4ZAKA 5BZDB 1HINH 1V3KA 3FYEB 4PAZA 4W4NA 3A23A 4U0RC 5CP3A 2NR6D 4LL4A 3U4EA 4LP4A 2VIRA 3ERXA 5CKGA 4F7PB 2ZNXA 3CLFL 3GBNL 1MRCH 1KXQA 3KWXA 1R24A 1EHKB 5CZXC 4WI8A 4XVTL 2OYLA 1RD6A 1KN4L 2ED9A 4RGOL 1IAOA 5AW1B 4X99A 2EIKB 4G8GE 2QREA 3DVNA 3BD5A 3US1A 4GBXC 4PJ7E 1L9MA 4F57L 2FO4A 3TN0B 4QYAA 4OLVL 2PCYA 3QIWD 3BCDA 3DVFA 3VH8A 3NIFE 1LILA 1RJCA 2V4LA 4DK5A 5T8IA 1KTCA 1BBDH 3DXAE 4E36A 4WGWB 4YUEL 3WN5B 1OAZL 3MJWA 4TVPD 1BZ9B 1HEZA 3DIFA 3B1TA 1WO2A 3E6FA 1W80A 1KULA 4WDIA 3M17A 1CU4L 4X6EA 1KN2H 5I26A 5IOPB 1U8CB 4M7ZB 2WWMC 3ZN6A 2RTTA 1PCSA 2FX7H 2NUTB 2XN9A 5LGJA 2FBJL 5FUOL 2V2TB 3FPYA 1OPOA 3KLDA 4Q56A 5AUMA 4YLQT 2A3TA 1C4GA 4FQJL 3HHMA 5F1NB 3UTSB 3O6ML 4LLUB 1RU9L 1BGXH 4XNBA 4YQXL 3GMPA 25C8H 1B4JL 1AOHA 1WZKA 4E9QA 3Q2NA 5FUCC 5DJ6A 3QZBA 5DVKA 3UBHA 1Z3RA 2WC7A 5HDRA 4WNQA 3RWIA 4L8SA 3EDDA 4WI0B 5SV4A 5SV3A 3V6FA 3ZL2A 1HCVA 4UT6H 4XNYH 2VZVA 4QLWA 1FSKB 3FQNB 4YHPA 2VXQL 3TX4A 4URTB 2F7IA 3QHFH 5CO1A 4OKVB 4I4WA 4RAVB 4IJ3B 2DQIH 3CZNA 1KCSH 1W72L 1PG7H 1T2JA 4GPVA 2ATAA 2Q3ZA 2FE0A 2H3NB 3II1A 3MI6A 2FRGP 4OZHA 2A73A 2X2UA 1HDMB 4DK6A 4PLOB 1JZ2A 4UV7L 5B38G 3PV6B 2F8VA 4JO2H 1QQDA 4O02B 4G8EB 4MB4A 4PJGF 2OSLB 3RPIA 1HTYA 3C08L 3DURA 4XPTH 4FYRA 4TUOA 4F7EB 3ZLQC 1M6OA 5ALCH 3BSZA 4ZFGH 3UYRL 2BIMA 3QRGH 1RZFL 5IB5A 2A4ZA 3TA3C 3QCVL 3F0ZA 5L2KB 1KCUL 1A6PA 3CU1A 3VI3E 2DM7A 5CJQL 4X6CB 4BK8A 1GGCL 4FKEA 1P2CB 2BMKB 2GT9A 3ZZQA 5AVSB 2WKLA 3C8KB 3FZUC 1N5AA 1BXXA 2HX9A 3TZVC 4L4TB 2C1OB 2HLEB 1JTPA 2EUXA 2X1OA 2EXWC 3JV0A 2PPCA 5HVWA 3L5XH 3QFJE 5HYQA 3AW5A 1T1YA 4HISA 4YPGB 3II3A 5I9QC 2CALA 4HPHA 4JAMA 2BSSB 2ZSWB 3MCG1 4Z18A 5T3ZH 1BF2A 4HIIA 2P8LA 4K94C 3HR5A 4NN5B 4NWUL 4EJ1C 2A74B 1DVXA 2JKRM 4FQPA 4U1IA 3US0A 5CHNB 3RP1A 3L1OH 3VSTA 1K9TA 4EVNB 1Z2KA 2O6PA 3OZLA 3KYOB 1C5BH 4GKNB 3A21A 4KXCA 1KEGH 3VWKA 4JQVA 4XMXA 1JV2A 1JD7A 2L7UA 2EYTA 4GP8B 5EU6E 1A1OB 4JFDA 5AW4B 4GT7A 4PJ9C 5JPNA 1AD9A 2DBJA 4X0KB 4X5XB 3TE5A 5F9OL 5I2IB 4OCXH 4A7TA 1D5MA 4OZIE 5A2FA 4JPQA 4GMTL 3RX5A 2A9MH 5AVYB 1BM7A 3OHXB 4LPUA 3I0XA 4AOFA 5H4YA 5IK3B 1SYSA 3DSFL 3L45A 4YFDB 2MTPA 4WW2C 2FQEA 2IXQB 5SWSA 2V2WA 3OJVC 4PJIE 3PGCB 2FUQA 2H6UA 2F54D 3EJUA 5H37H 1T83C 2IANB 2X4RB 2BS71 4FXGA 1RXLA 4MXVE 1JCVA 4ZK8A 3RNQB 4MX7A 3CUPB 2DQTH 1A3LL 1MCQA 2NTSP 1BMWA 3M45A 4ALAC 4U1NA 3UBXI 3MRRA 4N9OB 4JM4L 2NR6A 4K23H 3E1ZA 5JA8B 1E30A 3PP3K 4A63A 1UENA 1ERNA 2IDCA 3IGLA 1MZYA 5F3BA 4RAHA 1NBYA 1XH3A 2MTAA 1VFBA 3UZQB 5DMIH 1T3FA 5DRZA 4AEHH 3NT0A 1I8MB 2BNQD 3F62A 3DHPA 3RVWC 2WOYA 4HJGA 1NDMB 4WJ5B 3CVIL 3MMEB 3D34A 5DFTA 5SWQA 4L8CB 4JN2B 4WHYG 4RFNC 4MNQD 1U42A 5BV7B 1E6JL 1SN2A 4GW4B 3VTTA 2DPKA 1XF2A 1J8KA 1PDKB 1MFCL 2ZUSA 5K59E 2CR6A 3VFTB 1RUAL 2PYEB 3R0MA 4PRHD 1WD9A 2J44A 4ISVA 1T1XA 5A6MA 5AYUL 1Y18A 4PV8B 2QTEA 3GJFK 4IEFA 1XF5B 4RMTA 5BUPA 1DVQA 2YXMA 5ELIA 3BSHA 3LCYA 2OZ4H 4F9PA 2VMDA 5F9JA 1KLUB 1Q9WB 1MI5D 4XN5A 2DKDA 2J6EL 2NY0C 1COBA 1E43A 4UUJB 5JUEH 1OAYH 4HU2A 3FTGA 2F53D 1J0HA 1JSYA 3MGOB 4JY5L 3QPXH 1C5DB 4F92B 3GSRA 1QFHA 3K4DA 5IWLA 5D1QD 5JHLH 3C8DA 1KCVH 5KBPA 3S5YA 4DUXA 4N2GA 1QVOB 5B7MA 3LZQA 2FIRT 3G6JA 2Y2TA 3QUYD 1DBKH 1S7VB 4LLYB 4XXDA 1NUNB 4PJ8B 2BO0A 3VWJD 3WNLA 1ZOXA 1BIHA 1X7TA 4J12A 3L5JA 1TCRA 3NRPA 2NOBA 1MDTA 3PCYA 3NH7L 2PPAA 3GK8L 3A6CL 3DROA 5FHAH 3MJ7A 1EBMA 1RMFL 2RMNA 4V1DD 3C6LB 2JB5H 3HW7A 4JEGB 4Q7DA 5CJBA 2IGFL 3FL7A 1UD4A 2V5SA 5FYLE 4X5WA 3Q1SL 3I2CL 5KN5A 2CA3A 3GLAA 3L4XA 4ODWA 1H9VA 4PRAA 4ALAH 5L4JA 1H8LA 3WFBH 3QUZD 3RZCB 3OF6D 4HV8A 4OAWA 1D2OA 4PRIE 5I15L 4RA0C 2G3XA 3FO9B 1HH9A 5DJZB 1L3NA 5A2JH 5KBLA 3H42H 3B56A 1TQUA 4YL9A 2ODIA 4NKDA 1S9XB 2XQYG 4KQ4L 4RMQA 1AGFB 1ULVA 2GTWB 3S4SA 1JD9A 1IQDA 1JZ5A 3TH4T 3G5ZA 4P9MH 1J5HA 1TZGH 2CHXA 3Q5OA 5TDOA 5BOZG 4KNQA 5D1XC 2I07B 3VSVA 2HZMA 1KT2B 4CBZA 5TE6L 3DOSA 1T7WA 3H85A 2YFNA 4TPRL 4G8AC 4WWID 3UTTA 4MNGE 1CVRA 3I6KB 1OSPH 2EVFA 5AW3B 5AD0B 4A66A 3FQTA 1HZHH 4H20H 1AXTH 3Q8AA 3ZDZB 3HUJF 4BUGA 1IEHA 4HJIA 2E7CA 1UCTA 1CFTA 5IVXB 1FLRL 1U4EA 4OCWH 3V5KB 5HYJA 2NVMA 2Q86A 2G0LA 1AGEB 3OV6A 4EAKA 4UM9A 2J1ZA 2WCPA 1FFOB 4LSSL 3N5AA 1CDGA 3QRFM 1SOSA 1R5VB 3HAEB 2WBJD 3C09C 3QYCA 4K9EL 3E8UH 5F72S 5T5FH 1RIHH 1YNTA 3SKJL 3VXSB 2D0HA 1F3DJ 2NMSA 2XA8H 5E08H 1BX2A 4HAFA 4OV5B 1PX3A 1IFRA 4AYMC 2YH5A 2Y3NA 3RA7H 4LOUD 4P2OB 1T7VA 3GMQA 2JQMA 2W5PA 4DGVL 4MMZA 1CQKA 4ZFZB 1B9KA 1JRHL 1MCNA 3FB5B 2NLVA 1AKJD 1F45A 1QFWM 1TYRA 2PTVA 2QL1A 3F5WB 3P4OB 1XQ4A 5DJYB 1PVSA 5BZWB 4XNUH 1QMUA 4RLDA 3RGVC 4Y5XA 3DUHA 1UXSA 3SPHA 1CFNA 2WKOA 2ZYIA 4Z0XB 3RTQB 3QQDA 2VC2B 3MLXL 3QPQC 4JGUA 2IG2L 3V79C 2DB8A 5D6DC 1DDHA 1TENA 2FO1A 2FX8L 2I9LA 4W9KC 1WBZA 3CJJA 4ZO6A 3VG0L 2X38A 4ANUA 1XD1A 4TPSA 3CVHL 2IGLA 2A5UA 5I1LB 4G6AC 1CCZA 5ACZA 1YEHH 5C7ZA 1U3ZA 4G43B 4YHIB 1DSFL 3GBML 1IRAY 3TTSA 4NN7C 4F8LA 3BKQX 5JYLA 3D52A 4H0LC 2R9HC 3QDGB 3FT4A 3MYJA 4P4RB 4I1RA 4P5KA 3P9WB 4DEPB 3D7PA 3OGCB 4MD5A 5E1IA 1HCYA 2C3XA 2UWEF 4DKEH 4DQOH 1FFNA 2NLJB 4QHMB 1G9NC 1DLHA 4HJEA 5CJOH 3OB0H 5CFHA 1G1OA 4GQQA 3EAYA 3CFDB 2IWGA 4YO0B 3GI9H 2W9DL 3LHPL 4JO5A 1J5CA 4HX1A 4PMEA 5DZOA 1QFUH 3ZMNA 2IBZY 1F4HA 4B0MB 5I1AB 5EDXA 4JJ5A 5EF3A 5CNHA 3MRBB 3D50A 3UZEC 2BOCA 2XRAH 3ARGC 2HT4C 3CPLA 2CBPA 4XAWH 2IBGA 3QXTA 1NSNH 3FCSA 1K2YX 4NJAH 1JXJA 3C12A 5E94B 3WDJA 3PGDB 1X5HA 3M8OL 4FFZH 4X6FA 4QXUL 4EI5D 1WG3A 2DQ6A 4X4YB 3IDJB 3HE6D 4LSVL 3RY6C 1WPCA 3EYOB 4UTBL 3AS2A 5EZJA 1OTSC 2WSDA 3HMXA 1WZLA 3JV4A 4R7NA 4XC3L 4OGYL 1U91A 3QI9D 3FUMA 1IMHC 4KZEH 5BZXA 5DEFA 4H8HA 2PCXA 2VSCA 3WMQA 2R0WL 1L7TH 5DUMH 4K3DL 1JDCA 3S2AA 2WIIA 5ITBH 4OVVA 3BUIA 1EAOA 2PO6C 2DIEA 1INQB 1T66C 1CG9B 4U2ZA 3GSNB 2XQYK 2BXZA 5I8OH 3GBEA 1ADQL 1LWJA 4K7FB 3S6CA 2IAMD 2VLJE 1UA7A 2FLRT 1RKRA 1Q94A 1XF3A 1I1AA 2QQKL 5CLWA 1X9LA 3BPLB 2RIKA 4QYOA 4FYTA 1P4BH 3T65B 5KVFL 2FQFA 3LQZA 3ZKMC 4YIQA 1N67A 3OZ9L 2N0MA 1Y6KR 1V3JA 3WLBA 1PKQE 2DQHL 4I2XB 3EO9H 3REWA 3PDOA 2I7OA 3BUDA 1M3QA 1BD2E 2WZAA 3HR6A 5F21B 4JG9A 4CNIA 1BM3L 5F3HB 1S7XA 3FH8A 4WSKA 2MCMA 4ODSH 1D3CA 1A7OL 4XBEH 5KVGH 5HYSG 2D2OA 4OD1L 2CIIA 4RRPG 1G9NH 3VFRB 4ZMOA 4IQHA 3O3BA 5CSGA 4KU1A 5EUOB 4HUKB 4JFUA 2VAAA 2EDLA 3QJFB 1TMQA 3S3PA 4H26B 3B3IA 5CZVL 1XSIA 5LHDA 1FNEB 3MUJA 4IRSA 2JPIA 2FAUA 2NNAB 1VTOA 2MJ7A 1QEXA 3E6HA 4XP6H 1KBVA 3ULUL 1UEYA 5TF0A 4ZUWB 4XH2B 1MFBL 3B83A 2H1PL 3QEUB 1S9KC 1LEIB 2HLFD 1OVZA 2EXYD 1MCWW 2NTFB 3OVUB 4LSQL 1IM9B 3ARDB 4OIBA 1FO0B 3LKPB 4KK8D 4YDIH 1UD2A 4KVCL 2KPNA 3A22A 1GA2A 3O45A 4PLKD 4A2HA 1U36A 2UYLA 4PJHF 5I6XC 4L37A 5DFVD 4AEIL 3L9RA 5T1LA 3OKKA 2EYRB 2JV6A 4M1CC 2XYCA 5DI8B 5IVZA 5D1ZD 4YHZH 2H26A 3GYRA 5FB8B 1XV8A 1AGDA 4OGAD 4Q6IA 2DH2A 4FG2A 4YSOA 1ZA3A 4YS4A 2FHFA 3AU1B 5ABDE 2QKSA 4HKJB 4PP2A 4PS4H 5D7JA 2JCCF 3ZXAC 1HH6B 1D5XB 2KDYA 4YBHA 4AM0Q 4C4BA 1MNUH 5FX3A 3I74A 2VOTA 1UADC 3P40A 3S5LG 2Y7MA 1QBMH 3FQWB 3CHOA 5ID0B 1MEXH 4WWKA 5DK0B 3LZFL 1N6VA 5C0DA 1DVFA 4WEUD 3S3DB 2NNRA 2I26N 5DRXA 3GXUB 2AJVH 3U79A 5D5MB 4YK4C 2D7QA 1CICA 1UJ3A 4EN2A 2A6JA 3B6SA 5ERWB 3PP4H 1NEZG 2H5UA 2HMID 4NS0A 4G11A 2NSQA 3L6FB 2YLKA 3L4WA 2VERA 4GSDH 2Z4TA 4TSBH 3T3PF 2X4NA 2JJVA 1CQYA 3U2SA 4E9XA 2R27A 4X7SL 1GC1L 4KRMB 2PLTA 4ZOBA 5IW3A 3ETTA 3WJLA 4BZYA 1K8IB 2BIOA 5E6IA 4FI6A 3UJIH 3TCLB 1EZLA 2AI0L 1PF3A 3UFIA 2UZIH 3N41F 2CO2A 3MO1A 1RPUA 5K9OA 1FGNH 1K72A 3BUYA 3BO8A 4GXVL 3PQYD 5F1IA 1QN6A 1K2DB 1WS8A 3AUWB 3RUGB 2FYVA 3LV3B 3EHBB 1JPSH 4BSWB 5IF0A 3MRNA 4N0UB 3WD5H 3VXOB 3GMLA 1OTTC 2VDKH 3D39A 2GYSA 4L29A 4P4KC 3M1CA 2KYIA 4QRRE 2X09A 3B2XA 1QFWI 2AJSL 4UQ3B 4DULA 3HLAA 4U6YA 2VDQB 1IARB 4BBWA 2BWIA 3FOLA 3D0VB 3UGUA 1JK9A 1TJGH 4K7PX 3CMOL 5FHBH 1ZV9A 4EXPX 1CDJA 3BPCB 5K9QG 1OF0A 1ZVHA 2G3NA 4Y5YC 2ZCLH 3UABA 4AJYV 4LLQA 2YPKA 5E23A 4A2GA 1DJXA 4P9HC 1CTOA 1KEML 4ODTL 3IXTA 4X50A 1JGIA 1ETA1 4CN4A 1KTKE 2X2IA 3WJJC 1KXHA 4OZFH 3WFZA 5HHXH 5ITFA 1AXSB 2OMVA 3QAZB 2IFFH 4MCZB 3U46B 1FP5A 5C0AE 3HG1B 4FFWC 1FRGL 3AREA 4Z7VF 4BSVB 2FD6H 2QQNH 2R4RH 2FEEI 2XQBL 2BW5A 2ZOUA 3RE0A 2A6KB 3RZWA 1RH8A 4N8VG 2FUVA 3O11B 4WSGA 1TLMA 3U0PB 4LHUD 1NCGA 3DRTB 4TSCH 4FFYA 4FKKA 2XPZA 5FF6B 5DHVH 3KBPA 3B1UA 3DC0A 1O75A 5F7DB 5ESAB 1QR1B 2WTOA 3H9SE 3LS4H 2R0LL 1VCBC 5GGSY 2VABA 3PNWB 1A4AA 4FNSA 4ZFFA 1P53A 3S37H 2UVFA 2OYPA 1GJWA 3HRZB 3WFDH 3LZPA 4HCRH 2YJLA 2Y36L 3SQBA 4JDEA 4GAYA 5C09E 2WCGA 4O2CA 1UACH 3RPJA 1F86A 3GHPA 1QP1A 1AQDA 2GIYA 1ZJAA 4HSCX 1FL3B 5IJKA 4Z5RB 4JQXC 1XR9B 1QLEH 4FQCH 4JFQB 4FLQA 1RUMH 3K2UH 3MRQA 3S36L 5SX5K 3RYMA 35C8L 1RULH 3T0ED 2OR7A 4GFXA 1NGXB 1S78D 4HC1L 3K6FA 1KDIA 2X28A 3D18B 2ADFL 3QJUB 3B37A 5T1DL 3KJ6L 2HJFA 4PWJA 5CBEA 3BEVA 3EOAA 3W37A 2GUOA 2L04A 3ZVVA 3BVNB 3TEWA 4WJKB 3VGHA 1YTBA 5BV7L 4JM2A 5BRZA 1GKOA 1GYUA 4P9HH 3X1NA 5JR1H 2YQBA 3MFFA 1T04A 4JRYB 1W0VB 5LAPA 3MFGB 4CBPA 2YD8A 4F33B 2R8SH 4FI8A 3HS0A 4KGLA 1B4TA 5HHOB 2YPLD 3ECQA 2X44D 4L8SC 4PS3A 1UCBL 3UBXA 4AE0A 3WE6B 2PXYB 1MKFA 2VRQA 3O6KL 2K8QA 3RVTC 4X6DA 4CC4A 3STBA 1OSEA 3QYMA 1F11B 3A6OA 3MOBL 1VERA 1QN7A 3STZA 3RNKA 4F7CB 1BWWA 1OP9A 1ZT4B 1WFMA 5CP3H 1JWSB 4OIFA 2WNWA 3MLZH 4ZSOA 3NIGF 3MCLH 5EN2B 1ZSDA 3BJLA 1YQLA 4Y4KA 2MEJB 5F7EL 3HHSA 4TVPE 1Q9LB 1V5SA 3TXAA 3NSFA 1GGIL 1F58L 5I1IL 4XPBH 4XZUB 4AENB 1R33A 3EOBA 3LKOA 3MACH 4BFBD 9CGTA 3WI9A 3GZKA 3PIQB 2J5LC 4D7PA 1BIIB 1WFIA 3QO1B 3BGMB 1G1YA 3MRIB 1FNSL 5HPOA 4MMXB 3CVDA 4K71C 3KHQA 4C4KT 2OW6A 1IQWL 4ZDHA 5C07A 4JANB 2XWEA 2ZP9A 1P5VA 2ZZUT 4OBSA 3N06B 3MJ9A 4ZTPL 2NX5D 1BFVL 5DHXB 3ZHDA 1MP9A 3QPKA 2NUPA 4WI3A 4H7VA 4ELKA 4HUUA 1RV6X 3DMMD 2GJRA 5H37G 3RWHB 3PJSB 4JR9H 1QSED 1IGTB 1MHHA 2VXTH 5ADPH 1EPFA 4MVBD 1GHFH 3BAIA 4YEFA 3FU7A 3GI8H 4PJHE 3OAUH 5EC2B 5J1AB 1EEYA 4LGRB 1IM3D 2TSAA 3HZVA 5JW5A 4PSPA 1U8KB 3H1ZA 4UDUA 3VWKC 2CJ3A 4JFWA 4NQDD 3W3BA 2NY7H 5H4ZA 3CFTA 3L1GA 3SYAA 4PG9B 3F7YA 4I0PB 4BK4A 2JCCE 2ERJB 1MCOL 4WRLA 2EINB 5LN4A 2M26A 5IEKB 5JPNC 4FNLL 4P46D 3PWJB 4JN1H 2YD9A 4I3SL 4WGVB 3H3KA 1L7IH 4GW5A 1G84A 4WO4D 3QG7H 5DR5L 2JI1A 4P05A 2QJDA 3IBOA 5FO9A 3OQ3B 4JRWA 2J20A 1QX1A 1YRKA 1SMAA 4Z78B 5GRVK 2J8UB 4Q4EA 4PB9H 2BVQA 4NSKA 5ACLA 4L9LB 2XYBA 3TV3L 1X5LA 1PL3A 2GBTA 4G71B 4PLJD 2GY7B 3MA7B 3IJ9A 5IHWA 3BSZH 4L3AA 4MYPA 3BP7A 4FXGC 3T3PE 3WTWA 4L4JA 2PP8A 1RJYA 1XCTA 2DQCH 1JPGA 2XDHA 4C56B 1MHEB 3P0YH 5CILL 4AC2A 1UKTA 3FRUB 1A9BA 5KVDE 3HZKA 5C3IA 3OPUA 4QUOA 2F0CA 1IO4C 1F1DA 5SX4I 2VC2L 2WVUA 4O58H 3SJVA 1YPZF 2QELA 1FFPA 2FX9H 2YD3A 5DTFA 4KKZA 1M05B 3MXVH 4JRLA 4ZW8A 1S9VA 3LTVA 5C0RL 1T0PB 2OXGA 3F85A 3FXIC 3MV8A 4JUTA 3RU8H 4PD4J 1H0DA 2B7DT 4OCRH 5D7LA 2K9FB 5E5LA 4MSWB 3VE0A 1ZWIA 4XNMA 3D06A 4YVUA 1DJHA 3AAZB 2FIKA 4NM4H 5LBGA 2I5YH 2MQGA 5I76B 4KX8A 3SGJA 5FGCE 5T3XD 4F9PC 1CTMA 4PY8I 2EYSB 5BW7C 4GKZB 4WI6A 4ZMPA 1NIAA 5LVEA 1SFDA 1OHQA 3R06A 4OUOA 3TEUA 1DBBL 1A6ZA 1CN4A 4H5SA 1UM6L 1NJ9B 2P43B 1KJ2A 5DJ8A 3O2VL 1HE8A 4Z7VE 1MCEA 1NDGB 3QXAB 2BCKA 1A4KB 2BSED 2F54E 2UUDH 5BXFB 4WZSD 3Q8EA 1OHZA 3AWGA 1FNAA 1XR8B 3GKWH 3GDBA 4BFJA 2R2HB 3NAAH 2IDTA 2FL5A 3TBTB 3BDYH 4KWUA 1D5IL 5DZNA 1A6VL 2YPVH 4HKZA 4Y4FA 1GZPA 1CB4A 3RI5K 3Q2CA 1MW3A 2YPLA 1AY1L 1FZKB 3C5ZB 2H2SC 3CSYB 5DK2B 3X14B 4G82A 3B2MA 1GIGH 1ZHNB 5G4MA 4AV5A 1ZTXL 4M1GL 2BNQE 3VXRA 1QUNB 1XL4A 4GRWF 1F56A 4XVSL 4QRTA 1J1OH 4Q11A 5IMKA 3U9PH 1S4IA 2YQ2A 5HHPB 5AB1A 5AB9A 4LQFH 4HZLB 1IEAA 4MNQE 3OD3A 1MFEL 4MCYB 5FO7B 5E99L 1Q0XL 3GSNL 3OJMB 3TBSB 3H9ZA 4D2NA 4L4VB 3ULUD 2Y5QA 1DJSA 4PRHE 3TN0D 4F93B 5DMJB 3PWVA 1FDLL 4PJEE 2L0DA 3QS2A 1FFRA 1MI5E 1IEBB 3UX9B 1JVLA 1JWMA 4RMBA 4TLUA 3O41B 3NIDB 4GEJA 4JG1H 4NKOA 3G9AB 1YSOA 4GSUA 2F53E 1SBSL 1C08A 4EEEA 1F90H 4PGEB 3VMOA 1SJHB 3VFMA 2VGLM 4MB5A 5D1QE 4W9LC 1U8HA 4OT1L 2F58L 1DANU 3E0GA 4EKXA 1XBRA 1ZA6B 4HD5A 1N8OE 3M7OA 2C5DC 3UTSD 5KSBB 1KCKA 3CC5B 3WKML 3QZPA 4V33A 5AN4A 3DIVA 4S2SB 1JZGA 3P9LB 4JO4L 3V0AC 3QDHA 1DQIA 2ZXCA 1QOKA 4V1DE 2Z35B 3RAJL 1CDHA 3C60B 3K2IA 4HJJH 1FL6A 5GSVA 3UCRA 2ZWLT 1YEDA 5C0JA 4MMZC 1E5AA 3V4UH 4TNVK 1P9MA 3WUZA 3NIGE 3VXNA 1D7DA 4QHUA 4GB9A 1CGTA 1FO0L 4OM1H 5HI4C 2VTFA 3BPNB 4IRJB 4NWTH 4UDTA 5CWSA 1CR9H 2J1WA 4Y5XC 5C0BA 4FAAB 2R1YB 3FHAA 1TO4A 1OGSA 2IQ9L 3IXAB 1KBGH 3ETSA 1MXGA 1NANI 5DJAB 3VNZA 2VDML 3LD8B 1S7WA 2F7QA 5T1KA 3U2IA 3W2DH 3AM8A 4UTCA 4WUKL 1WE5A 4NN6C 1YYML 3TC9A 4JUSA 2DMKA 2XTJC 1M2VA 2ED6A 4BZ1A 3VUAA 1DE4A 2VLKA 2VLLA 3WHXA 5L2KD 2HH0L 2ZJSH 3ZTCC 2VQ1B 4HWBA 2R1XA 5FECB 4WCYH 5KL0A 2OQJB 1R3HA 1IBGH 3ZT5A 4AQ1B 4LIQH 1W0WB 1YEFH 3QC5X 4U1JA 1CFQB 4L4TD 4F9LA 4FA6A 1RVFH 3V8CA 4NFCA 1WICA 3ALPA 2Q0ZX 4F80A 2VR7A 2V3DA 2P5WB 4FL4C 4NBXB 1PZBA 4URKA 2IPTH 3UZVA 4U0QB 4ADJA 3T77A 5GJTH 4NZRH 3ZE1F 2C3GA 3QNXA 5JPMA 4R2GC 2HT2C 1EZSA 2XVLA 1FYHB 4FG6D 2EECA 4R5TA 1V10A 5DF0A 4F37F 2R7EA 3QQ4A 4AJVA 3ZE0B 1JNNH 3AC0A 4X6BB 4YSPA 1EFQA 3O2DA 4IOSD 1A6UL 1MLBA 4ZW6A 2CHWA 4U1SB 1JK8A 3O6FB 2JK5A 4U6XB 2OW7A 1RUKL 4HWEL 2VDQL 1C16A 3NZ8B 4G72B 4E2OA 1UA3A 2GFBA 1T89A 2VN4A 3KLLA 3UG4A 3TBYA 3I75A 3T0VA 1KUMA 2W59A 2C3VA 2NY2B 4W9JC 3MQIA 3KWVA 2CDGB 1VKXB 3MRGA 1U8MA 2O5ZL 4FD0A 4LCIL 4M8RA 1CDYA 4OLEA 5FA4A 2EUZA 1I1AC 3BKYH 4EIUA 1TJXA 2IAND 3GGWB 5H94B 1Z3GH 4NB7A 4WENB 5HSHA 2JTYA 1BEYL 1CXKA 2EIBA 4OGZA 2F5BH 4LLAA 5LBSA 3TIEB 1JTTA 2WQXA 1QBAA 1XGPA 2QLVB 4ZD3L 3WAKA 1SLUA 1XSOA 3GEWB 4XP1L 5HJGA 3NFPB 5AOZA 2PWGA 1WV7T 4JZJA 5DT1L 5ILTL 3J07A 2WXGA 1A3ZA 4L5FE 4HEMA 4P3DA 2PYFB 5CUSH 5KYWB 3DARA 2B9AA 5AYQA 2HTKC 1CXEA 1K6QL 2IADA 1VEOA 2E4TA 1BW8A 3QXUA 4KXZH 3ASNB 4WU5A 2PYED 5DD6B 1B3IA 4IRSC 1JDDA 1JAEA 4HS8L 2KZBA 1NAML 4KK6D 2XBDA 3WLWD 1QN8A 1VLXA 2ZP8A 2QVIA 1IBYA 4PN6A 5GISH 1HAWA 4G7VL 4OJFH 1LK3L 3X1FA 4OF3A 3BWUF 3QXVA 3DK2A 3KGTA 3LKRA 4O2EA 2ED8A 3HMXH 4XHJD 2Q20A 4Y9GA 4EDXB 4UT9A 5GS0C 5JHAA 3MLTA 3LXUX 4MBOA 4U7SA 2WMPA 1CVSC 1X5YA 1CE6B 2CNYA 3B5GA 3RTLA 1UWXH 3UTQA 4KO9A 3OAZK 3IGKA 1QN4A 1QWHA 2DYRB 1MCSA 4PJ8D 3UAJA 4WI9A 1HXMB 4Q6IC 3JTSA 1KB5B 3K91A 3S8WA 1PSKL 3V9EA 1MVYA 1OCRB 3NSDA 1J18A 1AVAA 2LAGB 3F6LA 5DUPL 4GRWE 2P28B 1Q72L 2A83B 1LMIA 3FUHA 5D7JC 4G5AA 3L3JA 2OLDA 2P80A 2PW1A 5HY9A 4BH7A 2EKSB 2V9JA 3TOPA 5I19H 4ZFQA 1W8OA 3C6LD 1XCWA 4WWKC 1GZHA 3MRMA 4Y7OC 3HHRB 2QR0A 1DVFC 1JNLH 1NINA 1TFHA 4Z95L 3RZCD 2OMUA 1TTCA 1CICC 1UJ3C 3ALXA 4QGYA 3SN6N 4LRNL 1OAQH 4KI5D 2PWHA 4XP5L 4OZFG 1XZ0B 4G8FB 4LLWA 4M7JL 1N7MH 2TRYA 1ED3B 4W9HC 2K0RA 3WXVL 3FCGA 3OKNB 1JGVL 1OQOA 5JW3L 2XHIA 5E6IC 4DOHB 5HYSB 3NTCH 4N1EA 4PUBH 2HVBA 3H54A 3HC3H 5F70A 4ZMWA 5L2KA 3TFBA 5ADOL 4LKXB 2PCPB 3A4AA 1TKWB 5ISZA 1CGVA 3NABL 1INDL 5E2JA 1PQZB 4HH9B 4XO3A 4D0CB 1KWKA 3K5SA 4OF0A 4DPRA