1E42A

Beta2-adaptin appendage domain, from clathrin adaptor ap2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 COMPLEX SUBUNIT BETA
publication title The Structure and Function of the Beta2-Adaptin Appendage Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 60
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e42A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1e42A02
1W80A 1KYUA 2D0BA 2D0CA 1TBPA 1KYDA 5IYCP 1C9BB 2D0AA 1NGMA 2IV8A 4WZSD 1QN8A 2G30A 3EIKA 1QN5A 1QNAA 3VN5A 1KY6A 1NH2A 2Z8UA 1VOLB 2VJ0A 1RM1A 3OC3C 1QN4A 2MJ7A 4ROEB 1TGHA 1TBAB 1PZDA 2IV9A 5IYBP 1KY7A 3HS9A 1NVPA 3HS8A 4ROCB 1QNBA 1AISA 1KYFA 1D3UA 3OCIA 1CDWA 1QN3A 1YTBA 5IYDP 1E42A 1QNCA 1MP9A 1QN7A 1YTFA 1QNEA 4PY5A 1VOKA 1JFIC 1QTSA 1QTPA 1B9KA 4RODB 1VTLE 1R4XA 3ASMA 1QN9A 4B0AA 3H1ZA 1PCZA 1VTOA 1QN6A
chains in the Genus database with same CATH superfamily
5HI4D 5CCKL 4JG1H 2OTUA 2F9BT 2DWDA 2AJ3A 2R51A 3EAKA 4GRWF 3H55A 4LPTA 4U6VH 1TSRA 4X4ME 1HH9A 2ZAGA 1MHEA 4NWTH 2QVFB 2VERA 1PZCA 2FLMA 3RWIA 5DEJA 2IPTH 4ZMVA 1P84J 2J25A 2YEZB 3T3MB 1Q0YL 1G1KA 4LHQB 4M1DL 1T4KB 4NKDB 5KANI 5FF6A 2QR0A 1QWHA 2VSKB 1G9NC 2GK0A 2CXGA 3MLRH 1CFVH 1EJFA 4CGTA 4WEMB 2P46B 4NQDB 4RBPH 5BV7C 1QZ1A 1WISA 4OUUA 2DAVA 3CVCA 1KYOJ 3L3KB 4LSUL 1F13A 5AVVB 1EAPA 1RURL 1UA6H 2K6ZA 5IYCP 1WGVA 1YG9A 5F1NA 3N40F 1J8SA 1F0LA 1OLZA 4L1SA 3B1TA 1YMMA 1DP0A 4AYBA 3PAVA 2AXGA 3TO4C 2PABA 5JA9A 1IVTA 3G5YB 5HPOA 2X1XR 1S9XA 2UXGA 4AL8C 1B2YA 3LV3B 1URLA 4LPWA 4PGCA 1MCOL 5DK2B 3EYQD 2OSLA 4LSVL 1RIVH 3CFCL 2PP8A 4AITA 1F2XK 2X4QA 5C09B 2PWGA 5FS5A 4WSGA 3Q5YA 2KC0A 4WGKA 4ZODA 5B1KA 2G4EA 4E9VA 2QMJA 2WZ6A 4LMQI 5JR1L 2H8PB 3EJZD 4XO8A 3ZQWA 4AIZB 5HP5A 4V1DA 3WSQL 1HWGB 2AEWA 2YAOA 1OZTG 4KX7A 5DJCA 2IGFH 4XB8A 2X4TB 3WUWB 1TTRA 3OKDB 2CR6A 1U4FA 3PHQB 4FHBD 4Y8AA 5ABZA 3CZLA 4J4PD 1G7MA 1JAEA 3D2UB 4XXDB 5J12C 3VO0A 2RQEA 5AKVA 3TCXA 4RGOH 2DPKA 1EHNA 5GS0D 4HQQH 1OGTA 2DQJL 1S7TA 5HHME 3VXSD 1HL8A 5KYUB 4J1UB 3SKJL 2RGSA 4GQ9H 2WNKA 4BFGA 1R4XA 4NQSB 4KNQA 3BHBA 3QT2A 4MMZB 1A5FH 3T4AA 2V3EA 3QDHA 4ODVL 4HX1A 4NOFA 5B39B 2F7QA 1OALA 3OB0K 1IC7H 5I8EB 3LKQA 4HG4J 1NANH 4NQCE 1EBPA 2H2PC 3F85A 5CU9A 3KVDD 4AQZA 5D6CA 5I1EH 1KJ3L 1HAWA 1IAIL 3JWDL 4MZIA 1G5AA 3S5LG 1KG0A 2X3CA 3BH8B 1JRHL 1FFTB 4FZ8H 3U4BL 4XNDA 4LLQB 4HWUA 2XOTA 4GKNA 4I85A 3D85D 4LVOB 1JVOA 3MJ9A 5FM8A 3KGSA 2Z1PA 5T1KD 1M7IA 1FL5B 4LIQH 4H1LA 4ZMAT 4U31A 5J1AA 3BUYA 2AK1L 2VLKB 4NKMB 2ADGA 2PO6A 1X5LA 4DZBB 3KR3L 3OX8B 2P42B 1FV1A 1PAMA 3CFJB 3TEXA 3TJHC 3UADA 3HI1B 2WLYA 3NIDB 1EZVX 4PJBB 5DMGD 2AEPH 5TDOB 3RUGA 4BWUA 3CZKA 4XMUA 5GGRA 4APXB 4ZG1A 2J44A 4R26L 1J3MA 4BRJA 5I2IB 1RUML 5CCGE 2ICCA 3SGDH 4EI5C 3TN0D 2HMIC 2VM9A 4UOJA 1EJOL 2EKSB 5KZCB 4O2CA 1BM3L 1R3HB 2H6UA 4RMVA 4N6RB 2YAMA 4RZCB 3AUWB 4UNUA 4YBLB 4Q9RL 3EF7A 1GCFA 4YDKL 1YNLL 2YEVB 3F01A 3GSUA 4MCYB 4WDIA 4OV5A 5PAZA 3DYPA 1YMME 5EWIL 4QXUH 5F1KC 1CFTB 4PRPE 3VFRA 1ZS8B 4Y9CA 3ECBB 4MLIA 4JJ5A 1OW0A 3MV01 1Q9OA 3FFCE 1CLYL 4M6ML 2CR0A 2WO3B 4HG4K 1XHHA 3HPLA 4L1TA 1ZRUA 3UP6A 1RCYA 4JQVA 4C55A 1MLCB 1OB0A 1F3DH 1T6WA 2C34A 1HCZA 1ZE3C 3V7MA 4WJG3 4Y4KB 1CU4H 1J05B 4ABUA 3QJZA 3UYRL 2QPFA 4XC1H 5FGBA 4V1DE 3UH8A 5C71A 4N2HA 1UOKA 1FZJB 4AG4L 3MRNB 4J39A 4UV4L 1AOZA 2VDOH 4PP1D 3IU4L 3B56A 4QJ5B 2YARA 4XPHH 4ENZA 1JZDC 4I0PB 2P5ED 3BW9B 3HAEA 3U7YL 1TQTA 1QEXA 4ZFGH 4UZGA 1KDIA 2IQAB 1K2YX 1MJUL 1GYVA 4G8GB 4JFWA 2V5SA 4RMBA 3RGBA 5EH1A 4NDMA 3TZVA 4WO4D 2EYRA 1YPZA 1SBSL 3EGSA 4YIQA 3P11L 1IAKB 4PTTB 1BQHB 1HE8A 1WZLA 3SHSA 2B9AA 2NSQA 5HHXH 4NC1C 2G3ZA 3LPWA 1JGDB 2DQHH 4PS8A 4APQD 1PW3A 3UAJC 1A7NL 3WBDA 2R4RH 3FQUA 4H8WL 1MF2H 2A74B 4GSDH 3M1BA 3V4VH 3L7FA 4ELKB 1T4WA 4L3ED 4UBDC 1Z5LB 3VRJB 2YPLA 1Z9OA 2JJTA 1TEGA 4FNLL 4HJGB 4JO3H 4L4TA 4D2NA 4H1LG 2K7QA 4N0FB 2C1PB 3MBED 1NGMA 3ARBD 1WV7T 3CZSA 3UTSD 1NWPA 3CSPA 4Z3JA 3DBXB 3L08A 2YD4A 4XNXH 4IKKA 1NCUA 3VXUD 2FATL 4NJAL 4X4XB 3L3HB 3TVMA 1ZE3H 4ZNEA 4JN2B 1W0YT 3U79A 1DVFD 4Y9EA 2QKIA 4Q14A 1A3QA 4M1CD 4Q0XH 4LLMA 2CKNA 4I88A 4X50A 1GC1C 1LO5A 3UEZA 1NAKL 1NBYA 2EE3A 4JM0A 1IU1A 5DMYA 3F12A 3O6ML 5ETUA 3V4LA 2ATAA 1RUKH 4IKIA 2R1XA 4NQUA 3CFNA 4RMWA 3VFMB 3OJVC 1RUPH 2AV1B 4YHYB 3MLUH 3LZOA 4XCCL 2WTOA 5DZ9A 5AB9A 4ZW5A 1JWSA 2NY2D 1KCVL 3O9WC 1E5ZA 2A6KA 3K6OA 1REIA 3LNIA 1BBDL 4AYID 1HXYB 1A1MB 3MOBH 2B8OT 1V5JA 3N41B 4JM2C 2FBOJ 4F7KA 1ZHBB 4HJTA 5CFAA 2EIZB 4HH9A 4F92B 2WINA 4MRQA 1ZVNA 3GXMA 3KHQA 4J6IA 2G3XA 4ZPTA 5DFVD 5EEWA 4JRYE 4M8QB 3PMGA 2W94A 1BZ9A 4Y8DC 1INEH 1FL6A 2I32A 2TSBA 4ISVB 4E5XA 3JV4A 3LZPA 2XXFA 4ZX4A 1JXJA 4YWGL 2X6UA 4MD4A 4P5KA 4EIZC 3HAEG 3SY0A 4UQDA 6FABH 1WS7A 5FDWB 1TVHA 2PWFA 3H3PL 1BF2A 3C60D 2KLSA 3MYJB 3ULVC 2Y4SA 2Z4QA 4J2XA 3B2PA 2NLJB 3T0XA 2J20A 4ONFH 4Z78B 1XEDA 3KM2A 5HI5C 5HHPA 2Y72A 3OC5A 3OKNA 5DUPH 4HW6A 5I8CB 4B9PA 1E7VA 1LP9A 3SJVD 1YPZE 4AVIA 2EHBD 2IH9A 4OKVB 4PPTA 3QUXA 3FSOA 3CFKB 5GRJH 4BJLA 4E9WA 1HE7A 2Y24A 2Y9RT 4UIKL 3N40P 3QUYD 5L2KD 3QZLA 3RYMA 3MZGB 2ILLA 2JJSC 5F9CA 1BBJB 4ANXA 1IGTA 3NFSL 5A7EA 1AI1L 5JPMA 4U33A 1PZ2A 1I3GH 1INDH 1WAPA 3HLAB 2ZWSA 4E9QA 3OMAB 4KFZC 4URKA 2YPLE 3NCXA 3EOAB 3I3DA 1TJIL 3PF2A 1M7XA 4NNXA 4BGDA 5MEPB 5DR5L 4BFBD 4HIEA 4PV8A 2V5RA 3RWHA 1LDPL 3W9EB 2K0RA 4XN5A 3BQUD 1BOGB 2P24A 2G3NA 3U2IA 4PRNB 4X6BA 3GZKA 1FO0A 2WN3A 3NJVA 4MKTA 1ET7A 1WWAX 3BAKA 4Y5XB 5IIEA 4H44C 2V33A 1BVKA 1BLNA 1ETA1 2D9QB 2WUBL 5E6ID 5MI0C 3N44B 2FX8H 3Q9QA 5IJDC 1GA2A 1DUZA 3NRFA 2FBJH 1KIRB 3O6FB 3QFDB 3ZW3A 1X9LA 3P2TA 5EN2B 5IBTH 4ZMOA 3KYKL 3UCRA 2GTZA 3FN0L 3PL6B 1Y1UA 2FD6H 4P59L 1AHWB 1UM5L 5I15L 4PI2A 1R1CA 1TZGH 5HDQH 3Q2CA 1LEGA 3ULUF 1OSZA 1X7QB 4QNPF 1RK0B 5DQDH 5HGAB 4X7EC 2MIZA 4QHMA 4QXTA 3AQYA 4R7DA 2VL4A 3L3DB 25C8H 1T2QL 3HG0A 1H5BB 1IC1A 1A6AB 3MOQA 1H3VA 4N68A 4ZSOE 2CCWA 5EMYA 1P4LB 1OSPH 3HW7A 3B83A 5MEQA 2R1WB 2QV2A 1GRWA 2W1NA 4POUB 3O3BA 4TUOA 4XPAH 3ILQD 4AV4A 4M61B 3RAJH 2GPZA 3P9WB 1WRFA 2OX5A 2WXFA 3WFZA 5BRZE 1CQKA 4LLWB 1NQBA 4IMLB 1E27B 5JZ7D 4FQCL 2X40A 4NUJB 1NCDH 1U4EA 4I7ZC 4KKNA 5EFIB 3S4SG 1HQ4B 1NOFA 3KD4A 4ZX5A 5HI3D 3QZOA 2V7NA 4KO5A 2BVTA 2B16A 4OLVH 2Y7NA 3SDDD 4CVXB 4GKLA 3ZBMA 1IC4L 4OZHA 4G1EA 1K6QL 2VQTA 3VAEA 4OVUA 1ES0A 1MCLA 3ZRSA 2Q6WA 1KLFB 5D1XD 2X5PA 3I02B 1JZ6A 3ZL2A 1ERNA 3H7BB 3PWVA 4OJCA 4K55A 1UWYA 4K9EL 4AI7A 1PKQA 3EJTA 3RGVC 1LP9E 2WLLB 3BO8B 3VFNA 4U6HB 5F7NC 2C9VA 2WXQA 3P0VH 1ASQA 1IB5A 1Y18A 3QNYB 4PRDA 2XWDA 3RG1C 4ODXB 3ZL1A 1FZKA 3S6CA 4ELMB 4JG9A 2Q7AA 4DKFH 2O6DA 3KAAA 3U82B 2NTSP 4QTHB 5F8QC 4KKAC 3WY4A 2X4NA 4WKZB 5ELIA 1I1YB 2HT4D 3HNVH 3LRGA 4YX2H 4KI5E 5BS0E 1A9BA 5EPCA 4PFEA 3WN5B 4H0LC 4XNMB 5DEFA 3VXMD 1FE8L 4NRXB 3GMPA 5BQDA 3IJSB 1C08A 2HH0H 4RAUB 5I30H 1FFQA 1RZFL 1SQMA 4NO3A 3VFPA 3M1CA 3FU5A 3VFUB 1KGYE 1MDTA 3PWLA 4P5TD 4XMLL 5EF3A 3B7YA 5A1AA 4JHBA 4HMEA 3CC5A 2A7BA 2GVYA 3MUZ1 5BUAA 1OAXL 3ZHKA 3ZZLA 1OCZB 5CEYA 2H9GA 1T83A 2W9EL 3CZNA 2JKSA 3FTYA 1H6UA 2WOYA 4GB9A 1PDKA 4WJKB 5DD3L 1DBBL 1EHAA 4HJ0C 4WWID 1JHKL 4A7SA 2C7UA 1CL7L 5DVKA 1FDLL 2VDRB 3EH2A 2V8QA 2GG1A 1KXQA 1QLEL 3DV4A 4QJ3B 1URZA 2IDSA 3LIUA 4NO2A 2HRPL 2UXVA 3PP4L 5DT1H 2B0SH 1KXVC 3NGBC 4CBZA 4LCCA 4X5XA 2ZNXA 1E6JH 1ZTMA 2UZIL 4YPJA 4CVZB 5FYJU 1MDAA 2XWCA 2BZDA 1ZHLA 1TZHB 4R5VA 3OZKA 3QORD 4HUWB 3MRQA 3WD5L 4CSPA 3C5SB 4JLRA 1EGJA 4JFDA 4JY4B 5GRUL 3UG4A 5JPNA 4NZUL 4PMFA 5CJ5A 3OPZL 1ZVHA 3IB4A 1NMAL 2VZSA 4EOWL 1KELH 1BAGA 3W9DA 2A0LD 2AANA 3Q2VA 2WC7A 4I0CC 5E7FA 3TCTA 3LY6A 4OZHE 3EO9L 4P2OB 5EF2A 3SO3B 1ZVYA 1E8YA 4OIIL 1QR1B 3RZCA 3RX8A 2HYMA 1AO7D 2I7SA 2C9RA 1P6FA 3CFDA 4GAGH 4UCFA 1JNLL 2DY2A 4J27A 2XETA 5CEXB 1P4IH 3OAUL 5EN3A 4XVJH 1AZNA 1UUNA 4RWYH 1V5SA 3GBDA 4FEMA 3O8XC 3GKWH 5CN2A 2J3SA 1AR2A 2F5BL 3R06A 3RWEA 1MW0A 4HZAA 1SDAB 4AM0A 4DPRA 2BVQA 5F0LB 2P8PB 4OM0H 1BD2B 3H7LA 3MRHA 2G0LA 4RGMC 3HFML 5CR8A 4J3TA 3V0EA 2OM5A 1CZ8L 4IBQA 3PY9A 3R7RA 5IMKB 1I1FB 1MLBB 5CO1A 3V4PA 2NZ9D 1Z3RA 1FZMB 2BHYA 1AR1C 1ROCA 3QIWA 3FHQA 3T2LA 1WHPA 4UM9A 5DRWB 1AYRA 5IW1B 1D6VL 4XNAA 4GO8A 4B53A 1DBMH 2R1YA 2W60B 5DD1H 2G5BB 1IMHC 3EH5B 5E2WL 2G9HA 1ZANH 4D9QD 1JDDA 5EIIA 2CBTA 3BVTA 2G75B 4BHUA 3WAJA 3OH9A 2J2ZA 4XP5H 5LHDA 3FONA 1WWWX 2E86A 3LZRA 5CUSL 4I3SH 3ARDD 1U6AL 3KLSA 4H25B 5F0PB 5IMLB 5TQ0L 2FX9L 2ZYIA 3O3DB 1QKZL 3CVHH 3P69A 2AMUA 4NZTL 3KPNA 5T3ZH 1IKOP 5BRPA 1FQ9C 5HD8D 4L4VB 3D85B 5F8RC 5LNDA 5T1KB 4J8RB 3VRLF 1KXQE 4KY2A 2VXSH 4JVUA 5I23A 1OAUL 3V9CA 2BSTB 2G5RA 2JIXD 3IF1B 1V55B 3PREA 1BMGA 4KRPB 2YEZA 5DLMH 2YUZA 4P9HL 3BFOA 1T4KA 3PWJB 4NKDA 4W4OA 5E4OA 4UTAH 1QO3B 3QQ4B 1O7SA 2O61B 1OCWL 3X1EA 4GBXD 4LARH 2J8OA 4YHKL 3S34H 5HJ3B 5EZOH 5I19H 4NQDA 4DKTA 1D5RA 4U4IA 1IKFL 1SOXA 1QUNB 3OSVA 1OE3A 4AV5A 2BFVL 3BYTA 2O6PA 5D7IF 4RAHA 1L0PA 3L3KA 3C5ZB 4JFDE 1Q1JL 3TN0B 1J9SA 1R3LB 2AVGA 4ONOA 4Z7QB 4ZMXA 1FFRA 4OIAA 3NIGF 3FC8A 2WW8A 3R4DA 2A6JB 5CD3B 3G5YA 3ZE1B 4E0RB 3GB7B 4WW2A 3U7AA 3LV3A 4KHTH 1C5CH 1MAKA 1U41A 2HX7A 2NCMA 1UOLA 5DK2A 3LDBC 2R8SL 4N5UA 2WZ5A 1ID2A 1NMBL 1U3NA 3BAJA 5GRVL 4Z8FH 3T2QA 5C09A 1WC7B 2DWTA 5LGHL 4XZUA 4GEJA 3T2OA 3QEQD 1G1OA 3PWPA 3SKOB 2H8PA 3ZE1F 4KZ0A 4AIZA 5LB1A 4RMSA 4M43L 3ZKND 2ZSWB 2FUVA 1ACYL 5A16B 4LHJB 1J1OH 3MNMA 3W5MA 2X4TA 1I7TB 3WUWA 4JDTL 3OKDA 3PHQA 3BPNC 2ZWKA 4NOBA 3B9KD 2AF2A 4FTVD 2QQNH 2BRRL 3MCLL 3D2UA 4H0GA 4K94H 4XXDA 3K6DA 3RX5A 4IIQA 5JA8B 3SDXF 1UXMA 2E74C 4LL9A 5GIRB 4FQIL 4W9IC 1TZIB 2QADD 3S3CB 4L37B 5GGTH 2QLYA 1J1XL 2WPGA 2HL8A 1XIWC 4J1UA 5C0RL 2WNWA 4ZBJA 2VO8A 4NQSA 5KSBF 4FA8A 3IJYB 4F37F 5GGQH 3BVUA 1YEFL 3GGWB 3BDYL 3ZKSD 2QDVA 5B39A 3LB6D 4L3CB 4ROCB 4U7SA 1VEOA 2VLMD 5I8EA 3KXFE 4KK9C 1F42A 1MCSA 1PLAA 3RVWD 4TSCL 4OY9A 4U1HB 2P28B 2IALB 1QSFB 4H0IA 1QN6A 5CP3A 2NOZA 3BH8A 4MFHA 2Q7YB 1BYOA 2GHWB 3IETB 1WFMA 4LLQA 1F4WL 2FJGB 3FTVA 4PW9A 5CZRA 4APQB 1MWOA 1P5DX 1AZBA 1DQML 3I9PA 4K8RD 3NRQA 3AMLA 3OQRA 1FL5A 2YPKB 4Z3FA 5LKNA 3EYVB 3V0WH 2VLKA 4NKMA 1U8PA 2F18A 4DZBA 1DDTA 3OX8A 3L5HA 3GS7A 4F15B 3CFJA 5EV7A 2FHBA 4HFUH 5B3SB 3ARBB 3HI1A 3UTSB 1R33A 4UT9A 4PJBA 4K7PL 4MAZA 5H4YA 2NY3D 1K3ZA 5TDOA 4AK1A 2G9KA 2EDDA 3VXUB 1G6RB 4APXA 5E1QA 1JGEB 1TEYA 3LSOB 4OJEH 1QW8A 2Z9TA 5I2IA 4PM1A 2DWEB 5KSAD 3IDYC 3UC2A 3MRPB 1SF5A 4NQDE 1ZEAH 3IGUA 3T04D 3U25A 5EU6E 4Z3HA 4GAYB 2XN0A 2BK8A 2EKSA 3FK3A 4EE2A 1JYNA 1R3HA 4O5LL 2XXCB 4N6RA 4RZCA 1QFWL 1MVYA 4ENEC 5I8KH 3ESNA 2ZCKL 4EI0A 1CFTA 4JHAH 1JD7A 1ZS8A 3AQDA 3ECBA 4GUCA 1QYGL 5LG6A 1NFDB 1MW1A 4K5OA 4LSPH 1QACA 1SY6L 2Y2TA 2QGBA 2Q87A 3ZL4H 5IOKA 5A6MA 1UZ6F 5K9KB 1MLCA 4UT7L 1I9JH 5AVRB 4Y4KA 1J05A 3GI8L 2O5XL 3FB8A 5DD5L 3Q05A 4JPIB 1YYCA 1CS6A 1VPOH 3UPAA 4E9RA 3QYMA 4BEIA 1NFDF 4HJ1A 1FZJA 4WEUD 1Z3GH 2PUQT 1B90A 1CD9B 1ZV5A 4I4WB 4O2FB 4DF9A 3DPUA 1GKOA 4LLUB 2JKLA 1CE1L 3O81A 2WTRB 2DH3A 3LQAH 4GYBA 3TT3L 2ICWJ 5CBEA 4AMWA 4I0PA 1ZIAA 3BW9A 3ZTNH 1YEHL 3U0TB 2WXMA 1OQXA 3RPKA 4Y9BA 3IFNL 5C0AD 3BCDA 3OXSB 4G8GA 1WS8A 4AEFA 4OFQA 2IXQB 4YSSA 3BAYA 3NDYE 3C60B 1R9FA 2WNXA 1WLHA 2ZKYA 1AHMA 1YQRA 3MJWA 3T4AC 4YGVB 1RIUL 4LEBA 2ZF8A 4EKXA 4I77H 5E03A 5A2JH 1TO5A 2E3VA 1IAKA 4PTTA 1BQHA 2XYBA 4JDZB 2A73B 2PW2B 4XB3A 4DN3L 3G3LA 4NYLB 3CLFH 4YR6B 1JGDA 1AKJA 1TCRB 3F7LA 4OTXH 4MA8L 2NY4C 3KGTA 3SD2A 4JFED 4KMLB 3GBML 2A74A 3LXCA 4R84A 2Y5QA 2AJXH 4N2BA 4ELKA 4F1ZA 5CEZE 1CJYA 1Z5LA 3VRJA 5IGXH 3TURA 3O45B 4LCYB 1UYWH 2K9UA 3Q2NA 4HJGA 5EZLB 4N0FA 2C1PA 1IFHL 2YKLL 3ERXA 1NCWH 1KTBA 5J3HC 1KTLB 1A3LL 2VLKE 3DBXA 1BX2B 2PO6C 4KJWC 2Z0UA 3CFIC 4DGIH 3VUAA 2R2BB 1ZLSL 4TLTA 2WTPA 3C8KB 3PAYA 1GY2A 4X4XA 3L3HA 5ALCL 1JFIC 4JN2A 1TVBB 5HYJD 2F7OA 4PJBE 3BQUB 5IROA 2GJZB 4M8RA 3FPYA 2IANE 3K6SA 2Z3FA 3ZKXB 3A6BL 5C6TH 4AGPA 5H37A 1MFEL 4TVPE 5T5NF 1IC5L 1C16B 4Z7UA 1B2WH 5E6IB 3VFMA 4O02H 4G7VH 4MX7B 5IFAL 3Q7JA 2XWTB 3I3BA 2AV1A 3ZRCC 2NQDA 3HZVB 2Z92B 1HCFX 3NCJL 1QBLH 5DEGB 3VFSB 2N0KA 1HXYA 3FXIC 1JGVH 4IRJB 3QK0A 3L4VA 3JBG7 4GW4B 1OW0C 1A1MA 4GO6B 2J88L 1OZUA 4HUKB 4NPYB 2Y22A 3BZ4B 1ZHBA 4JQVC 2BIIA 2DDQH 2EIZA 2AAAA 1NAMH 3FBQA 5EOQH 2EILB 4HVBA 3LXUX 2EDJA 5AB1A 4EDWL 3F0ZA 1MUJB 4NZRH 4M8QA 5FGBC 3FRPG 4ISVA 5T1JA 4FERA 5DLLA 1ZS2A 3GHBL 3TBTB 3R19A 3TH2T 2YA2A 2LV4A 3GBNH 3QUML 3A4DA 3HBGA 3TU6A 4UV7L 3KPLB 2MTAA 5CKGA 1D7CA 3RIKA 5FDWA 4PJCF 2QV4A 3MYJA 2B3IA 1E9OB 2VDNH 2DI8A 2NLJA 2OMNA 2JQZA 1D5IL 1AJ7L 4HOXA 4Z78A 4PJXB 3KPRD 4G8GE 2NT0A 4NQVB 3WS6A 4FL4B 3GF8A 1I1AD 2OL3B 1OPOA 3TZVC 2LHAA 4HPYL 3NVQA 5I8CA 4K8RL 1PY9A 2IO5A 3PGCB 4Y19D 5D1XB 2WSKA 1BQHG 4GINA 2ZXWB 3CFKA 1FLRL 3CFUA 3TF7C 4KKRA 3ZDZF 1OOAA 3BAEL 5D96B 1BBJA 2Q10A 3CQPA 3HC3H 3RP1A 5DC9B 5D72L 4HT1L 1H6EA 1HDMA 2YAEA 3HLAA 3DIVA 2E47A 3H2WA 2JJTC 3EOAA 1Z0MA 4CDGC 4UQCA 4PLJD 1UURA 3NA9H 4MNQB 5MEPA 4XPFL 3EBIA 1X4YA 4TULL 4EF3A 3W9EA 1NCNA 4OCSH 4NXSA 4KXBA 1BOGA 2BP0B 3VXMB 4PRNA 3DX2A 3MRFB 1ZT1B 3TVMC 2HKFL 3KPSE 2V17L 4MB5A 4Y5XA 2QKIC 3GUTA 5FCUH 1YEGH 1KJMB 2DTSA 3KVQA 4K23L 2CSPA 4P5TB 4FCHA 9PCYA 1ET5A 2X2HA 3E38A 1KIRA 3O6FA 3QFDA 2IPUK 4Y1TA 1TPXB 1A25A 2XQBL 4OCXL 5EN2A 2AS5M 4HJHA 1JPFB 1LTXA 4DHLA 2EC9U 4E68A 3T6XA 1OCRB 4DEPB 3KYNB 2RHEA 3PL6A 1MFCH 1KC5L 1JCKA 2J5LB 4X9BA 1CGTA 1NGYB 4XHJC 3WLBB 2RB8A 3JZYA 1AHWA 4QRPD 4YXLL 4XCYB 3C04A 3A47A 2Y3NA 3MXWL 43CAB 3TH4T 1X7QA 1RK0A 3S2AA 4MZ3A 4WTQA 5HGAA 3U46B 5JOPE 4QY8B 5KBMA 1YQVL 4XOEA 3L3DA 3LKRB 3L5XH 1H5BA 4TTDD 1A6AA 2VQ1B 5FW8A 3FQXB 1OK0A 1O9WA 3LXBA 1P4LA 2PYEE 3MKGA 5AVXB 4EUPH 5FC9A 4OCWL 3G5VB 2R1WA 1WCBB 5JQ6H 3TF4A 3ENOC 3OWEA 4YGAB 4M61A 4EN3D 5L88L 1RU9L 3CQFA 4LLWA 2BIMA 2EACA 4IMLA 1E27A 1G7QB 3MQIA 3P9LB 1T6AA 4NUJA 1IX2A 3NDZE 2CGYA 2A9CA 2NX5D 5EFIA 1HQ4A 1MJ8L 3S35X 1VCAA 3WCYA 3D48R 2X89D 3QDGD 2Y06H 2R0WL 3NABL 4J3OF 4OFYD 4CVXA 4U6YB 5GS2D 5I8OL 3CK0L 3QI9B 3BIAX 2HAZA 3FF7A 3VTAA 1VLXA 2WJ7A 4QHKJ 3MGTB 3KWVA 4K2UL 1KB9K 1KLFA 2CRZA 2AI0H 2YUWA 4MB4A 4TVPL 2X0WA 2FSDA 3CFMA 4PGDB 3QNFA 3H7BA 4MQSB 5FXCH 4F7EB 5TE6L 2XY2A 2WLLA 3BO8A 3FCUB 3K1DA 4OBSA 1ZK5A 4HIXL 2XKNB 3QUXC 1G94A 1EUVA 4DGYH 1AO7B 1A6TB 3QNYA 2H6OA 1SYVA 4N5EC 3M07A 4ELMA 3GWJA 3WO4C 1FRGH 5JHDA 2NX5E 3DPBB 5E2VL 5I71B 1N3AA 4QTHA 3ULUD 5HDBB 1TTAA 1OAZL 5JPMC 3CN4A 4WKZA 1I1YA 4KI5C 4X4YB 4R4FH 4KZDH 1GOHA 4HD5A 1ICTA 1FN4B 3N89A 3WN5A 2HP4A 1XD1A 3GBEA 3Q6GH 1XQ4A 4LVNC 1J11A 4NRXA 4UOW1 4XNMA 4D3CH 5KS9B 3K1KC 3OD3A 1T1XB 4U0QB 4RAUA 3B9VA 1A47A 4YDJB 3NSDA 5E2UH 5HDBF 5DURB 1S5HA 3GT6A 3OWRA 3VFUA 1LK3L 3CSTA 2FDBP 3GRWA 3F7PC 3GI9H 5CJOL 3GSRB 5TF1H 1R3IH 5C9KA 4JZJB 4RFOH 3EDEA 2XV0A 4ZFOL 2HZMA 2BXYA 4N2LA 3ULUE 1KFGA 43C9B 4QNPE 1W0VB 3BPLB 4MAUL 4MZ2A 4DW2H 2CBMA 3T8VA 3RU8H 1UJTA 4UNVA 1EA9C 2VDPB 2ZOLB 3ARDB 4LSDA 4ZW6A 5D4IA 1X7TA 2GAZB 1R46A 4HKBB 1DBKL 1J9QA 5HGBB 2D7OA 4FGMA 5E7BA 3P0GB 2WXGA 4R97C 4G6ML 5KANG 2QHLA 4CVZA 3E3QE 3IDUA 3DOSB 4LCIL 2H1PL 4ZO9A 4YDIH 1URIA 1ACXA 1TZHA 2AW2A 4V2BA 4ZOCA 4HUWA 4GBXB 5FKAA 3C5SA 4G2AA 1NBVH 5FPIA 2XKSA 4K15A 2RTTA 3QDME 1LVEA 2BNQD 2Z7WA 4WIQA 5A2FA 3CSFA 4YS4A 2OBGA 3WFEH 4FF9A 3SE8L 4GAFB 3TC9A 1P53A 4P2OA 1E4WH 4MRCA 1QR1A 2F8VA 3T6VA 2IAMB 2KQNA 2Z31D 1GS8A 1K8IB 1NCCL 1PCXA 2YAPA 3D5OF 3IXTB 1DVZA 4N0CD 4XVUD 4H13C 3UACA 4OLZL 5I6MA 1EERB 2ZUTA 2YWZA 2EVGA 4K5LA 3TYGH 5CEXA 1MRDH 4HZ1A 4A67A 3AFLA 1H3WM 4HBCH 4LXFA 3KJ6L 2P47B 5DXWA 4U1NB 2IBZX 3QEGH 5D7SH 2AHIA 4ELME 2P8PA 1MAMH 1BD2A 3P2BA 4WENB 5KG9B 3CCHB 2YGVA 1J5DA 3BSHA 3R1GH 4POYA 2XRAH 5AOKA 5IMKA 4N90E 1I1FA 2FECL 5FECA 2ERJB 1MLBA 3CG8A 3OHXC 4O9HL 1VRSA 5DHMC 3QUZD 4M7ZC 1EDHA 1INQB 1FZMA 3B9KB 1IBDA 4J4PA 1CIUA 4F8OA 4FTVB 2DRUA 3HZKB 3G6DH 5AZ2L 5GS1C 5IW1A 2VZ3A 1DN2A 3BSZL 3CU1A 2QADB 3HLKA 2W60A 1OAQH 1EUUA 3BD4A 4F7TB 2G5BA 4Q52A 3VXSA 4YJZL 4QHPA 2NPLX 5LCVA 1HINL 1WF5A 1TQWA 1FGNL 1HNGA 4D7PA 1JTPA 3EF4A 4PJ6A 3LKPB 3OAZH 2R2CA 5MHSD 2G75A 2BVPB 2WXOA 4OCYL 1ND0B 1U95B 4L8CB 3D6GA 2FWOB 3MLTB 4ODHL 3KJ4B 5TTRA 4KQ3H 4YDNA 1T83C 3CIQA 1Y6NR 3DGDA 4HIPA 4H25A 2YSTA 5IMLA 1CTMA 1Y07A 4NEHB 3OZ9H 4WRLA 2XZZA 3O3DA 1A4AA 1YEJL 4EQ2A 1XGUB 4NUGL 5E95B 3TASA 5ID0B 3DMMD 4Y7OC 4L4VA 3D85A 1RJLB 5T1KA 4UTBH 2W9LA 2AKRB 4JRLA 5L0QC 2BSTA 3CX2A 2HUHA 4IBTA 3IF1A 4S1SH 1F90L 5FOBB 3LNGA 4K0OA 4LCCC 1QO3A 3QQ4A 2Y69B 2O61A 3A67L 1WP6A 4PB0H 2OFQA 5HJ3A 4YSQA 2NY3B 3QJOA 1QUNA 1BG9A 1T7WA 3O4OB 3WFDH 3APDA 1TJHH 4CC1A 1I4FB 3HN8A 3C5ZA 5DO2C 4XAKE 5KVEE 4QR7A 3GIVB 2I5WA 5JPNC 3TN0A 3I75B 2FQFA 1R3LA 2ADYA 3LZQA 2EE9A 2V2WB 3U30C 3V5KB 2ED7A 5EC1B 3VG9B 4DGVL 1MCNA 3IFLL 5CD3A 2A6JA 1GYAA 4E0RA 1N5YH 4BFJA 1JYVA 3ULUL 2OW6A 3BKYL 3ELQA 1PZSA 2WY3B 4NNPL 5C3TA 3RZCC 1JNNH 3G7TA 3SIKA 1WC7A 4OZFG 3D25B 4JZNB 1QZNA 3FT1A 1MCFA 3RQ3A 1CI5A 4JKPH 1I7RB 4TL5A 4RNRB 5EUOB 1DCEA 5DMIH 1QN9A 5E6RB 4X5WB 2DN7A 2ZSWA 5GZND 5A16A 2Z91B 4UZSA 5E1IA 2FO4B 1I7TA 1Z7JA 5JO5B 3DTDA 1BD2E 2Y1ZA 4BYHA 1UL7A 3BGFC 3HN5A 1JS4A 2MCG1 2NMSA 3DJ9A 1MH5A 5DD0H 1J86A 2Z7ZA 3NZUA 4DK5A 4NUQA 4OD1L 4QRTB 3G5ZA 2D2OA 5GIRA 1GH7A 1TZIA 4L37A 2SEBB 3QIWC 1JZ2A 5IQLA 4XPTH 3WNLA 2PR4H 2ZKXA 2P5EA 1E3FA 3JV6B 5AW5B 5HYSG 2VCOA 3UTTB 2ISDA 1EFQA 3IJYA 3PS6A 3TV3H 3GGWA 5C0AB 3V4UH 5IBUG 4L3CA 4IEFA 1U58B 2HFFB 2BO0A 2LFGA 1UFGA 1LO0H 2CHNA 3H9YA 4C8XA 3ALPA 2WHVA 2WLKA 5IT2L 4U1HA 4DP1X 3PJSB 2H2SC 1OP3H 3IGLA 2IALA 3UO1L 1MFBH 4GNKB 3GO1H 4JL1A 1FWXA 1FBIH 3B5TA 4EDXB 4E9LA 2R2EA 3BKQX 2Q7YA 3IETA 3NZ8B 2FJGA 4APQA 3PHAA 3NH7H 2YFNA 3MTRA 5EZIL 3NJFA 2WCPA 2YPKA 4JFEB 5H35B 1I1RA 3EYVA 2FKMX 2EDOA 4L4VE 1QWNA 4QYOB 5G2NA 3WGVB 4AOFA 2WXHA 4B5EA 2BVEA 3W1ZA 3ARBA 2NUPB 3UTSA 4ZQKB 3S9DB 2DKUA 2XJLA 2PLTA 2X38A 3ATFA 4GW5A 5HY9B 4B96A 1TTUA 3VXUA 1G6RA 2MQ3A 4J3WA 3LSOA 1CFVL 4Q8BA 1JGIA 1KYFA 1DVFA 2DWEA 3K46A 3NIGE 3THML 3MRPA 2HSIA 3MXVL 4UAHA 1YJDC 2R29H 4AV0A 4BE5A 1JE6A 3PHSA 4GAYA 3GHEL 5DYFA 4X8CA 1CDCA 1UA6L 5DHYB 3EFFB 2DM4A 3NEEA 3ALXA 4Z7QE 3OF6D 4X9FA 3HUJB 3LRMA 4JFFE 5DDHB 4FFYA 1A9EB 4XNYL 3ZE1E 4Z3GA 3GXUB 4WW2C 5JXED 1S9VB 3RDTD 4J6RL 2HJKA 1UM4L 4HHAB 3RI5K 1RIVL 1CF8H 3MV7D 2YC1B 3HG1D 1KPVA 5K9KA 3B4NA 3SGDI 2E9JA 1NDGB 4HEPG 4M29A 1JV2B 2GSGB 4LGRB 5E1HB 3HUJF 4MNHB 4NP9A 3PGFH 2CH8A 2PF6A 4JPIA 4A2LA 4AWJC 3CX5J 1AC6A 3HG5A 1CDHA 1JVKA 4OF7A 4WW1A 4O2FA 4KH2A 4JMXA 4I4WA 1RZJC 4JHWL 4LLUA 3B7RL 4ALAL 2OSYA 5KSBE 2WTRA 3GLZA 4EIUA 5C0EB 5I5JA 1GVIA 1PEWA 1YEDB 3QCVH 4RGOL 2ID5A 4IIQC 4N86A 5TF0A 3TO2B 2GYSA 4HUVB 3U0TA 3D52A 4IW4C 4HUNB 1QEWB 3OXSA 1M3QA 4GQ9L 1PQZA 1YO4A 2IXQA 3VNYA 3C60A 1LNUB 4AYFB 1A5FL 1FHGA 4Y5VB 4LEOA 5FIEA 4BQ8A 5KVEL 4YGVA 4BCZA 1IC7L 3FQ4A 2Y2WA 3FUMA 1N0LB 2XWBB 1HWHB 4NKOB 4JDZA 2A73A 2PW2A 4NYLA 4YR6A 1TCRA 5KTEH 3W11C 4Y19B 4D9RE 1QSFE 2ODIA 1T6BX 2GQHA 4FZ8L 5F7LB 4PY8J 2OCCB 1PD1A 2XWJB 3CN0A 4KTDH 3UJJL 4KUZL 4LVOC 3O45A 4LCYA 4LIQL 5EZLA 5TK4A 4BFNA 4G42B 3ZT6A 1IGIH 3MR9B 2OZ4A 2XUWA 5CILH 1KTLA 2G2PA 1BX2A 3DROB 3INUL 2XWXA 1B0IA 3C8KA 5CSBA 4P46D 1M42A 5BO1L 3TJPA 1TVBA 3T3PB 2AEPL 3CX5K 1KDJA 3MZTA 3BQUA 1EZVY 2GJZA 4JPVH 4YVNA 5F96L 5FYJH 3U9UB 2WYHA 3EADA 4EBQL 5J1SC 4I8OA 4G82A 4JFQB 3SDCD 4XI5C 4FLOA 3RTQB 5IM7B 2Y7OA 1MCPL 1JNHB 2PTVA 1C16A 1UD2A 5E6IA 2ENJA 1TLKA 1HOCB 4MX7A 1QPPA 1QLRB 2JVUA 3HZVA 1GJUA 1FCCA 5IHZB 1UZ6E 2Z92A 4IRZA 4KKZA 2GY5A 5DEGA 3VFSA 1OTTD 2EYSB 3RVTD 1LQSR 1IT9H 1NGQH 4IRJA 3CBRA 5E8EB 4QRPB 2R2HB 4OZ4B 1VACB 4GW4A 4PJ7F 2ADFL 4PRHE 5L9DL 2UVEA 1NFDE 3DIFB 3M6DA 5HPMB 2HKHL 4U1LB 2NR6A 4NPYA 3BZ4A 3VD7A 3LZFH 3MACH 1QLFB 3PPSA 1P7QB 1IM9D 1MPAL 1OAKH 1TMQA 4Y4KC 1HL9A 3GFUA 1MUJA 3UABA 3FU7B 1HHGB 4W9CC 3U83A 1LO4H 4CRPA 3DVNB 4ZUTB 1UJ3B 1KJ2L 1JPGB 5E99L 3TBTA 4PLNC 2C3VB 3O0RL 4N8PA 4DGUA 2VDOL 5D4QA 5C0BB 4AQ8C 1I3VA 1Q1PA 3KPLA 4I0PC 2F5AH 4TQPA 2HB0A 4ZFGL 4BFFA 1MWAB 5E08L 3X13B 2GJPA 1E9OA 2JKRM 3K4ZA 1KB5B 2BSCA 3INOA 4QI3A 4MA3B 3FUKA 4PJXA 1YN7B 4XNZC 4NQVA 4MGXA 5E1AB 3M7OA 4X80H 5MENE 5I6LA 1ED3B 2OL3A 2XC8A 3II3A 3O11B 2D7MA 3HMXA 4IHOB 4GXVH 4UOW0 1OM3H 2ITCB 1E6OH 5BUGA 3PGCA 5IESH 2L4OA 4R4ND 2MH4A 5D1XA 1KIUB 3KEDA 5HHXL 3QQNA 3VI3F 3VWKD 1VOLB 4FS0A 5DFAA 5HHVL 3QXWA 1N4XH 1FNAA 1M1XB 3NZHH 3UC0H 2K8MA 4EVNB 3D06A 4DK6A 4QCIB 4Y16B 5J7CC 1DL7H 1RPQA 3QQ9D 4GSDL 4PJIF 4XPBL 4H40A 5LAXB 3DHJA 3V4VL 2A74C 3VGBA 2WLZA 2VJXA 1LDSA 4JQXA 1A14H 2X87A 5CCJA 4MNQA 2WD0A 2QSCH 3NCMA 4PJAF 2YD3A 3JQOB 3WI9A 3IN0A 1KCSL 4F9PC 5T5NG 1ULVA 2BP0A 4H5SB 4N9GB 3VXMA 5K9JH 3MRFA 2VL5B 4TSBL 1ZT1A 4ZZFA 2A4CA 4M5YL 1RZ8B 1BAWA 4XVTH 4JY5H 5JHLA 1QRNE 3G6JB 1DLHB 4P4KD 4Q0XL 2R39A 1BVOA 1KJMA 2MEJB 4KK5C 1S7VA 5EO9B 2AEOA 4P5TA 3KE0A 3VE0B 3EYOB 3NJJA 1WA1X 2YA1A 2GI0A 4IU2B 2DQEH 1VDGA 1JPFA 3ARED 3QQDB 5ICZB 4L8DA 3FNKA 1OE1A 2KZBA 1X6LA 3MLUL 3KYNA 1EV2E 3Q2WA 1BAFL 4B41A 3G6JF 1U92B 4YHYC 1NGYA 3O6LL 3WLBA 4F27A 1ORQB 5HSFA 3ECWA 4XCYA 2LLNA 1O9ZA 1PU0A 4B9ZA 43CAA 2XV3A 3NSXA 2PPEA 2IWFA 5F1IB 1R5VB 3U46A 4Q89A 3F7YB 4QY8A 2R0ZH 2IV9A 3LH2L 2IMNA 3S2CA 3LKRA 3GJFH 3MROB 2E27L 2ADIB 4TTGA 4PRBB 2VQ1A 3GSVB 3FQXA 1H3PL 4R5XA 2Z8WC 2QQLH 5FFLA 1NEZG 3F83A 5SX4H 1NCAH 1WFTA 4Q74A 1OLLA 4ODWB 4KX9A 3G5VA 4J3XA 5KSUB 1WCBA 4PJCE 3FAXA 3D4VA 1N26A 2AV7B 2B1AH 2ZYHA 1HWWA 5CIPH 1BYNA 4OF5A 4XBPB 1S5IH 4BZ1H 4UT6A 1G7QA 2YFOA 2YD1A 3P9LA 1PFCA 1DDHB 4AC4A 5DJXA 4UANA 1R3KA 3FB6B 2FSEB 1AQKH 6FABL 2A83B 5AWNL 3WNMA 3C9NB 4HH8A 4WHDA 3VTTA 5A2CA 4LL1A 2HG0A 3S35H 1LM8V 3JWNC 4U6YA 3U7WH 3QI9A 4ONFL 3ZDZE 4ZX6A 2BNQB 4PJXE 1Q94B 5DUPL 3WS6C 3DDGA 3X3FL 1XXDC 4OGXL 4PGDA 5D7LD 5FDYA 3K8MA 4X6DF 1SVCP 4F7EA 2ZYSA 4XMVA 4LCWB 4AMXA 5B38B 3P0YH 2Z31B 2XKNA 3FHEA 1AO7A 1A6TA 3KLQA 1ZLEA 3L1OH 1WEJH 5IHUH 1CXHA 1UWEL 5FWQA 3CN1A 3DTXB 3W2DL 4P57B 3DPBA 4FXGB 4PG9B 1UH4A 3D39D 5CU5A 5KVFH 2C3XA 1FFOB 2R0LH 1KCUH 4J3UA 1OT2A 3NP4A 4ZS7L 3CJJA 1FN4A 3FN3A 4X4ZA 3M17B 3PUCA 5JLZB 1BF8A 2VO5A 3I84A 4TKWA 5KS9A 4OSUH 1XH2A 2FJUB 1C1EH 4MNQE 1BFVH 1T1XA 2FEJA 3M8OL 3HZYB 1KGIA 4XMZA 4NGHL 4YDJA 2LR4A 3V6BR 3QPQC 3BRGC 3RHWF 1NFKA 3CAFA 2RCSH 4LP4A 1E2WA 4BQ6A 4ECNA 4WFGE 4Y5XC 3LMJL 5GJSH 4LKXB 3GSRA 3Q8AA 4BFIB 3MV9D 2Q8AH 2KT6A 1A64A 4JZJA 4WU5B 1RMFH 1CBVH 3GSNH 3FUHA 4L9DA 4YPGB 1A6VH 1T0PB 3O6FC 43C9A 1AG6A 4XPGL 3OSTA 4G5ZH 1DLFH 3MI6A 5HYFA 1KBBA 2N0MA 1DFBL 3D18B 2FD6L 3PL6C 1CI3M 4D8PA 1AHWC 2YD9A 5HDQL 2GKIA 3GD1C 4HD9A 3BUBA 3ARDA 2ZOLA 4ZFZB 1QPXA 5DQDL 4HCRA 3T6WA 1MCBA 5SWZD 3EUUA 2GAZA 4JG0H 1RAMA 2A77H 1Q0YH 5L8JB 4HKBA 3JTSB 2P49B 4XN1A 3BLPX 5HGBA 1QR4A 2HLAB 1H5BC 4KOCA 1AGEA 3DMMB 3QBTB 5F7FA 3LPGA 3LTVA 2MNUA 4PB9H 2VR8A 1P7KB 2LLLA 3EHBB 4J3OG 3WFBL 3APNA 4LSUH 4XPAL 3DOSA 1RURH 3IDJB 3RAJL 5T3ZD 1AKPA 2UZPA 1IARB 3O0LA 5ECGA 4U1MB 4GBXA 1I8IB 2DW5A 3D4YA 3OL2A 5LDUA 3P4LA 2OCFD 3BN9D 1HOEA 3QDJE 1MCOH 5L2JB 2WZAA 4EI5B 5ESVA 1P69B 4LSVH 2FZ3B 3ESUF 4TXVB 4D9LH 1YTFA 1JCVA 2CKBB 4N3UA 2E5EA 5F1SA 3WTWA 1JZ4A 5DK3A 2IAMA 1LWHA 4WFED 3C2AH 1K8IA 2NNAB 4FQQB 4FJ6A 5JR1H 3HZ3A 1HC1A 3PLYA 3FT4B 5DVMA 4HZLB 3WSQH 4EIGB 4Z3IA 3RKDC 3WNJA 3GXTA 1MRFL 5F97E 2JB6B 1Y1DA 4LHUB 4U1NA 5J12B 4EKJA 2XG4B 5HTSA 4XTRD 1JYXA 5IMOB 5FO8B 5KG9A 2W92A 3CCHA 2V2TA 3OSMA 4YX2L 5HDBE 4WSKA 4WI8A 4M4PA 2X44D 1MW2A 1MFVA 2VMJA 2BS9A 1T1ZB 3L48A 1TZOA 3L9YA 5D1QE 3SKJH 3MLYL 1NGPL 2AZAA 1NFIB 1INQA 3B9KA 3J8F7 4ABVA 4BCYA 5KS9E 1BFOB 4QRBA 3IJ8A 4FTVA 3HZKA 4PHZA 1E43A 1NLBL 4ODVH 4OAWB 3C6EA 3LNFA 5EULV 4QIRA 5KYXB 1E50A 4F7TA 2MPAL 1XB3A 5F6HI 1WIPA 1LWWA 3OAZK 3HZMB 1WAEA 5FFOA 1AGFB 1FVCB 1KJ3H 3JWDH 1IAIH 3LKPA 4KK6C 1BZ7B 3AACA 2BVPA 4FULA 3AWGA 4ZMLA 1ND0A 1RFDL 1JRHH 1U95A 3U4BH 4L8CA 2W81C 3CLEL 2DL9A 3ZTJH 5E00B 2FWOA 3MLTA 4MA7H 2TSAA 1YHPA 3HNSL 3DV6B 3C5JB 4K5MA 1I1CA 3L5WB 1ZT7B 2P43B 4DP7X 4E9TA 2AK1H 1OY3B 4WGWB 2YR3A 1JN6B 1OD9A 5C3LD 1F5WA 5LBSL 4NN6B 4FQ2L 2VITB 1XGUA 2QVKA 5ID0A 5LNGA 2GJRA 1UWFA 1RJLA 2RACA 2UY7B 2AKRA 3FF8A 1GKEA 3N43F 4R26H 5DT1L 5HI4C 3H9SB 2YD2A 3LCYA 1RUMH 2OR9L 5FOBA 2EECA 3RHWK 1MOEA 2AGJL 2YD5A 3ZR5A 7PCYA 2OAAA 2NRDA 2GC7C 4JUSA 1BVNP 1SFHA 4LE8A 1EJOH 4BFRA 1BM3H 5F7WC 4EZLA 4X98B 3QH3B 1A6UH 4H8WC 2Q20A 3MBWB 1WBXB 3I50L 3NJKA 3OTTA 4YDKH 4Q9RH 3NJIA 4I9WD 2JNZA 4LDOB 1I4FA 2VMCA 3MV8D 3PJLA 5EWIH 2LLGA 3GIVA 3GDBA 5FX3A 3I75A 3DTUB 3CGTA 2V2WA 4M6MH 2MNJB 1CLYH 1S3RA 1U3HD 4N26A 3TFKD 1IM3B 5EC1A 2EVHA 5DU7A 2CXKA 3VVVA 2OP4L 3VI4B 1DQJB 3SO3C 5IB4B 4UM8B 5H4ZA 2ATKB 2J57A 3UYRH 4S0HA 1DJWA 1P4IL 3P54A 3RDTB 1P4BH 3D25A 2CHXA 4JZNA 4AG4H 1W8EA 5EUOA 1I7RA 1ZD6A 3EYQC 4RNRA 4UV4H 5AKTA 1TO4A 2BRQA 2I27N 2VNCA 1ZPUA 3IU4H 2J6EL 2BP5M 4X5WA 3HS9A 2Y3AA 2Z91A 1O7DE 3U7YH 2XN9E 2FO4A 5JO5A 5IOPB 3QJFB 1S7WB 1FC2D 2HJLB 1A8JH 4KGLA 2EXSA 4A7GA 1JZIA 1QVOB 2HLFC 4PN6A 4KC3B 4QRTA 5GPRA 2ZF9A 2D7QA 5T1MB 3GBLA 1KCRL 3F6IA 4KOBA 3US9A 4J4PC 2SEBA 5HVFB 3CHQA 1EVTC 1QSED 3ZE2B 2JI1A 5JW3L 3F8UB 1HHJB 3JV6A 1A4KB 1SBSH 1DBML 4IDJL 3UTTA 5GS0C 4R7XA 1OGPA 2VUYA 1JYWA 5C0AA 3WMPA 2PCXA 3TYFB 1U58A 2HFFA 3T77B 5CJQL 3RFZB 1XXFC 2D3NA 4GIPD 4N24A 2F19L 3GXDA 1OP3K 1D5MB 2JFCA 4H8WH 3PJSA 2J5WA 3ZE2F 2AQPA 1HKLH 4WEBH 4TOYL 1A02N 3BP6B 2ZZUT 4FNLH 4EDXA 1UD5A 3H0TB 3D05A 4PG2A 2X2UA 4WCYH 4CGUB 3NZ8A 5FGRA 1V8HA 5I1KL 5KN5B 2AJZB 4R0LB 4XBMA 2F54D 1MVFA 4DUWA 3QARA 4LRIC 4NUPA 3SE4A 3KH4A 4JFEA 5H35A 2FATH 3QDAA 4PUBH 5JYLA 2EZ0D 3S3JA 1CF1A 4OGZA 1ID5I 1P7HL 4QYOA 2J6WA 4KX8A 2VXSL 2DQ6A 1KOAA 1BECA 3JXAA 1OB1A 2NUPA 4ZQKA 3FB5B 5DLML 1NAKH 3SQOL 4JKNA 4KGJA 3ZQXA 1OSEA 5HY9A 4UTAL 3O6MH 3JVGA 4NM4L 4Q6YA 1PX4A 1NDMB 4LARL 4X6EA 2K4WA 4OZGB 1XSKA 4P46B 4LRNL 5CZXD 2G2NA 5DMGC 2E6JA 1A7OH 3WY2A 4XCCH 1P9MA 3PJNA 3BAXA 1IKNA 1WH0A 2CA4A 1KCVH 1EDQA 1UXLA 5F7EH 4CC0A 1BBDH 1ZJAA 3E8UL 4DK3A 1LO3H 5DHYA 3TN0C 4KMTL 3EFFA 3E9TA 3D2TA 3S88L 2W9DH 4FQLH 4OZGF 2XTJE 2CRYA 1NUNB 3UJTL 5DDHA 2PCYA 4OCRL 1A9EA 3KL0A 2J1KA 4DP0X 3QZWG 3OH6A 5I6OA 2ZWNA 1S9VA 2FGZA 3TH3T 1MRCL 3MRDB 2D0BA 2RIKA 2G0KA 4HHAA 1YEIL 3DNKA 2YC1A 4Z8FL 3B2UD 1XF3B 1AHKA 3T65B 1G0DA 3O4LD 1NDGA 3IU3B 2L7UA 5I1HL 1JV2A 2GSGA 2EVJA 1JFHA 2MNWA 4JM2F 4MNHA 4ZMTA 4LCUB 1TGHA 3GC3A 4HOZA 1IM9B 2WVVB 4G8FB 1YTBA 4MQXD 4AGLA 4J5VA 4IBSA 5T1LD 4KI1A 5C0EA 4K94L 3Q44A 2X1QA 1YEDA 1UB5B 1IFGA 2PCPB 3TO2A 2E9IA 5I0WA 4HUVA 1CD8A 3HC4L 4PP1C 1L7TL 3NYKA 4N2MA 1EAQA 4NCC1 3ARFD 4HCFA 3ULVF 5B4MC 2JI3A 4KROD 1E7UA 1LNUA 3UTTE 4ONGL 4AYFA 4Y5VA 2X4OB 4UIKH 3TA3D 4ATTA 2XBTA 3UXFA 1T2JA 5K59F 1M7UA 2A9ML 3KPRA 3VD3A 2L3BA 5JIDA 5E5MB 1N0LA 2KHAA 2XWBA 2EUVA 4NKOA 5FCSH 2WZPD 1I1AA 2BZ7A 2NOIA 3NFSH 1AI1H 4WO4C 3PU7A 4NX0A 2OYKA 1BF5A 4EAKA 4Y19A 3WKNA 2CDFB 2L04A 3DI3B 1FJ1B 2NY1D 1TJIH 5E5RB 2I85A 3S8WA 1O7VA 2Z7UA 2XWJA 3N42B 1NL0L 5EU7C 1WZAA 2ZE0A 1OARL 2VLJD 1LDPH 4OU3A 4APQC 1FCGA 3L1FA 1FN7A 2EJ1A 4G42A 4F8QA 3KMDA 1UT1A 3MR9A 4A2EA 4WX8A 1IFRA 1QQDB 1XBDA 1YYLL 3QCTH 4WKXA 5MI0B 2MCPL 3DROA 3M86A 5SWSB 4F15C 2WUBH 5K9QI 3MBEC 3TWCL 3ARBC 5EO1B 1AGDA 4HOWA 3W39B 2AZUA 2CK2A 1X5GA 3X1NA 3U9UA 4RGND 2ARJB 4QXGL 3KYKH 3D0VB 4JFQA 4YHML 5KVDE 5IM7A 1CYXA 1DVFC 1GGYA 4H88L 4N0YH 1E5AA 4MCMA 1JNHA 4QOKE 1J5IA 4P59H 1UM5H 4M1CC 4L9LB 2RR3A 1HOCA 4LSRH 1AC0A 3DUHA 4KKCD 1QLRA 3II1A 4A66A 5IHZA 1GZHA 3JYBA 5GZOD 3OLDA 3WL9B 2IFFL 5F7MC 3WHXB 2EYSA 3PFQA 1N9PA 1L9OA 3HUJE 1KN2L 4GG6B 4RDBA 3FH8A 5E8EA 1ETJA 4QRPA 2R2HA 2EYTB 2NY2C 1VACA 2X9ZA 4OZ4A 5JXAL 1E5CA 3CPUA 2FNWA 3PWUB 4PYGA 3ZL4L 5E2TH 1N70A 3DIFA 3IM1A 5JOEA 5HPMA 1MXDA 3MMEB 1I9JL 1QLFA 1M05B 2WQ8A 1P7QA 1ZDSA 5IVNA 4LPXA 5DCCA 2Z8SA 4XX1G 3FU7A 3UOAB 3HEIB 1HHGA 1YVLA 4XX1E 3TBWB 5T5FL 4Y2DD 3SPVB 2QSTA 2QDWA 3DVNA 4DZ8A 3RWCB 4ZUTA 3BE1L 1UJ3A 4UAOB 1JPGA 1Z3GL 2C3VA 3KPQB 3ECQA 2QMKA 1GTFA 5DFVC 4AZ8B 3QUKB 4FMKA 1XSIA 5C0BA 1GGTA 3PAZA 1IC4H 1NUDA 3NCFB 3ZTNL 4PR5A 1FZOB 3UYOD 1MWAA 3X13A 4FJYA 1CYGA 1KB5A 4YFLF 3JUYA 1I8MB 1EO5A 3J2PA 1ODUA 4K9EH 4MA3A 3RGVB 3X1GA 4JJHA 1U8LA 2X89A 1YN7A 5E1AA 1P7BA 3IJHA 4YXKL 4FTDA 2WYIA 1ED3A 2YUXA 3C60C 2FJFB 3O11A 5FLUA 5I0ZA 4IHOA 2PKDA 1TQCC 2ITCA 2OMUB 2XFGB 3X1FA 2IJ0C 1JGLL 3MCG1 4QTFA 2XHNA 3HBQA 3RA7L 3OV6A 4A39A 3LN9A 2WKGA 3TL5A 5A40E 2HKPA 1YCSA 4WK0B 2KUTA 5K39B 4EVNA 3U0PB 4BM7A 1JWUB 4QCIA 3WTYA 1R19A 1FE8H 2DBLL 3CPLB 3BLBA 3QUYC 5LAXA 2NVMA 1FIGL 2WWKO 4YSPA 4HC1L 1UGNA 2B59B 4FQXD 3D39B 5DWPA 1PZUB 3F7QA 1WZMA 2I9LB 5EU4B 2EKJA 1UQSB 3N3EA 2A6DB 3UEQA 4DGIL 4GI8A 1ADQL 4KHXL 4H5SA 4E41D 4F1SA 4N9GA 3SPHA 1J8HD 3HAEH 2VL5A 3ARVA 1OAXH 1UADC 3FQTB 5GHWL 1IILE 3MC0A 3T3PE 5G4OA 3G6JA 5AW4B 3BQUC 1DLHA 4DPBX 5EB9A 2W9EH 1UA7A 2N1TE 4PREB 5EO9A 4I1PA 3VE0A 3ZT5A 3EYOA 4PLKD 4OQTA 1QHPA 5CCHE 4IU2A 2ZYRA 2VJ0A 4PQXA 4B50A 5E6IC 5DD3H 1DBBH 3T5WA 5ICZA 4WHCA 4PJ7E 1JHKH 2YN5A 1CL7H 3LZLA 1S3KL 1NKGA 2A5UA 1U92A 3AWEA 5IJVB 1ORQA 3LPPA 1QLEH 1GHFL 5K5YA 5IVXF 3LHPL 1G7IB 2P26A 3BMWA 4NZDA 1HHKB 4NQTA 5F1IA 2HRPH 1R5VA 3PP4H 3NGBB 4WWKD 3F7YA 5E24E 3DUUB 3MROA 5MEOB 1JF1B 1VFBB 4LASL 1JD9A 1HX0A 4NZJA 5IFJA 1BZOA 4Z0XB 2KZWA 2NR6C 2UZIH 3VFTB 1SVBA 1KB3A 1JTTA 3GSVA 2WOBA 4FXTA 2X0VA 4ODWA 4KPHL 4B60A 5KSUA 3WD5H 5GRUH 2X9YA 2AV7A 4NZUH 5H2BB 3OPZH 4N2NA 4XBPA 3PDOA 3GBNL 1NMAH 3CVHB 3S0PA 1DDHA 2PN5A 1JJUA 1QATA 3MO1B 4HCGA 5C0BE 3ILQC 4QHUB 3FB6A 3SYPA 2FSEA 3EO9H 4ZXBD 5CKAA 2EH7L 1A4JB 3C9NA 4N0UE 4OIIH 3PV7A 5JZ7C 3L4YA 1FPTL 2NY5H 1E5YA 1I9RL 3VI3E 1A6PA 2I9TB 3RLSA 1YEKL 3IBOA 4GQQA 2KS0A 5HI3C 1PFOA 4Y1AD 2BNQA 1Q94A 1P1ZB 4U0RC 3ZGIA 3OAUH 3OLIA 3O8XB 4HK0B 4P9HC 2HTLD 1M6OB 3RGHA 4UQEA 4PJIE 1L3NA 4ZJ9A 2KL6A 4LCWA 5D1XC 5B38A 4RGMB 2P80D 2Z31A 3T71A 3AC0A 5BVPH 3HFMH 1TT6A 1L7IL 4KV5E 3DTXA 2MOGA 2QT6A 4P57A 4PJAE 4Y9GA 1UZGA 4FXGA 4PG9A 3CWAA 4AQ1C 1FFOA 3DO3A 1DE4B 2VDKL 4P2RD 3RX7A 3M17A 5JLZA 1D6VH 3BT0A 1E4KA 1TJMA 3BPOB 3GUFA 4FLRA 4LGSB 2HT4C 3AS0A 3HZYA 3RBSA 3O2DL 4RWHA 5E2WH 1H3TA 1RZKL 4ORZC 3ZDYF 4XWOD 3HA0A 5AYUH 5A43C 4WI6A 5TDNB 3NFPB 3CSYB 4TLSA 4LKXA 2D2CC 2JKTM 2OJEA 3G6JE 2OSWA 5IB1B 4BFIA 5CUSH 3SOTA 3FS9A 4WU5A 1JGUH 1U6AH 4P5TC 4GUQA 3AVEA 4YPGA 1L0YA 3CD4A 1COBA 1TF4A 4M1GL 1TPXC 1QKZH 3JYCA 1KV7A 3KBPA 2EC8A 4NZTH 5KBDA 2HZHA 2UVFA 3D18A 4DEPC 2J5LC 4AGQA 4R2GD 5LBVA 3FTWA 4OGQC 4ZFZA 1OAUH 5FYLE 3V10A 1TMCB 4KKBD 3LRKA 3TEWA 2W0PA 1KIQB 3QJRB 3JTSA 3L5XL 5JW4R 3PCYA 3VQLA 3ZZSA 2HLAA 1OCWH 4ETYA 1ACZA 4YHKH 3VB9A 4JHUA 3DMMA 2Z8UA 3QS2A 1U8QB 5I6XB 3V52H 4GRLD 1P7KA 2O1AA 2BFVH 2AFNA 1SYSB 4KQ0A 1KFAL 1J0KA 3SDYH 4PV9B 1NOAA 1RXLA 3IDJA 1Q1JH 1T5WB 3C75A 4I0KA 3U2SB 2VZOA 4JGJA 1BZ8A 2N56A 1OCOB 1CLZH 2XX0A 4U1MA 5EPMB 1R24B 1I8IA 4X6CB 3V6OA 2VR3A 1LMIA 2O4EA 2WP3T 3MLZL 4PP2B 4ZW8A 4Z5RB 1RUAH 3LDBB 1KYDA 3FTUA 3QORC 4AVHA 5L2JA 2R8SH 3MV8B 1NMBH 2FZ3A 4MYWB 2AQRA 3VFOB 2CKBA 4JRXD 3MCYA 5DYOB 3ZZ1A 2B4CL 5LGHH 1VZGA 1BVLB 1U3HB 3ME0B 4AENB 5E9DD 2NNAA 4FQQA 3ILDA 2A0LC 3ZE0B 4JFHD 4N2EA 1XAKA 4AX3A 3ECUA 3FT4A 4HZLA 4M43H 3P30L 4TRPL 5A2AA 5B38G 1ACYH 2C8NA 4LCWE 4DGYL 2B77A 3V0GA 3BZFA 2ZUQB 5EBGA 4WUUD 2JB6A 4JDTH 3QR1A 1J0HA 4AT6B 1FRGL 4PTUB 3KL3A 3MCLH 4IK6A 1CXEA 2XG4A 1N64L 5D9SA 5I71C 2XSKA 2JLLA 5FO8A 2CO3A 4FQIH 2E7LA 1J1XH 5GZNA 2GIYA 1CGYA 1DBJL 3VXNA 4GI6A 5C0RH 4JS7A 3LIZL 3HS0B 1NFIA 3K6IA 2ROXA 1BFOA 1EO7A 1FG9C 1YEFH 3BDYH 1S9KC 3MRBB 3BFQG 3FQRB 3WJMB 4OAWA 5AVYB 5KYXA 2NZ9C 3LRSB 1EJ8A 2VB5A 4TSCH 3DPDA 1ORSB 2X1PA 4LQ1A 5GGSY 2DQMA 3A4FA 3D3VE 3HZMA 1AGFA 1FVCA 5TF1L 4RFOL 4FG0A 3VU1A 3QJSB 1BZ7A 4G1MB 4PJ9D 4JZJC 4WHYG 4KKQA 4O51B 5IVZB 5I5IA 1F4WH 4F93B 1FAIL 5E00A 3ZDWA 1BP3B 4D0BA 3GMMB 4NI6A 3DV6A 3C5JA 3L5WA 1ZT7A 2Q0ZX 2OI9B 4MJIB 3RIAF 2V6HA 3APMA 3MODL 3NCWA 3ZMRA 4DH2A 1MG3C 3BAIA 3O2VL 5E23A 3IRZA 3WG7B 3ARDC 2VITA 3HR5A 4YSTA 1DUYA 3D30A 4P05A 1CYWA 4W9ZA 3QWOB 3JTBA 4K7PH 4NHUA 2F54B 3QHFL 3HJEA 2UY7A 3RJDA 4WTZA 1VFMA 1XGZA 1AE6H 2D73A 3CN3A 5ABAA 2CGZA 1TQSA 2H3NB 5B8CB 1HU0A 1U2CA 4R90L 3H9SA 4EI5A 3WO3B 1X5XA 3A3YB 3AS1A 4F5CA 3K8LA 1TYJA 3OSKA 1T0MB 5BMFL 1AZZC 4G8AC 5AVUB 4O5LH 3VXOB 4X98A 4L4JA 3QH3A 2VSDA 1YSOA 4YDIL 1QFWH 1P0SE 3MBWA 1WBXA 3UTPE 4D7BA 1KGWA 2ZCKH 4GBXC 1BCIA 2IDCA 2PXYB 4Z7OF 3Q01A 2HL9A 5E8NB 3P3TA 2EINB 1QYGH 4K3GA 3CDGB 3FULA 3SYQA 1YECL 2WWNA 1IM3A 5MP6L 1UFUA 4AEEA 3EH4B 5AYQA 3VI4A 4DWHA 4UT7H 1DQJA 5IB4A 4UM8A 3OF6A 2IAMC 5C7XL 2ATKA 2OKMA 3GI8H 3VW3L 4U1KA 2O5XH 1W15A 4W9FC 3TYGL 1QBAA 3EOTL 3N0PB 5JXEA 3RDTA 1NC4B 2P8LB 2YBRB 3W0WD 1C8PA 1FNHA 2H2PD 1KYAA 1ILUA 4LHUG 2V3DA 1KFQA 3BKCL 3QEGL 4O02B 2UX7A 5FYLL 2CR3A 4OCMC 5IREA 2P48B 2IBZY 1I7UB 2X12A 1MCWM 4XMKH 5IOPA 1KF9B 1PSKL 1YEHH 3QJFA 3SZ6A 1S7WA 2VR5A 1B9ZA 1WZKA 2HJLA 3LQMA 4ICWA 4M02A 1B6DA 3IFNH 3ZKNC 4RRPM 2ERJC 5J56B 5JW4M 3CBKB 5EEYA 4XBGB 1PJ9A 5T1MA 4W9KC 3B9KC 1EGJH 3QXVA 1QUPA 1WJ3A 2BVOB 4FA6A 2ZJSL 1RIUH 1A4KA 3CLWA 4EO5A 1NAMB 3B1UA 2QADC 1A7RH 2X9WA 3NCCB 3GS0A 3TYFA 1V7ML 5IHLB 4WY7L 1KJVA 5D6CB 3UAJA 2Z8RA 3T77A 1QD0A 3DURB 2O5YL 4KROB 2AAVA 1RULL 4MA8H 4TS6A 3RFZA 5AAWA 3RIFF 3DXAB 3T1FB 1G9EA 2VZTA 4QWWC 2HMID 3GBMH 3LB6C 1U3ZA 1JPTL 3KJ4C 3OAWA 4LVHB 1SM3H 3BKML 3H0TA 1PJWA 1VF5C 3RVWC 4L8BB 1IFHH 3OZ9L 3D7PA 4I87A 4OLUL 2YKLH 2AJZA 4R0LA 2VDNB 2ZXGA 1MG2C 4R5TA 1ZLSH 3WTTA 1CVRA 4LU5L 4TUUA 5ALCH 2XV2A 2VLJB 3KCPB 2Q2LA 3PQYB 4LSSH 5ALBL 3KH3A 6TAAA 1O75A 4K8RC 1GMIA 2H26B 2X41A 3N06B 3EBGA 5M7QA 3FB5A 4LNVA 2HT3C 4G7YL 1DJXA 2OSXA 3H9SE 3JVFC 1XT5A 4ESKA 1MFEH 3AMKA 2JI2A 1IC5H 4F5CE 1W8OA 1NDMA 1AZUA 4P46A 1YZZA 2ESVD 5IFAH 5JIKA 4XO9A 1OV8A 3RUGF 2NY3C 3Q0HA 3IPBA 4FHKA 4BUQA 3F58H 4M5ZH 3QFJD 2YUVA 4ZUSB 1SRDA 4RGNB 3NCJH 1TEFA 3TESA 4TLKA 3SDCA 1DJHA 1TLMA 3T0ED 5IFHL 2YQGA 3BT2L 4JHZA 2VLRD 4LFHD 4NB7A 2VW4A 4GRWH 2WBKA 2J88H 1QN5A 3BDXA 4KXCA 5FYJD 1NH2A 4S0TD 5D71L 4HF5H 2DTML 3VI4E 2VDQL 3TNNB 3MRDA 4EDWH 3D0AA 1U2YA 2XQYG 2VWEC 1N59B 1XF3A 4Q4IA 3HG2A 3T65A 2SODB 1E8WA 1RLWA 3IU3A 5B1JA 4JKPL 2WLHA 3GHBH 3C09B 5AVTB 2C9XA 5LN4A 3ZSSA 4LCUA 3QUMH 4Z18A 4RODB 3DHUA 1J0IA 2ARWA 2VERN 3TPUB 2J56A 2MTPA 1IM9A 1DVUA 3GSXB 2WVVA 4UV7H 4G8FA 2BHUA 1XAUA 4P9MH 4UB0L 5FUZH 3WEAA 2W8CA 4UBDD 3HC0A 5DD0L 4Y2DB 3CDYA 3MVSA 1SHSA 1RKRA 1DVYA 3SGJA 1DVTA 1CFSB 4GEIA 5BV7L 1FYTB 1UB5A 2PCPA 1Y6MR 1A7QL 1GGCL 1SLXA 4JKKA 4K8RH 3ZE2E 1Q90A 3SDAD 1TR7A 1FLRH 3TV3L 1A6WL 4NC1E 2X4OA 1QABA 2EE0A 4EUPB 5FHBH 1SOQA 2JJSA 2NY6D 5DS2A 4AL8L 2Q2EB 5E5MA 3S98A 3BAEH 5TH2B 5C0CB 1MJ7L 2XV6B 1EANA 2VAAA 4AYEC 1YPZF 2VABB 3M1BB 5D72H 2VC2L 3PWNB 4HT1H 4LBAA 1RM1A 3IRPX 2E4TA 4FABL 1IO4C 4L4TB 2CDFA 4L2LA 1FJ1A 2X10A 3IAPA 2JJWA 1M2OA 3O9WD 4HXBH 4C56D 1NICA 2BDNH 4NQXB 3VACA 3QIUD 3SE4C 4HS8L 2DIEA 4ANVA 2V17H 2GUOB 1QQDA 1JF5A 4WFHE 2XFXB 4ZD3L 3KYMB 4FQXB 1J12A 4G80B 5SWSA 4FQ1H 1LO5B 1C5BH 3TIEB 4K23H 3VMNA 4PWEA 1GS6X 5EO1A 2B1HH 3W39A 3C12A 4OCXH 4QG5A 1MW3A 3JVGC 4MA1C 4MAYB 4JQIL 3MCKB 1E4XL 3D0VA 4OZGE 1DCLA 1I7ZB 2EABA 1KC5H 2W0LA 1DVQA 1XVSA 4P4KA 4L1LA 1P9MC 2D3VA 1WFOA 4YXLH 1IKNC 4L9LA 5FR3A 2Z93B 1KTKE 1KCLA 3QYNA 4Q56A 3TCLA 5DVOA 1AMYA 3MXWH 4Z7NB 2OMVB 3IMWA 4HAGA 5JIMA 2UWEB 3LRLA 1THCA 1YQVH 3WL9A 2Y7SA 5EBWB 3WHXA 3U4AA 5IW3A 4GG6A 2EAEA 5BNXD 3RFRA 3SPGA 2EYTA 4MASA 3QULB 3PWUA 2E0PA 2J73A 4OCWH 3B3BA 3P02A 3WY1A 5HHOB 1CE6B 1MHPL 2ZUVA 3MMEA 2F68X 3NN8B 4WWKB 3OC8A 1M05A 3JV4B 2WB1A 5AUMB 5L88H 2AQ1A 5IJCC 1RU9H 1FSKB 3PGFL 4DP5X 4R96A 2QGEA 3TBWA 1Q9UA 3EOBB 3SPVA 4UT9H 1MJ8H 2EH8L 3RWCA 2BNRD 4BXSV 1U8HB 3KPQA 1TVHB 5HDLA 2R0WH 1RP9A 3NABH 5TK2A 3QUKA 3V0DA 4AZ8A 3ULVE 3UW2A 1MNNA 2D4FA 5I8OH 3CK0H 4XC3L 2V5TA 4OQ1A 2NSMA 4RX4D 5K59E 4K2UH 4TVPH 3L4TA 1FZOA 5EOCH 5I9QB 5BZZA 1SXBA 5FB8B 4F20A 2WXLA 5ICXB 4LP8A 1I8MA 3N55A 1YQKA 2KPNA 4ZXBB 4S0SD 3VYNA 3DWTA 5D7HA 2MWCA 4QRRD 1TQUA 4HIXH 3LJ3A 4U4BA 2FJFA 1M4KA 4WU7B 1PY4A 1F18A 2K7PA 3WO4B 4M6OL 2GJ6B 2PYFB 2OMUA 1NIBA 4MJ5B 2JKXA 4Y1AB 4DO6A 1BXAA 3CDZB 1RZGB 1T80A 4Z76B 3UX9B 4X7DC 1I1AC 2X6MA 4UYPA 3I0XA 2E7BA 4HFWB 1B6UA 1OAZH 1LP9F 2DMGA 1IAIM 3ABKB 3Q8CA 1MI5E 1PGRB 5C08B 5K39A 3U0PA 2WLMA 1JWUA 4XCNB 5CM1A 1R75A 2K8QA 3CPLA 2WVUA 3VXRD 1RI8A 2JQAA 2QLVA 5CINL 3BWSA 3MRRB 2DMCA 4XXWA 3QWNA 2B59A 2P24B 1F6AB 1UG9A 3D39A 2ZPKL 1U3JA 4PVMA 2I9LA 1FO0B 4MTMA 4KI5F 2OMZB 5EU4A 1T89A 1UQSA 4GFTB 1ZXKA 2ZXCA 2A6DA 1U30A 3WN6A 3WV0A 5IIEB 1V05A 4B5ZA 3S5ZA 3U4KA 2EDKA 2V92A 4G8IB 5FW6A 3BEVB 4KK8D 5SWSE 4PLJC 2FKFA 5EDXA 1KENH 5TE4L 3FO0L 3FQTA 3HPJB 3X12A 4UQ9A 3KNBB 4JPVL 2YHGA 1EXHA 4PREA 1IQDB 4XH2B 4G70B 2G4GA 2XVBA 4FYTA 4A6YL 3WIHL 2AERT 1D9KD 2OA9A 3WS3A 5AAMA 3AG3B 1DQTA 1N8OE 2DQTL 5KWYC 2XPYA 5IJVA 3E7JA 3UMTA 1GZHC 4PI0A 1T22B 4U49A 2EXTA 1DBKH 3GIZH 1G7IA 4A38A 1HESA 2G3MA 4HWNA 1EEZB 1HHKA 2WVSA 4R97B 1EO8L 1NCTA 3DUUA 4G6MH 5JTWA 3HB3D 5MEOA 1JF1A 5AB0A 4BZ2L 4GAJL 2DJUA 3VFTA 2IGLA 1QX1A 5IVOA 4LCIH 1K4CB 5KVGL 2F1BA 1S7QA 4FN0A 2I5YL 3QO1B 3NPSC 4JEGB 4M9OA 4TQHA 5H2BA 1UJ3C 4FLSA 3ARGD 2VZ1A 5GGRY 3L4WA 4ILDA 1PD6A 3BWAB 4H26B 3WFCL 3WYRA 3CVHA 3PP3K 4F2MB 1ZSDB 4Z7VB 3WENA 4G1EB 3MO1A 2CK0L 3SE8H 4QHUA 4EN3C 3QEUB 4F2FA 2MMXA 5CHNB 1A4JA 2FL5B 4AYSA 3WNKA 3ISRA 5HGGS 3DVIA 3IS1X 3K8KA 4PGZA 2FTAA 3QNXB 4RLDA 2VXQL 2I9TA 2X2IA 4OLZH 5C0DB 4X7FC 2WZ0A 4K71B 3WTUA 3IMBA 1P1ZA 1NTDA 5FLVA 3QWQB 1VAHA 4HK0A 4OZHF 4P5SA 1OM3L 3NP3A 4Z1PA 1M6OA 3KJ6H 1OT4A 2OULB 5K69A 1E6OL 3DBSA 4JRXB 5BOZG 5HDWA 4JK0D 4L0ZA 2PWEA 2I07B 3R0MA 3QAZB 1SHXA 2EEDA 5KYYB 3OHXB 4N2FA 1NGWB 2VDLB 3D09A 5DEFB 4O9HH 1BJ1J 1Q72L 4M7ZB 3OLPA 2F53E 1GW0A 2BCKA 4JREB 2VKWA 3MGAA 4LSTH 5J57B 1T0OA 4QAWA 5GS1B 5LXGL 1DE4A 3TBVB 3EYSH 2H0PA 3FQYA 3BSZH 1NCOA 2DQCL 3WIFB 2MFNA 2QSCL 2VM3A 5JIIA 4JKMA 1E9QB 1HINH 3QR2A 1TFPA 1FGNH 3VMOA 2IC2A 2O5ZL 3IT8D 3L3OB 4LCVA 4W9LC 5D2LB 3O2WL 4GRMB 4X8GA 2Z0BA 3ULVL 4OCYH 5JW4Q 5TDNA 4AW7A 5IUSA 4JY5L 1LE5B 2W80C 5I1AB 3T09A 2GT9B 2H9GB 4ODHH 5IB1A 5F7HA 1BXXA 4BFKA 2GIMA 4Z3EA 3EIFA 3CHPA 1PG7W 3I6GA 3V8CA 1PIGA 3DETD 2XX1A 4O4YH 3HE7D 5GJTH 3MUHL 5SX5H 4PJ9B 3REWA 1KBVA 1OXYA 1YEJH 2VR6A 4MMXC 3VYOA 1IZJA 4NUGH 1Z1WA 1H8NA 5GGTA 1NBZB 3TNMB 5L7XL 5B3NA 5ISZE 3SGEH 3L9EA 1G9MC 4FCAA 1XGPB 2LGNA 2VISB 5ABDE 3IDXL 1F90H 5DF0A 2ZX6A 2R0ZL 4EN2A 4X5XB 1HQRB 1KIQA 3SQBB 2MQCA 3R18A 2CO6B 2X4UB 3A67H 4TN9A 2J72A 2D7PA 3LYRA 3NIFB 1NCAL 4UQ3B 1MP9A 1U8QA 3D7QA 1U36A 3GXFA 1AANA 1SYSA 4YEEA 5G4NA 4GSRA 3G08B 4PV9A 3GKZA 3LEVL 2YPVL 3VFWB 1I53A 4JN1H 4LO9A 4Z7IA 1T5WA 2P5WB 2BSDA 3U2SA 4HLZH 4PRIB 5EPMA 3Q1EA 1R24A 4X6CA 2HTKD 1SXAA 4DGVH 3IFLH 5L4MA 4HWBL 3ULUH 4PP2A 4NNPH 4NQED 4Z5RA 4ACTA 3S35L 4IOFD 1IQWH 4KMQA 3MV8A 5GRVK 4X0NA 1YNKL 2WQVA 4EI6B 4QUOA 4OZIB 3VFOA 5DYOA 1S2EA 4ZO8A 4BGLA 3CBJB 1BVLA 1U3HA 2WB7A 3ME0A 4KKLD 5IZ7A 4JKLA 3WFHB 3FZUD 2FX7L 2ZX8A 2ZUSA 3Q43A 4CU6A 3MRHB 1WCQA 1KGCE 2Z31C 1HYRC 5IHUL 1WEJL 2FT8A 1OGAD 4P2QD 5D8JL 4N0CC 4XVUC 1W72L 3S36X 4YLCA 3F7RA 4AT6A 1N7ML 4PTUA 5C6WH 1PS3A 2DB8A 3V0HA 4XP4H 1DZBA 2DLFH 3MRMB 3ABMB 3N1FC 4FXGC 4OD1H 5ICYB 1HSAB 3VYPA 3ZDYE 2YRZA 2XVKA 4Z7WB 3I6KB 3TEYA 2CIIB 3S37X 4YFEA 3GZOA 3HJ0A 1ZCRA 4N2DA 4QDGA 3ATEA 3HS0A 1JK9B 1E4KC 4NIYE 3EFDL 5D1ZD 1WTGT 4LOUD 4W93A 2Q7NA 3MRBA 3FQRA 3WJMA 5DUBB 3JSSA 4XCEB 4XMPH 3QUZC 3AU0A 3DDFA 1AS8A 1UA3A 3P1VA 4XRCB 4ZUVB 3LRSA 2ED8A 5IT2H 1N8ZB 1DEDA 3WHE0 3QXAB 4ADIA 3FONB 3UO1H 1Z9LA 1ZLDA 5DMJB 4HS3B 1RMFL 3GSNL 4G1MA 4NIKB 4RCAA 4O51A 5IVZA 2X09A 1SMAA 3GMMA 3K3QA 1JMZA 3KPNB 1P6AB 2DLIA 4MJIA 4NN7B 5AOZA 2D0CA 4MXWL 5TFSL 2Z0FA 1A65A 3F6LA 3CVIL 5EZPA 1J88A 3WNPA 3KPTA 3QWOA 2QPSA 4JG0L 2A77L 2F54A 3L9BA 4PJ8D 4XBEL 2EO1A 3ORJA 1IAII 4KAQH 2H3NA 5B8CA 2XWZA 1L9MA 3MRGA 3KG5A 2YMXL 1JRHI 3DMMC 1D6EB 3ABLB 1ZLUH 4PB9L 3R7QA 3THMH 3MXVH 3H3KA 5KAQF 4ZZKA 3U1SL 2UYLB 1T0MA 3EHBC 3GHEH 3FMGL 4WI3A 3T3MF 1CR9H 3VXOA 3QZPA 2TRYA 3CWTA 4LB8A 1I9EA 2ZP9A 4IOSD 3GRWH 4JPWL 3ILEA 2P9RA 3I6LE 2APTA 5F0MB 2R0KL 3GS4A 4X6CE 32C2A 5FUCC 1SJMA 2V7HB 4F9LA 2PXYA 4JFOB 3V6OC 4WW2B 5E8NA 4XNYH 1A7PL 3QFJB 5I6NA 5ITBL 5HHMD 3CDGA 1S9YA 4W4NA 1XIWD 4J6RH 1UM4H 4BD4A 5H8DA 4D9LL 3WTXA 2KLTA 4ETQA 4JHVA 1YQ2A 4XZUB 3B6SB 3ARXA 3C2AL 4UILL 3PWPB 4M56A 3WDJA 1JVLA 2CD0A 4OLWL 1J0YA 4MNGB 4WW2F 2QGDA 3UP1A 1NC4A 2P8LA 2YBRA 3HI5L 5FHAL 1LWVA 4NQCD 1FIEA 4GIOA 1R5WA 4JHWH 2XA8L 4CDHA 4ALAH 4O02A 2YEQA 3D51A 4IIQB 4GG8B 1I7UA 3K74B 3GRGA 3KBHE 4PY7B 4RSVA 1P84K 4JMNA 1KXHA 5E6SB 2E7LC 2VH5H 3W3BA 5GZNC 3DC0A 1S7UB 1LLAA 5TGBB 4XBGA 1VEPA 3F2LA 2J21A 1D3CA 1SOKA 2YZ1A 1UM6L 3CDFA 1MQ8A 5KVEH 2BVOA 4DO4A 3VNZA 5G5DB 2FO1A 1A3ZA 1KYOK 4ADGA 4DT2A 4MYPA 3AXIA 1NAMA 2CPCA 4HHGA 3UBHA 1TQBC 2N7AA 3VDBA 3J7HA 4K5NA 3BIBX 4LNRB 3SDAB 3DURA 1KY7A 5A2LH 3CXDH 3T1FA 3DXAA 3GSQB 2EDRA 4HJSA 4JFTA 3G5WA 2QZ5A 2NY6B 4MA7L 2IGTA 4KUZH 3UJJH 1PEZA 1ILSA 2R9HD 2ZXQA 4G9FE 4OZFH 4ZPVB 4ENED 3QRLA 2WIIA 2NXYD 4L8BA 4MJIE 4Y5YA 3T0DA 1U8PB 1JK8B 1YMMD 5T3XE 1HIML 4JCWA 5FYKU 3S7GA 4PRPD 3ATAA 4PBDA 3INUH 2PTUA 3LPFA 4NN6C 4MQ7B 4MMYB 3FFCD 4K7PY 4MJHA 5BO1H 2AK4B 2VLJA 2EDEA 3CC1A 3KCPA 3PQYA 1M1SA 4R3SB 1OTSD 2P1YA 2J8UB 3WXWH 4JR9L 4IBLT 4OFDA 4AW4A 4BDVB 1Z32X 2EDXA 2H26A 5F96H 4PGJA 4EBQH 4IBZA 3LS5L 5EZIH