1E42A

Beta2-adaptin appendage domain, from clathrin adaptor ap2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
b'GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 COMPLEX SUBUNIT BETA
publication title The Structure and Function of the Beta2-Adaptin Appendage Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 60
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e42A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1e42A02
1B9KA 2G30A 2IV9A 1C9BB 1KY7A 1QN3A 2Z8UA 1QN9A 3OCIA 1QN7A 1QN6A 1W80A 1VTOA 1YTFA 1PZDA 1QN4A 1D3UA 1TBPA 1TGHA 2MJ7A 1QN8A 5IYCP 1MP9A 1KYUA 1QN5A 3ASMA 3HS8A 2VJ0A 2D0AA 3HS9A 3OC3C 1YTBA 1RM1A 2IV8A 2D0CA 1VOKA 4RODB 4WZSD 2D0BA 1JFIC 1QNBA 1QNCA 4PY5A 1QTSA 1TBAB 1E42A 1VOLB 1KY6A 3H1ZA 1KYDA 1PCZA 1KYFA 1VTLE 1NGMA 1R4XA 4ROEB 1NH2A 3EIKA 3VN5A 5IYBP 1NVPA 1QTPA 1AISA 1QNEA 5IYDP 4B0AA 1CDWA 1QNAA 4ROCB
chains in the Genus database with same CATH superfamily
1XL6A 2DLHA 1ZGLA 4FLRA 4PJCE 1ILSA 3BWAB 2CJ3A 2DD8H 4EUPA 4CAGA 1YQKA 1JF5A 3P77A 3MGTA 1NPNA 2KLRA 3PXHA 4NSKB 1G9MC 3VFPA 4MB3A 1ZV9A 3BDYL 4AKOA 5TDPA 3TCLB 3LKNB 4RMUA 1ZLSH 4Q2ZA 1IM9B 1EAPA 1OF0A 1NFKA 3WE6A 4OVVA 1XB6A 5DVNA 4FQQB 1GAFL 1RMFH 2K78A 4JO3H 3W11C 3Q43A 4WKXA 4G80A 3HS0B 1W9XA 1UD5A 3GBDA 5T1KD 3VRIB 4B95C 2HKPA 1LEKB 4QO1B 2YBRB 4WEUD 1NEPA 3B3BA 3BGFB 3GSXA 3PGCA 4PP1C 2QVTA 4FP8L 3NABL 3AY4A 3AS1A 1C1EL 4G8EA 1FAIH 2P5ED 1PMYA 1T7ZA 4B9JA 1YO4A 1UD4A 2GBUA 1JWUB 4FFVC 2AAAA 1NCDH 5HDQL 3HZMB 3OD3A 3PWPB 4UNIA 1A22B 2DQCH 4JG0L 4FX5A 5B8CB 2FBJL 1MPAH 2P28B 4RNRA 3A22A 1JF1B 4U1JA 4PJIE 4HUMB 1UKTA 2XG4A 5FDYA 4KV5F 2Z93A 3E9UA 2A9NL 4LIQE 4ZSOA 3G6JB 4ZNEA 4Z3JA 1P1VA 1TF4A 4RDQG 4CU8A 4XMXA 1CG9A 3GINA 2X4NA 4OM1H 1CR9L 3V4LA 5DJ8B 4LPVA 5HI4C 2Z65C 3QPQC 5GRYA 2E6JA 1NBVL 2OBGA 4IIZA 4KI5D 4HSAC 2OJZL 4U1KB 5AD0A 2VUYA 2DEWX 1IL1A 3VWKB 2OQJA 2WWMC 3EGSB 4P3DB 1EERB 2Y07H 1NH2A 5FA3A 1KB5B 2MRYA 4QRPB 4ZMQA 2VDKL 2NY3B 1RHHA 2I24N 4QI3A 4XE0A 1CLYL 2W0KA 5EZIH 5HDWA 3GSVB 3ZDXB 4A2LA 5KTEL 1WICA 2VRQA 1TFHA 3BD5A 1DEEA 1H3GA 3SPJA 1OB1A 5BRZB 1IJ9A 3SPHA 3GSNB 1GR7A 1YY8A 3AWGA 1WS8A 1UOWA 1ET5A 3OJVC 3QDMA 4H8HA 4ANKA 5B3JF 4Z7AA 4P8QA 4YHKH 4DO4A 3CK0H 2VB5A 4HC1A 3K1KC 3NJJA 5D7SL 5I1DB 1Z5LB 3FO0L 3OKMA 1SYVA 2ZJSL 4PCKA 3OLEA 2MCPH 3P4MB 1ZWIB 4ZOEA 2QQKL 2IG2H 3D7PA 4JM4H 4TVPL 2OCFD 5DHVA 1S7QB 4MD4A 2Q8BH 2Z8UA 2NYYD 1UH3A 5C09D 3HLAB 2GT9A 4W81A 3RX8A 2EDTA 2FX7L 4ZFOB 3PJNA 5JHDA 2J72A 5I6KA 4ODSH 5C86A 1RIHL 5KSAD 1Y1UA 4M7KH 3EH3B 5IBLD 4JKKA 1RK7A 5CJBA 1SJEB 4HCRA 4HJ0C 1HSAA 2XI9A 3LXUX 4CA4A 1DR9A 2C9RA 5GGTL 1CBJA 4YFLI 1LK2B 3VD1A 4YPGA 2CIIA 4PRIB 2QR0B 1AANA 4MA7L 4XVJL 4G7YH 1P6FA 5SV4A 3PMGA 5DZAA 3NA9H 2H2PD 3PWPE 3U9PL 3WUWG 5BUGA 1BZ9B 1EO5A 3IWVA 5CCHE 5F7BA 3OGDA 1KCRH 1S4IA 3SPVA 3A67H 3HNTL 4OZGE 3AGVA 2R5XA 1CD8A 3KWXA 3T0WA 1M2OA 2OTWA 4GRWF 2BCKB 3D09A 1SBBA 5GGQH 2CUHA 1FN4B 5ITFA 5F7MC 2VMDA 1J1XH 4K2UL 1FC2D 5C0ND 4ECNA 2WB1A 5JPMC 4XN2A 3QDGD 2EE9A 3UZVA 1E9QB 1FAKT 4GSDL 3QXAB 4XVUC 4I0KA 2F7RA 1TKWB 4E0RB 3HI5L 1UJ3A 3H9SD 3VTAA 5DHEA 4KXZI 2GPZA 2R56L 1OCWH 4LASH 2J88H 1Q9UA 3PABA 4I48A 1FORL 4X4KA 4CSZA 3ARGC 4JNXA 1ACXA 1FGVL 1IAIL 4GXVH 2H3KA 3EDFA 3CHOA 1KCWA 4MQ7A 4WHTB 4WHYG 4PJ7F 3E6HA 1HILB 2Z3FA 3BZ5A 1UT7A 1R5IA 3KPNB 3DA0A 5CIPA 2JQMA 1VGKB 1X4XA 2YPLD 1Q38A 3QZWB 4QXTB 2H5AX 1MRDH 1FFPB 3VRJA 4ZUSB 1QNEA 1E0OB 3FO2A 4M6NH 5FO9A 3HE7C 5BNXD 1HXMA 2JV6A 3DI2B 3FU3A 1BVKB 1ND0B 5K9QI 1A7RL 4HS6A 1U3ZA 4OIFA 2CDGA 4UV7H 4GG8B 5DZJA 3QS3A 3BJLA 5I8CB 5IHUL 2J5WA 2HAZA 1ZLSL 4ALAL 4JFQA 3CFCH 1J1OH 3B5TA 4EQ2A 4L18A 1JN6B 2NTSP 1RMFL 3GRBA 4JO3L 1LWHA 3O4LE 4J5VA 1GL4B 4PLJD 4Q14A 1RZIA 5E2TH 3SYPA 3WLWD 1COBA 1E5YA 3QR2A 4F33B 4L29A 2BS8A 2DQUL 4IOFC 4PVLA 3PU7A 2D3LA 4POUB 5F8RC 3PE9A 4U31A 3NCXA 1JMXA 1GTFA 1T83C 5H37G 1PCSA 3T8XB 1RZJC 1TNMA 1FAIL 1YY9C 2D03H 3MBEA 3B2UD 3E6FA 2Z7ZA 3QRBA 1GZQB 1KLFA 1OT1A 5T1KA 2X10A 1C7TA 3WHE1 1EJ8A 3LXCA 3ZL2A 1OK0A 4OLUH 1NCDL 1UYWH 4BH7A 1EFXD 1I7TA 3FUHA 5IW1B 4F7CB 4KQ4H 1C16A 2DQCL 5HYQA 5C0AD 2P5EA 3ATEA 1MPAL 5CU5A 2XWJB 5IIEB 3MMEA 4IKJA 4LLYA 5FOJA 2Y6TE 4BCYA 4MAUH 1UGNA 3X12B 2CCLA 4BELD 4BJUA 4GXUN 4L3CA 4RBPH 1OE2A 4MXQD 2NW2A 4BK5C 1J0JA 1T7VA 3P9MA 3LEVH 4OM1L 1BDYA 1DFBH 1K5NA 3MKGA 4YLBA 5AZ2H 3NCYP 2FSEA 5SX4I 1PF3A 2EVIA 1SLXA 3NCMA 2EIBA 1ZHLB 1NIFA 3ARGB 4JVPA 4NOFA 4NENB 5GPRA 4WJKB 5GXBB 5F9AC 2Y07L 1G9HA 3ZQ9A 4AGQA 2A73A 3C87A 2DWEA 4XAKE 2UYLA 4XXWC 2MPAH 1HSBA 1A6TA 3NMEA 1B0WA 4FDWA 5EZIL 3CVSA 1B2WH 2WQWA 1OIOA 1L9OA 3HE7B 2ZQKA 4QRQA 3T4YA 1KWKA 4TNGA 3GYRA 2QGBA 4YDVA 4RMVA 4NBXB 1NCNA 3RVWD 5EUOF 3ZRFC 2IBBA 2E59A 3QEGL 4YHKL 3ATDA 3BYYA 3CK0L 3DRTA 3ULUD 2I85A 2NLJB 3J2PA 2BP0B 4BDVB 4ISVB 2GG1A 5TPWH 2MCPL 1IGCH 3LVTA 3AABA 3TBSA 5A2AA 2Y7QB 4F8TA 1RVFH 2IG2L 4JN2A 1NGYB 4G59C 2NY5C 2VR6A 3NJNA 3FSAA 1UXLA 4NT6B 1BD2D 3QUZD 3ESVF 4Y0GA 5J3HD 4JPIB 4YZWA 3A6BH 3O2VH 4Q9RH 1QSZA 3N1FC 4NC1C 5TQ0H 5C7XL 1JZ6A 3BDBA 3MRRA 4M7KL 4L8BA 4GG6F 4GAYB 1J0KA 1I9JH 3VW3H 2WKOF 1DQTA 1YUKB 2NNAA 5C09A 4JDVA 2IV8A 2GY5A 2BVTA 4GUPB 3VDAA 4D8PB 1I1RA 4G7YL 2E7CA 3IFOB 1U4FA 3NA9L 4UQEA 1HL8A 1EQWA 5KSAA 2EXWC 2LFGA 3BP6B 1AISA 1KCRL 4XNMB 1LWWA 1Q9OB 2E9JA 3A67L 3IGAA 3ECUA 1ITCA 3CJJA 1ETB1 1T0MA 4XXCC 3SNSA 1JDCA 4DEWA 5HPMA 3GLDA 4AGNA 4HWZA 1QN6A 4GW5B 5HHPB 3D12B 4X4YA 5CM1A 2BWIA 2E27H 3II3A 1AGDA 2WTRA 5GGQL 4J2QA 1WVZA 5FYKH 1JHTA 4RIRA 2EABA 4HG4J 4DP4X 3RGHA 4EUPH 4RGOH 2YAQA 4ICXA 2L7JA 1NPUA 4LEXH 1DQIA 2AJYH 4G6AC 2FHCA 5F7AA 1K2YX 2WCSA 2Y22A 3FFCE 5CEZE 1R3JB 2QTVA 5DJDB 5IVXE 1KBVA 1QG3A 2J88L 3E2HC 4HFWA 1I1FB 3KL5A 2BJMH 2Z8RA 3QDGA 2BM3A 4KPHH 8CGTA 1I8KA 2HLFD 4NUJA 1FZMB 1Y1DA 1CK0H 5EZOH 4ZW3A 4N6RA 1PL3A 2JH2A 4M1CC 3H9SA 5AW3B 5CLYA 1RZ7H 4K23H 4PYHA 2IMNA 4ABUA 4YO0B 1MRDL 3MBXH 1SZNA 2VLRE 1HWGB 4M6NL 3RL2B 1VAHA 2HG0A 2OMUA 1XGZA 4R83A 3FQXB 1UD3A 1FYTB 3ZYOA 4ESKA 1KJVB 1YN7B 1LO3L 4Z77B 3WTYA 4UV7L 1V54B 2YPLA 3M46A 5E2JA 5LG1A 1IAIM 3LIUA 3EBGA 2TRHA 5IEKA 1A6VL 2VLKD 3CFCL 4XTRC 1J1OL 3VI4A 4QHPA 4E9XA 4GMSH 2O5NA 3FU7B 4XO8A 1KIRB 2SEBB 5H2BA 1K4CB 1CLCA 2APFA 3TA3D 5E2TL 5EEVA 2C9PA 2KZBA 4HHAB 4DP9X 1HH6B 1L3WA 4RGNE 1TXKA 4DGYL 3MV7E 1OQOA 3ILPA 1GGYA 4FLQA 3WY3A 3ZHDA 4X8CA 5HVFB 2D03L 2B3RA 1JNLL 5D7IE 3II2A 4PW3A 3L1FA 2E9GA 4RA0C 3M7FB 3MRQA 1BQHG 3T0EE 1AGEA 1LEIA 1HQRB 3L9RA 3IN2A 4OLUL 2G5UA 1UYWL 3EGXB 2YD2A 4AM0A 3UPRA 4PWFA 1Z9LA 2VITA 4KQ4L 4RCAA 3RJQB 3FMGH 2CK0H 2WSPA 3CZFA 4F9LA 2AJZA 4Z0XA 2K6WA 3FQ1A 4GYBA 4POZD 3EF7A 2JXMB 3QWNA 3TTSA 1B4RA 1JOIA 4YX2H 4MAUL 1IGTA 3OX8B 1EFXA 3ZIMA 1KJ2A 3TF4A 4CVUA 4TS6A 1YHPA 4AUUA 2IJ0C 5C0AA 2CBQA 4JFDB 4JL1A 4HF5H 1DFBL 4HC1H 4PP2B 5AZ2L 1WAEA 4QXVA 3FN0H 4JDZA 3E2HB 3ELQA 5FHBH 4C59B 1HH9A 4RFEA 2W94A 5IFHH 5DCCA 2FCBA 3TV3H 3RU8L 3CUPA 3F7KA 3FRPA 5DHVH 4B7LA 3NOIA 4GQQA 2YD9A 3DHPA 5IB2A 1JZGA 4Y5VA 4FQHA 2JWYA 2X4SB 4PJXA 3TL5A 5B1AB 3HE6C 2VLME 1JZ2A 5EULV 2MPAL 4N6QA 5M7QA 2E8ZA 2C3VB 3ECWA 4HCRH 4PJEB 1B2WL 2XY2A 2JKXA 3P3YA 1OP4A 3VGAC 1JHKL 4PBXA 5EEWA 1TVBB 3KGUA 3R8QA 4LHJB 5HSFA 2ZSWB 3WG7B 5HHNA 3F5WA 5E6IC 3JV0A 4X5XB 2V33A 1F90H 3S37L 1YQ2A 1AXSA 5DJZB 4HZLB 3RWJA 3UTTE 2F6AA 2PTVA 2ENYA 4I85A 3DX0A 3N3EA 3K7UA 1V27A 2D2CC 5TPWL 4HUUA 1IGCL 4K71C 1PCMX 3QO1B 4FN0A 1ZS8A 5IVNA 1WEJH 1RVFL 3B7SA 3LVEA 2R1YA 3QYCA 4HUKB 4ALAC 2RFXB 4NC1E 4HCIA 5IQMA 1E4HA 2QKIA 3DMMD 2EDNA 4LB8A 4NQVA 3MLRH 2JTDA 3QW9A 1CTOA 2Z31D 3FQWB 1HE7A 1OGAD 3A6BL 3O2VL 4IMKC 4Q9RL 1UL7A 3D18A 1HAWA 3DX4A 4GIOA 3BZDA 1KIUA 5TQ0L 3WIIH 4RQQA 3AG3B 4ZPVA 4DNLA 4DKTA 1I9JL 3VW3L 4P2OD 4QRBA 4NKMB 1T6AA 4UDTA 2Z91A 1JVOA 1BD2A 3QUZA 5T5FA 1ZMYA 3LZLA 5FFOA 1C5DB 5T1LD 3KCPA 3T3ME 2ADIA 4NCC2 4M29A 5C3IA 1HCZA 3G5XB 4AEHH 1HXYB 4OI7A 1UZGA 4Z6AT 5C0DB 4AYEC 1FE8L 1JUFB 1X7QB 4PYGA 4KY1L 3X11B 3L3OA 3FSWA 2E7LC 3L1OH 2L7EA 3S96A 5CIPH 3T1FB 4ETQA 3MXVL 4ZPTA 4J4PC 2E27L 3GLEA 1MCWW 3O6FC 3UIZA 5KG9A 5FYKL 2HFGH 4OF6A 4JY6A 4RGOL 4AQOA 4XNDA 4K7FA 4PREA 5BMNA 2PMZA 4WV1A 4XN1A 5HHOD 4LEXL 4JFUA 5B38A 1S7VA 2A77L 1D7BA 2AJYL 4FG4A 3IGKA 5BOZG 2DQTH 1CGVA 1BXVA 1D6EA 2EKJA 3HE6B 3QSKB 2YBGA 3W9DA 4A66A 4XHJC 3QI9D 4N2CA 1PU0A 3RURA 2Z9TA 1THAA 3F7VB 4GAJL 2BJML 2R7EB 4KPHL 4TLSA 3VGAB 5BV7C 1TCRA 4X42A 2X53A 1V05A 3O3BB 3QFDA 1AG6A 25C8H 3V6FA 5EZOL 4ZMLA 1CK0L 3HZYB 4PJEE 2KT6A 5E6IB 4KMQA 1WO2A 3AQYA 4W6YB 4FFTA 1BBJA 3APCA 1KXQA 1H3UA 1RZ7L 2FO8A 4LLVA 4K23L 4LOVA 9PCYA 2EYSA 4MXVF 4B0MM 3D48R 1U95B 3CXHJ 3MBXL 2WBJC 2CM5A 4K71B 4J3OD 4L0ZA 4TVPE 2PW1A 1M4KA 3MRJA 3V6OE 3SBWA 1WA2X 1MAKA 1I9IH 1WGOA 2O6CA 3T2LA 5B3SB 2W0PA 2ZXBA 3C6SB 3NSDA 2FYVA 2XPYA 1KBKA 2WLLA 1YEWA 2D2OA 2XPGB 4XCYA 1JI2A 1M71A 2Q9OA 2X3CA 4DWHA 4E9QA 5JYMA 1JYNA 4GMSL 3P3TA 4NUGH 5E8OA 3VJ6B 3M7OA 1MCRA 1Q9LA 2R83A 4KJQC 3P3RA 1V5SA 3N9GH 1MCBA 2VLKA 3X1BA 4TKWA 1U8QA 1ECZA 3AT8A 3RDTD 1H3XA 3TA3A 3B2XA 5IR1A 5DQ9A 1TTAA 3L3GA 2FDBP 1UXSB 4E5XB 4XN4A 1F3JA 4KTYA 2AJ3A 4MZ2A 4ZTOL 5CWSB 3RIAK 1E3FA 2I07A 2NY7H 3IU4H 1NCGA 3O6FB 5DUBA 4ATTA 4AM0Q 4Z3EA 1A3RH 1NCIA 5J9PA 3CLFH 5BZXA 4HOXA 3GI8H 3EFOA 4U3XA 5IT2L 1DVTA 4YX2L 2QDWA 3ZUCA 5D2NA 3E8VA 4Z7QF 1IBFA 1AIFA 3KLLA 4TV3A 5JO5B 4TNEA 4U05A 1XQ4A 3ZSTA 4HF5L 2JB6A 5IMOB 1PQZA 4HC1L 4LNRB 1BFVH 3NJKA 3MJ9A 4N2DA 4YDIH 4ELKB 5B7MA 4HAFA 3FB7B 2J43A 2F68X 3FN0L 1S5HB 5JOPD 4X6DE 3FRUA 5FHBL 1J5OH 5IFHL 3TV3L 1KCKA 4L4VB 1MVUB 2EH8H 1QRNE 2VQ1B 2ZOOA 1X9UA 3ATAA 1K8DB 3LEXA 4R7LA 5I66B 4UUJA 2FR4A 5D4IA 3ALWA 1LP9A 2MCMA 1PD6A 1JGEB 2VIRA 3BAEH 4AZUA 1O7VA 2I5YH 3O8XD 3LZFH 3EOTH 3QJFA 2CH8A 3RSMA 2C7FA 3QDJE 4HCRL 5HDLA 2WBJB 1I1CA 1FG2B 3ML8A 2CAKA 3TVMD 4KH9A 1D7CA 2MNWA 5JXED 1DZBA 1KLUA 1UOKA 1AO7B 1GVIA 4UDUB 1G94A 1F90L 3TWYA 4JN1H 3VFUB 4NRZB 5EU7C 3L7FB 1UVQB 1GA2A 3KPPA 5CKAA 3FT9A 5F71A 5ANMA 2IH3B 3SKOA 4X98B 2D4DA 1WEJL 2WYTA 1JWMB 1KTLB 1R9FA 3CCHA 5DU7A 1PZSA 4TSCH 1AQDA 5HJBA 3VXMD 4F1SA 1KGXA 4J28A 1Z66A 4YHMH 2WUBH 4U1NB 5K59F 3WIIL 1HZKA 4Z7UE 1A1MA 5DRNA 2WXOA 1ADQA 2X4QB 5ICXA 3DMMA 1QSFD 3ES6A 3R06A 1BXAA 1HOCA 4MXWH 4G83A 4U1LA 4QHNB 1JK8A 3EFFB 4P4KC 4DP1X 1WZMA 4Y88A 2PTUA 1E2WA 4U2ZA 2CA3A 2Z31A 5KYXB 2EDDA 1OGAA 1KULA 3PV7A 2P42B 2IDCA 2RA1A 4AEHL 2FIKA 4YOKA 4NQDB 5E6UB 4RMSA 2R29A 3FPXA 1QSVA 4DN4H 1EEYB 4P2OA 5HGDB 3TNNB 3MRKB 3JUZA 4YLCA 3L1OL 5IHLB 3GHBH 4NEHB 1FGNH 5T1LA 2BFVH 2Z92B 3RLSA 3PLYA 1KWGA 5HJ3B 3PDDA 1R3IH 5HI5C 3S3CB 2WQ8A 4FI6A 1F56A 4B0MB 2E9IA 3IRPX 2H4EA 1Q9WB 2DH3A 4GKOA 4MS6A 4DP5X 1BWWA 1ORSB 5I1HH 3QUKB 4Z5RB 2WVUA 2AQTA 1TR7A 1CFMA 1E6OL 2PTTA 2DQTL 4X7TB 3EYQC 5E0FA 4LFHG 1QNZH 4GRMA 1NDMA 2JELH 4HIIA 4LKXA 3A21A 1S2EA 2D4FA 4AEEA 5IJBC 3FZUC 3VH8B 5DS2A 3L3JB 2EUWA 5HHOA 1H8NA 2KERA 3BWZA 5D8JH 5D1QE 3OVUB 4BKLA 4B0AA 5SX4H 3KBFA 1MJJB 1TNNA 4Y4KD 1PPIA 2Q76B 5JDJA 3FUDA 1U8NB 2EVJA 1N19A 2WGNB 3CN4A 3VWJD 4NCC1 2Q5BA 3QI9A 1M57B 5CU9A 2CBPA 1AO7E 2OMYA 3PNWB 5DJCB 2IWKA 1S7SA 4WI4A 4PJFB 2BW5A 5DI8A 3N1PC 3F0ZA 4GMTH 1VCAA 2Y1YA 1XEUA 2NOEA 1A5FH 2IWEA 3ESOA 1AZNA 1TMQA 3NFPA 2HJKA 4UQ2B 3P0VH 4JHAH 1G6RA 2BY2A 4LMQI 4ORZC 4ZS7H 3LQZA 2NW3A 4BHUA 1JYXA 2QHRH 2E9BA 3TEUA 2V2XA 2X89D 1QD0A 4H7VA 4LL1A 2GI7A 1KJ2H 4NUGL 4ODUA 4G5ZL 3ECVA 5DR5H 4HJIA 1I3GL 4L4TB 4P4KB 4XZUB 3MLUH 1CFSA 4M7ZC 1ETZB 1OAJA 2XJLA 1UM6H 4F80A 3EYUH 1LDSA 2ZPKH 4B97A 5FGCE 3LRKA 2CIKA 1JNJA 1NGXB 3WTXA 1RLBA 4G1MB 2FGWH 4JFSA 4NQXB 4P2RB 4CC4A 3SYAA 4NN6C 5FK9B 3GGWB 1QEWA 2NY7L 2OMZA 3IU4L 5I74C 3SPIA 2J1YA 3OR6B 1ZT4A 3RDTA 4F8OA 3CLFL 5SWQB 3QIWC 3GI8L 4G8IA 4LCWB 4KTDL 3L9YA 5C92A 3TT3H 5D1ZI 4PI0A 1VFAA 1RZPA 4RLDA 1U92A 2WNXA 3M17A 1ZA6A 3GMRA 3WJJA 2HJFA 3UEQA 4AT6B 1BFVL 3QQ9D 3CU1A 4YDIL 3ZRCC 1PSKH 4J3SA 4F9PA 1SYSB 4OGXH 1J5OL 1NANH 1M3JA 5KBNC 1GGUA 5F88B 1T2JA 1O6TA 2B15A 1IT9H 3LKPA 5CCKH 4K15A 3LEYH 3ULUH 1K35A 4ZUUB 3BAEL 1P5UA 3LZFL 3EOTL 2LW3A 1QFWH 5DRWA 1QWUA 3DTUB 5I1IH 3I9GH 1OL0A 1N0LB 3W0WE 4L8DB 1PZ2A 2H8PB 3SDDD 2XVKA 2X9ZA 3AY4C 3WDJA 3OMAB 1XTLA 1H8OA 1SXCA 3MQIA 1S7TB 4JE4B 1T04A 3QCTH 4PLKD 5F7DA 5T5FH 3QIBC 1N12A 4PJFE 1A6UH 4MDJB 1F11B 3FW6A 5AW7B 3O8XA 5DGQA 1N7MH 2EEFA 2RGSA 4JN1L 4OZIF 2VDRH 2WSKA 1HOEA 3TOPA 1JPGB 1GW6A 4XP1H 3VRLE 2R2HA 5M95B 3NAAH 4HZAA 4BUGA 1TTCA 4Z7QB 3GIVB 3TVMA 4X8GA 5CXPA 2YD4A 5JXEA 3GXMA 3DV4A 2EKSB 2WINA 4WNSA 4DT2A 3RNQB 1WAAF 3STZA 4IBTA 1NEUA 4M7ZB 3VD3A 3FC8A 4L4TE 4JRXE 1M9SA 4M03A 2D7PA 2YD1A 1BA9A 3JWDC 2WUBL 1SMDA 1J8RA 3EH4B 3SHSA 2X2HA 5AOLA 2E7BA 1H0DB 3LAFA 2XIIA 1TQUA 3FCTB 3VXMA 2Q6WB 4MXWL 4NN6B 1QOKA 4OGAC 1M7XA 1B9ZA 1A6ZB 4G6KH 1TQVA 1JERA 3INUH 1SMOA 5I74B 2XQ0A 1ET8A 3D39B 1WGVA 4KZEH 3QIWB 2Z35B 4DN4L 5BOPA 3LNEA 1A8JH 2DMCA 3POHA 2DWDA 2WQAA 1KJMA 3D3VB 1QSFA 4B9CA 3BVXA 3VGGA 1UT4A 1IZKA 4RODB 3GHBL 2JVUA 1FGNL 1XSZA 2X87A 2BFVL 5DC0A 1FNSH 3RILA 5DHYA 3UTSE 3Q2VA 4ZOAA 2XWBA 1R3IL 2QBWA 1DUZB 5E1IA 3S48A 4B5ZA 3QO0A 3IU3B 2P24B 2C26A 2XFXB 4G9FE 1PD1A 4ABWA 1MCNA 1EAPB 2NZ1A 5I1HL 3MNWA 2GBTA 3UP1A 5DYFA 5ALBH 4G80B 2BVYA 3MUZ1 2EVHA 1QNZL 5AUMB 2JELL 3BE1H 3ENCA 4FHBD 3OL2A 3B2PA 1UWGL 2QSQA 1ZA3A 2NMSA 5EO1B 2YWZA 3GSXB 5D8JL 3KPOA 4I18C 3NP3A 1YEDB 3MREB 2EIJB 3BWUC 4G8EB 1DSFH 3QIBB 1Z3RA 1OZUA 3QAQA 1SN5A 1U8IA 1X5YA 2A3TA 1H15A 5AB1A 4P5MB 4IKKA 2HP4A 1AVAA 4KJYA 4Z3IA 2V5TA 3TTYA 4GMTL 5B7EA 4Y4KA 1A5FL 4X4ME 4D0CA 4NNXB 3VWJA 3P0VL 2V37A 4JHAL 2Z93B 3D2UB 2JKIS 4ZS7L 3SE3A 4LEEA 1EHXA 2QHRL 4NLHA 4YSUA 1YECH 2NT0A 1JK9A 1CG9B 1Y6KR 2FATH 4XCFH 2X4NB 1I7RA 1PTZA 2PP9A 1RI8A 3KG5A 1KJ2L 3N91A 3MNDA 3KLHD 4H4NA 5DR5L 4U1SA 1YNTA 4KGJA 4NKQB 4BUHA 5LGJA 3AQDA 4OF8A 2DICA 1DVSA 5AD0B 4UNTA 3MJ9H 3S35H 5L9DH 2X89A 4NQEB 2R9HD 5ESQB 1UM6L 2KQNA 3EYUL 3HUJE 1S7XA 2ZPKL 1GKEA 4OQTA 1YEKH 4UQ3B 1UJ3C 3TDHA 2AZAA 3MHZA 2HG5B 2R1XA 5B1JA 2KLTA 2FGWL 4MS8D 3QEHB 2YGNA 3VG0L 2C34A 3MROB 4UTAA 1YG9A 5MHSD 4W9FC 1L9TA 1MW3A 2D9QB 3ULVD 4L3FA 5FYKE 1I82A 1YY8B 3E0GA 4UU9B 2DM2A 3DOSB 2GIXA 4HU8A 4CNIB 3BLPX 2D3NA 4Q97A 3TT3L 3OKMB 4H0IA 1SYVB 5C0JA 5E24E 3WIFA 2WWKO 4DOHB 5EIIA 1XF4B 3M6DA 4NFCA 4I1NB 5I0XA 3SKUD 1HHGA 2OTUA 4N2MA 2BOCB 4MD4B 1VADA 2ZOTA 2Z0FA 1S46A 1ETJA 2E5EA 4OGXL 2NX5B 1ZVSA 4OCMC 1F3DH 5DYOA 4BFIB 2GT9B 3BPCA 4JJHA 4I18B 5C6WH 2BP5M 2GC7C 1SF3A 5JHDB 3OG4B 4L8SC 1IT9L 5J1AB 3L3HA 2X1OA 3LEYL 3ULUL 2QVFB 4JX0A 2ZZUT 3UBHA 1ZS2A 3GPEA 1WH0A 2JHJA 1KTKE 2JHNA 1QFWL 3V8CA 1IM3B 2CLVB 2FLRT 4M3KB 4LPXA 5D55A 5I1IL 1FL3A 1KXTA 3I9GL 1ADQH 2G2RA 4K9EH 4R4FH 3U82B 1AQ8A 1WUZA 3QJUB 1ZHNA 3CX2A 2VH5H 5I75B 1OKEA 4DO6A 3GUTA 4Q56A 1VHPA 4Q8BA 3MBEC 3MNMA 5T5FL 3QCTL 43C9A 2XA3A 4FHJA 3SPVB 1A6UL 4X4XB 1Z0MA 3OWRA 1NGQH 2MJWA 1PLAA 1N7ML 1PZ5B 2LLLA 2VDRL 1IIKA 2WMPA 3D0VB 1K72A 2RQEA 1G7IA 2R29H 4XP1L 5FDWB 2H5UA 1F5WA 3WNIA 5I16A 2NCMA 3U6RB 3NAAL 1NLDH 3CFUA 4YXLL 3LNGA 3SDDA 1NJ9A 4ZSOE 4TTGA 4OQ1A 3BUIA 1UT1A 4U6VH 5CF3A 2F0CA 3ZTDC 3RTQD 3VFTA 2BXZA 4MRQA 4ELDA 2XCMC 1TQWA 3RUGA 4MNGB 3FQRA 3QORD 1PFCA 4N2BA 2H32A 4RDQF 3JWNH 4D9LH 1UJ3B 3KD4A 4WI6A 4UF7C 2VZ1A 3WNMA 3CAFA 1N59B 2Y5TA 3RI5F 5IJKC 1HHJA 3QB7C 3PABB 1KUMA 1P2CA 4M8QB 1Z1WA 5PAZA 1JVLA 1FJ1B 4G6KL 3INUL 1U58A 2WYZA 4MQ7B 3WS3A 4N0YH 3RAJH 4AKQA 1VTOA 4KZEL 1R5IB 4E9SA 1ZT1A 3MRHA 1FFOB 1OVZA 3N44B 5CD3A 1PKOA 3QDME 1CU4H 1NC2B 4E42A 3FO2B 3QNZB 3U1QA 4K3HA 2ZKWA 2CUMA 2JKRM 4CW1A 3NRPA 1FNSL 4HSQA 5CSZA 1DDHA 4DOHE 4N8UA 1A66A 2CDGB 3GS7A 3ULSB 2EIZA 4XWOD 1QTPA 3QCUH 2XWEA 4OLYH 1FZKA 4FC3E 2JK5A 4JCLA 4Y9BA 3ILQC 1NFDF 1B6DA 4A7SA 4ONFL 1H9VA 1G6RH 4L8SB 5A6MA 2BWQA 3LKSA 5TDNA 5ALBL 3ZOAA 4EJYA 1OLZA 5JHDE 1LNUA 4CL7A 2HL9A 1U30A 2RR3A 4V1DD 4L29B 3S3SA 1W72A 4J3OH 3VTMA 4E41D 1E50A 1O6SA 1MDAA 1M1SA 2AABH 5AKTA 1XF2A 3MBEB 3CXFA 1DSFL 5DFTA 5FYLD 3WEOA 4JFED 1OWWA 3HN3A 2QQLH 4IM8A 4WU5A 1NIEA 32C2A 4BCZA 4JCWA 4K73A 4XXDA 4BH7B 3K6FA 2JNZA 4EIGB 3SY6A 3KYOB 1RV6X 2PCXA 3ESUF 3SGJA 3F00A 2P5EB 4X8XA 4PY7A 5KSAC 4ORGB 2APTA 1WCQA 3EOAA 3MMEB 3RYMA 2O1AA 5IW6B 5IQOA 4LLYB 4E9WA 4UV4H 1B6UA 5JHLA 1RD6A 1RJYB 1YECL 4BD4A 2FATL 4XCFL 3P9MB 1TYEB 1K5NB 2CO4A 2EDKA 3N40P 3VXUB 4ZX6A 1RK0B 1E4WH 3QEUA 2P46B 3U83A 2VKXA 4QTHA 1PAMA 4X9FA 2YFNA 3S35L 1KOAA 5L9DL 1PNCA 3ME0A 2F8IA 5DD3H 5FCSH 3DGCR 1T21A 4GW4A 1UFGA 4TOYH 1YEKL 5C3TA 1RUKH 2P1YA 3VGFA 5C0NC 1A6TB 4J8RA 2X44D 3QA3A 3S2AA 1XCQA 5JHMA 1HN1A 1UZ8A 3MFFB 3AREC 4QRQB 4Z7NF 1ZVNA 1HWHB 3RX5A 4YDVB 1KT2A 4Y16C 1KG0B 3DARA 3K72B 4KNQA 4FTVD 2Y24A 3FB5A 2IFGA 3GO1H 4BUQA 4M4RB 3KMDA 2N3JA 4OZHF 2Y8LA 4HBCH 4FFZA 1AD9B 1Y18A 5AVSB 4XNQB 3DRTB 4F7PB 3OLPA 1QHPA 2YPVH 2YD5A 1XZ0B 3D52A 3L4WA 2NVMA 3TBSB 5FKPB 1A4BA 2ADJB 3FONA 4GEJA 5BQ7A 2CMRH 2QMJA 5G4MA 4KUZH 4N8CH 3UYPB 2E9WA 2HTKC 1AGFB 5CUSH 4A2EA 1MJUL 3BC9A 3W82A 5I1EH 2QGCA 3DX7B 1L9RA 3MRRB 4R2GD 5IYBP 4L8BB 1E67A 5D70H 4F37K 1XVSA 1P7BA 1NUDA 2YAOA 4BBWA 1WCBA 5C09B 2NNAB 1G7PA 3W5MA 4PPTA 3VMNA 2HWZH 1ADQL 4K9EL 4OCLC 4R4FL 4I9WD 2JE8A 2VH5L 3T8VA 5KSAB 1XGRA 3IGAB 1TO5A 4U6YA 1NGQL 3WLWC 4JZNB 4ATWA 1XF1A 2P5EE 4YHIA 3V0IA 3CH1A 1RZFH 1I3RA 2GFBA 3QUMA 2R29L 2HUHA 1I3UA 1NLDL 1P4LA 1AGDB 2DL9A 4JY4A 3RWCB 4U6VL 1JHTB 5JHAA 3MX0A 4MLIA 1JHLH 4Y9EA 1ASPA 1Z9NA 4KRPD 3FCUB 2A9BA 4H1LA 3CFTA 4PIRF 5KOVC 1QNIA 2J1XA 4UWQB 4TUOB 2O26U 3THMH 3L45A 4FI8A 3TGXA 1KPUA 1PYWA 5JIMA 1SY6H 3RTQA 3ARDC 3KYKH 1NM9A 4HFWB 4P5TD 4OJCA 1CFVL 3QORA 1ONQB 2AVFA 2F9BT 2E74C 1I8KB 3AREB 4MAYD 3U6XS 5DJ0A 5HGBA 2JIXD 2ZKMX 3L48A 4Y16B 4JM2C 4N0YL 4N6RB 3RAJL 3VFGH 1C9BB 1WT5C 1C12A 2C4FT 3II1A 4FHKA 4XH2A 3K8KA 5BW7A 1CU4L 3QJRB 2OMUB 3TZVC 3LKRA 3TO4D 3UBXA 1LHZA 2F61A 4ZO7A 4LK4A 3GMQA 4R3SA 4XVOA 5C2UB 3HMWH 4OLZH 3UZQA 5I9QC 3QYMA 3QCUL 1HU8A 4OLYL 4KVCH 3Q8FA 4L1DA 2FLMA 3KPSB 3WY2A 3LV3B 3VI4B 1G6RL 1JV5A 3F64A 5CN1A 2R2BA 4BYHA 2X6BA 5H2BB 3QXTA 2H9GA 4YNYA 5AW6B 4FTDA 1H3PH 5CMAA 3O3AA 4R9HA 2F8OA 4R96B 5AVRB 3ILPB 1N10A 4KQ3H 4LXFA 3CVCA 4APQC 5FYJU 5C09E 3FAWA 3PF2A 2OYPA 2IWFA 2W60B 1T89C 3HC0B 2IPTH 4V1DA 2QQLL 3MRQB 1LEGA 4QRSA 5F44A 5JQ6H 3L9RB 5E8PB 2IPUG 1ZJBA 5IMKA 4OQTH 4ZQKB 5GHWL 3PFQA 5HDBB 3BO8A 3GTNA 4E41A 2X7LB 3UPRB 2OAAA 3EKCA 4HAKA 4K5PA 4UTAH 3HCVB 4JFEA 4Q74A 1WQAA 3NFNA 4P9HH 4OH2A 4AVIA 4UV4L 1UB6B 1IGTB 3FQYA 4HGWA 1BBDL 2RALA 2QTEA 3HKZA 3Q5YA 2W1NA 2PYED 5KS9A 1N26A 5IOPB 2QGEA 4BE5A 1VKLA 2YD3A 3ARDB 4DGUA 4JDZB 3D4YA 5EOQH 1E4WL 4XPAH 2EECA 1HH9B 3NA4A 3D4CA 4M3JA 3GMMA 4WAFA 4WV1C 1T5WB 4HLJA 1D5ZB 2XKSA 2EDJA 2E6QA 4JM2B 5DD3L 3S36H 3QFJB 3RGVC 3QDGE 4OFPA 4TOYL 3CSBA 3FTXA 4LQ1A 1RUKL 4U1HA 3FQNB 3V0FA 3H9SE 1OCOB 3FB8A 2W0FA 4HIHB 4N2NA 4HG4K 2IPKB 4C7PA 3TZVB 2BERA 1BFTA 3GS4A 3F5WB 3PS6A 5HHNB 4O2EB 2WP3O 3RRQA 1X4YA 2WWKT 1CQKA 4RZCA 3WGUB 2Y0SA 4HBCL 4OM0H 5I9QB 3RWJB 5IVZA 3F05A 3UJTH 3FO9A 4GXFA 1PCJX 2RMNA 2VLJD 3KLAB 4PH8A 3TBTA 4EOWL 4UBDC 2F54D 2YPLE 1S7RA 1N6QH 4HUUB 3L2NA 2YXVA 1XMEB 1A1OA 1AC6A 1T7WA 2VAJA 1NICA 4FTVA 3VI4E 2PPCA 4YH6A 5ESVB 2NOBA 2CMRL 2BC4A 4NQVB 1X4ZA 3QAZC 2K6YA 4ZT1A 5A7BA 3DVFA 2EEDA 5CUSL 1KC5H 3ZL4H 4BINA 1UT9A 3NK4A 4DUWA 2JJVA 4X7EC 1JXJA 4APQB 4J2XA 1UD6A 5D5MA 3P2TA 3MLXH 4RQQB 4ZPVB 5MP6H 4TQPA 4IKLA 4JY5H 4OFVA 2H32H 2OXGA 4HS3A 2Z91B 3I6LD 3FU5A 4G6FB 4X50A 3ZDYF 4LQFH 1E5UI 2O93L 4LKCA 6PCYA 2ADIB 2HWZL 4HGMA 5D4QA 2DL2A 5DS1A 4BKSC 5HDBE 2PPAA 4FGMA 3CZNA 4QHUA 4HKXB 1JD7A 2MTAA 5LN8A 1RZFL 2JMRA 2FEDD 4NKDA 4A55A 1U8PB 4B9PA 3DIFA 3VD9A 4ETQB 2E76C 2K45A 2HT4D 2ERJC 3MV8B 5DSCA 4PRHB 1JHLL 5C0AE 3DX1A 1RJZA 3MRBB 2WLMA 3VGHA 1UXWA 2NY4C 5D2NC 4WV1B 1X6LA 4C57C 1S7VB 3BN9C 1TU2A 1GW0A 3RGVB 2V2WB 3IJEA 5JR1L 1D6EB 2EDMA 3OAYH 3THML 2WXQA 1MCLA 1CD9B 1JSYA 2LOEA 1KENL 2IH8A 1BSIA 3DGGA 3KYKL 3SE6A 5CGYC 4PJXE 2BP8A 1WZAA 3QULB 1LXMA 1EPFA 3V4UH 4L5FH 1HK6A 2Q8AH 2VUKA 1X5XA 2YUVA 4QHKJ 5CNHA 4I0PC 3CNKA 3ROLA 1W72H 2B1AH 2OMWA 3VFGL 4OSUH 2BPBA 1D6VH 1BBJB 4K9JA 3QZMA 4KO5A 4UANA 4PV9B 3H4FA 3QJVB 2EYSB 4P5TA 3QZNA 4XMPH 3KXFD 5DS8B 4MAYA 2DTMH 4HUWB 4PJHA 1S9VB 3FTUA 2JIXA 4WQOA 4BKTC 4FKEA 4O2FA 5LWYL 3MRJB 4I0CC 1MPGA 3H6JA 3QAZB 1MIMH 4RA3A 3WNPA 4KVCL 3VFVB 1QNBA 4FQCH 1FNEB 1M71B 2N7BA 5GSVA 5ICYB 3ULUE 1F6AA 2ARJB 2A6IA 2P8LA 5E8OB 1BJ1H 3QUHA 3TO4A 3QQ4A 1Q9LB 3FFOA 3HHMA 1H3PL 2XVBA 4NB7A 5JN5A 2WVSA 3TBCA 3PHOA 5L4FA 4KQ3L 3MRIA 1XGQA 2X05A 4PWGA 2V2TA 2NOLA 1BD2E 1G7HA 1QFUH 5GGSB 2IPTL 3L3GB 4K9EC 5JQ6L 3COOA 1WISA 4M5ZH 4OQTL 1WG3A 1VZIA 5DVOA 3U4BH 2I07B 1F13A 1JGLH 2Z31C 5JW5B 5GRJH 3JTTA 5IHZB 2NNRA 3L4TA 2ERJB 2YKLH 3SQBA 3T2PA 4UTAL 5KW9H 1CO1A 4P9HL 1MH5A 5DEFB 4NRXB 1JZHA 1OF2B 1DSWA 2HMID 2NY4B 5D2NB 4WFGD 1OD9A 2BRQA 4HK0B 1OW0C 1QQDB 1A0QH 1DE4B 3CN2A 2NCEA 3MOQA 4FFZH 1CF8H 1IC5H 2JB6B 3HR5A 5FM5O 1YJDH 3IFPA 5KBDA 4FE9A 8FABA 4N90D 3EH1A 2ZP9A 3KW7A 4OFYA 4NERA 4XPAL 3X1GA 3ULVH 2ICWJ 3RVXC 3MA9L 3T0AA 1UENA 3VXSA 4I0PB 4OD3L 3U48A 1IKFH 3BD4A 4FJZA 3RWIB 5HHXH 2HL8A 2PYEA 3S36L 1LP9B 1L5GA 2WVTA 1S3KH 1WA0X 2VIRB 2H2SC 1DJSA 2R0ZH 1T20B 3UZEA 2A99A 5E9AA 4D94A 1U3HC 4Z78B 5C07D 5CP7A 1UUNA 1KXQE 4Q6IA 4DCQA 2Y7NA 4JL2A 1HZHL 3EO9H 3WFEH 4HOMA 1KLUB 3DIDA 4PJ6A 3JT2A 3NDYE 5KSBA 1CURA 4F7TB 1OTSC 4GW1A 3WDIA 4EQ3A 4OM0L 3DYMA 4KMTH 1B4TA 1N9PA 4ZD3L 2EDHA 2WD0A 4NIKB 2N59A 1TETH 2MCAA 2NSMA 4LF3A 1N6QL 3SKOB 2XBTA 2VXSH 3QUMH 4A39A 1RJLA 2XJKA 3CCHB 5K33A 4OCSH 3WAJA 3OMZA 4BFBD 2Z1KA 4PSPA 3VB8A 4PWEA 2VLJA 3K6SA 1KC5L 3ZL4L 3DVIA 2ZXWB 2F54A 1WYJA 2CKBA 1V55B 3OKEB 5D93C 4YZFE 3MLXL 2Y1AA 3NCCB 1T4WA 4J3OC 2VLKE 1BX2B 3CXHK 4H1LH 1KTCA 2KDYA 3KPRD 1AMXA 5ICXB 1XB8A 3ES6B 4OCNC 1HOCB 1KLGA 3LRMA 4LQFL 4U1LB 1JK8B 2UZXA 3K0YA 4HQQH 4JAMA 4AY0A 1KTDB 5CINH 2J57A 2Z31B 1BQSA 3CLWA 3PRZA 2FIKB 2VWEC 3RKPA 1KYAA 3L9BA 1T80A 3TN0D 3NCBB 2V5RA 1YRKA 2VISA 2P47B 4JO8A 1EIBA 4CC4C 3G6AA 2DKDA 3IJHA 5AZEL 3VXRB 4NC0B 4YSDA 4DESA 3OAYK 5T1LB 4ZZKA 5CJ8A 2K8QA 1RL1A 3KGTA 3IPEA 5D2NE 4BFOA 4HUCA 2VRAA 4ZW7A 4Y2DD 1ZSDA 1XXDC 5AVWB 1KY6A 2BIHA 1HDMA 4HK3J 3AXLA 1I4FB 4FYQA 1HEZA 5DZLA 2FX8H 1KBWA 4BA0A 4B27A 2Y6SD 3LH8A 2VZTA 3Q3GA 3WFCH 4N3UA 4HIIB 2BMKA 2R0KL 4LKXB 1U3HB 2WAQA 2UZYB 4NXSA 4WIQA 1LP9E 5FPIA 1EZUA 2XZAL 1CGXA 5HHOB 3V4UL 1M7DA 4L5FL 3ZDYB 1P6AB 1R6VA 3U2SA 1CE6A 1D5XB 1L4IA 4O4YH 4UM9D 5E9DB 4BKLB 1K85A 4G8AC 5ACMA 1W72L 2B1AL 3T6ZA 1VFOA 1A1NB 4FXKA 2XYCA 4BZ2A 1OARH 3TYGH 1D6VL 1J9RA 1N8OE 4Y2OA 4XOAA 2OMYB 4UQIM 4IHOB 4NHCH 4XMPL 1S7SB 4JQVA 2DTML 4KBPA 2J4WH 5IFAH 2B7DT 1RP8A 2GEEA 1T1ZB 1T4KB 2HX9A 1AR1C 3P02A 4TLUA 5ANME 1LDPH 4K5MA 3OSKA 3B1UA 5EZPA 3O8XC 3WKPA 4WGWB 4YSSA 4QD2E 1MIML 5FYLH 1UWEL 2QVKA 3BAJA 1JRHH 2YZ8A 3KXFA 3RWFA 1T0OA 2V2XB 1Q1PA 4FQCL 4L37A 3SB3A 3VD2A 2PCPB 2WZ5A 5D93B 2O61B 2B59A 4M61A 2F7IA 1LE5B 3O3EB 4GBXC 5JHLL 4M8VA 3Q8EA 3VDBA 3APMA 4CADB 1CI5A 4F91B 2HLAA 4HIQA 2XN9A 5J7CC 1ZANH 4G8GB 5I8EB 1RU9H 4GKSA 4F2MA 1CFSB 1L9SA 1IILE 4NRYA 3LPOA 1QFUL 5E03A 5IGXH 1E8ZA 1TVDA 2PW2B 1OGAE 4ODWB 3B6SA 4OKVA 4FFWC 3QUXD 1UB5A 1MCFA 3C5XA 4M5ZL 3VXQA 3LCYA 3BAYA 4I77H 4ZAKD 4EF3A 4FI7A 4PJGA 3U4BL 4PGBB 1CWVA 4IMLA 2OMZB 1JGLL 5I2IA 3Q01A 5CEXA 4LHUD 1QR1A 2HRGA 4N2GA 5GRJL 5FR3A 4PG9A 3L3DB 1AFVL 5DZVA 4TNWK 2VUOA 4MD5A 3IETA 4ZW6A 1A4KB 4WVRA 2GEQA 2VCOA 1A0QL 3GZKA 3JWNE 3M17B 4FFZL 3GIZH 1ZA6B 4NKIH 3CW7A 1CF8L 2YC1A 1IC5L 1FPTH 2HJFB 3QJHA 5BPPA 1YJDL 2O5ZL 3CXDH 3PL6D 5G4NA 1D9KC 3BX7C 1WPCA 2IEPA 2VDMH 3GPSA 2FWSA 4A7GF 1WA1X 5I1AB 3ULVL 2FQGA 2WBXA 5IJDC 3FKUS 2WLJA 4WU7B 1IKFL 3UTQA 4CVXA 5HHXL 3W39B 2QPUA 5HHOE 4J1UB 4H20H 5I1CL 3T6QC 2R0ZL 1MFMA 2F1AA 2V92A 1IAOB 3JV6B 4QR7A 4DHLA 3LKQA 2VDQH 4G3YL 2Y2TA 5TGBA 1B3JA 4AVJA 5C0JB 1E43A 1CDUA 2AQRA 3EO9L 5F7DB 1AR1B 3DIVA 1B4JH 3O8XB 3EJQA 1XCTB 4PTTA 1G1OA 5EOCJ 1GKOA 5C07A 3F58H 4KMTL 5AW5B 3T2NH 2R2HB 3V0GA 3IF1B 5T1MB 1TETL 3U1PA 1T22A 2X9YA 2H3XC 3LMJH 2VXSL 2NY6C 3QUML 3DV4B 4GBXB 3MRMA 1NFIA 3E7JA 4P3CH 4W9ZA 1BZEA 2A1WH 2NY0D 1CDWA 2JJWA 1JZ5A 3GI9H 4OCSL 3STZB 4OGYH 1CGYA 2WM0A 3SE3C 1MY7A 5D1ZC 4DGIH 4ZI8A 1CLVA 2I27N 1RZ8B 2BSDA 3GJEB 1BLNA 2Z7UA 3TPUA 1BLIA 3N0PB 4QYOB 1SXZA 5AVUB 3TBVB 4AXWA 4D9QE 4RRPA 4HQQL 5ERWB 1AZVA 5CINL 4HH9B 2Z4QB 4MSWB 1Y07A 3V52H 3ZTJG 3EG9B 1FV1A 5CJXA 3TA4D 4YHNB 2E4FA 2PPDA 3PWNB 5C0GA 2C7UB 2N1TE 4PVBA 3KPRA 1V10A 3IJSA 3T0XA 1KJMB 5B1JC 1E8XA 2YSSB 2R0LH 4J6IA 2NTFA 3H54A 3B2VL 5DHYB 3F7PC 3TN0A 5KAQG 2XWBB 1D9KB 1AR2A 2NQDA 2VMJA 3TIDA 1DQQA 3SDAC 2DIBA 3AU1A 2FX9H 3LHAA 3W5NA 3K81A 2D3VA 3BRDA 2NY2D 2EUZA 2FX8L 3EJPA 4C4KO 1AS6A 5I18H 1YEJL 4QHKI 2OXHA 2B08A 3I9IA 3WFCL 3EJSA 1H3WM 1K2DB 4Y2DA 3ZDWA 4DGVL 4BSWA 1E5AA 1G87A 2BZCA 5D2LF 2XWDA 3QWRD 4D7QA 5JOPE 2FQEA 3OPZH 1TQCC 4FNRA 4HPOH 4K7PY 4G7SB 4O4YL 4TULH 5IYCP 2GKIA 2D7MA 1HAUA 1OARL 3OSEA 3TYGL 2Y06H 3QQ9C 3UO1H 4ZNEE 4QRFA 1SXNA 4U4BA 1I7UB 3RA7H 2E7MA 2QADC 4NHCL 4PBWD 5FA4B 4IOIB 2VJ8A 2VZUA 5EBLB 4UM9A 5LGYA 1T3FA 2EIMB 2J4WL 4UM8A 5DHMC 1WRFA 2NY6B 5TF1H 4D0CB 4IRSC 1SOQA 2CO1A 2A6DA 2WLIB 3QUYC 3ROOB 3HEIB 1XH3A 4NHUA 3VG9C 5D1ZB 5EORL 4EAGA 4PG2C 2VR7A 4NJ9L 4X0NA 1IM9D 3DXAD 1AXIB 4PLKC 6FABH 4JKWA 2W81C 1KPRA 5CZRA 4KHXH 4PRNB 2K8MA 1QBBA 4G9DA 2X2YA 1ROCA 2V9TA 3GRWA 4N8PA 1OY3B 1ORQA 3FO1B 5IB3A 1ZANL 3OXSB 4NWUL 1RU9L 5HD8D 2OCJA 1EWHA 3VXME 1YUHA 5T8IA 1HIMH 1MCHA 5GGSY 3HN5A 4JHUA 2B9BA 3PREA 5ES4B 3KW8A 5IGXL 1BF8A 5E99H 4XNYL 3TE5A 3DVGB 3Q6FA 2XKUA 3GC3A 1QSFE 1X7TA 3PGFH 4AUJA 5K9JH 4YSQA 1OSZA 2CJSA 3C9NA 4X9GA 3QG6A 4L0PB 3QWQB 4XNUH 4RVBA 1V7NH 5FLUA 2W65B 2G0KA 3QUXA 1DVZA 3WJMB 3SDAB 1P5VB 3BQVA 2YD7A 3WO4C 1O7DE 4ZAKA 2PCFA 3EYVA 3VSVA 3OZKA 2F5AH 1CTNA 5CD5D 4LHUA 2OSYA 3GIZL 4LMQE 2OMTB 4NKIL 3V5HA 1HHGB 1KPVA 1FPTL 2IQAB 2OTUB 1C4GA 5BMPA 2AVGA 3CXDL 4YDZA 2VDML 4TF4A 5HY9A 3MV11 4BSVA 3UL4A 3O41A 4PD4K 4G72B 4XX5A 4F15C 1NUFA 2GSIB 1ID2A 1TQCB 3M88A 5J6HA 4UTBA 4Z7VF 3L3HB 3F01A 3EUUA 4BFEA 1UD8A 2BP3A 3CZEA 4H20L 3US0A 3PL6A 3VWKD 5KJRH 3RIAF 2CKBH 4QRPD 1MREH 4B3EA 1AZCA 2NY3D 4K5NA 3ZZQA 2QADB 4PB9H 4XBPB 5EU5B 2BVPB 2VDQL 4ZG1A 4N2LA 2G30A 4HHWA 4LL9A 5I0ZA 3MI6A 4MMZC 5LBGA 4IRSB 4GJTB 1GRWA 1M6UA 3IDGB 4LBEB 1B4JL 4QNPF 3QUYB 3T04D 4AQ8C 5BRZD 2WMPB 1GXEA 3F58L 3US9A 1NGZB 1NGWB 3VG9B 1G7IB 3VVWA 3T2NL 3BRGC 2G75B 1MCKA 2YSTA 2K70A 3ZE1E 3LMJL 3HFFA 4G43A 2AV7B 1JYWA 3FT4B 4P3CL 5EF1A 2A1WL 3NYKA 3W11D 3WV0A 3KGSA 4GT0A 4LSVL 4YMPA 4YHPA 1B0IA 2LQRA 4N2FA 3OM3B 4XI5C 4HX1A 1WFNA 2ENSA 2BO0A 4PP1D 3HRPA 3QG7H 5BQDA 1ZLWH 4XMWA 5JA8B 4UAOC 1G1KA 3OKLA 4FQLL 2Y5TB 4U6HB 1N67A 3FYEB 4PJ9D 5DDHA 3VMOA 1USZA 4FFVD 3U1SL 1EBMA 3V52L 3AVEA 2BNUB 4EBQH 2C1OB 1VCBC 1QR4A 4PRID 3UMNA 4L1LA 1P9MA 3D4ZA 2X2JA 1GIGH 1ZT1B 2KLSA 2V9QA 1M9WA 2P8PA 4BGLA 5CD3B 4BZ2H 1SBSH 3LB6C 2R0LL 4E42B 5BZDA 3MZTA 5GGVL 4L4JA 4R7DB 3FTGB 3FQ2A 2QREA 5KSUB 4JFOB 1YTBA 4MS8C 3LJ3A 4KK5D 3QPQD 4NZRH 2FX9L 4F15B 2JK5B 4GP4B 2H3NB 4KFZC 3LKSB 1I7ZB 3BVNA 5TDNB 5I18L 5K9OB 1AS8A 1CXKA 3FTZA 4HIEA 3HG2A 5E8NA 3ULVC 2WWMD 2PO6C 3BZ4A 1V8HA 2O5YH 4WO4D 5G55A 3GSUA 3GMOA 1UM5H 4HHGA 4M62H 4JDEA 1U2HA 3KPLA 4PBVC 4TULL 4C58B 4HPOL 4QXGH 3U0PA 4MMZB 1BM3H 3VB9A 1U93B 4DEUA 3QH3A 2Y06L 5AVXB 3UO1L 2PABA 4DZ8B 4WU5B 2EAEA 32C2B 2M26A 5GS0C 3C5ZC 1Y7VA 3H7BB 4PBDA 1D5BB 3JV4B 3RA7L 1N18A 1P4IH 4ONOA 2D7TL 1DQJA 2ADGB 3L3IB 5GRVK 4B9ZA 4PY7B 5TF1L 2LFEA 5IREA 2YWYA 2FH8A 2EIDA 3EOAB 3U9WA 4GI6A 5I15L 2AEQH 3FH5A 4YE4H 5DURB 4HWEL 5JW3H 2EZ0C 1TSRA 3OZ9H 3UYRL 3WNJA 4MRCA 3RUGE 2HPOA 1HCVA 2ICWA 4HWUA 2VDOH 4IU2A 6FABL 4UAOB 4AV4A 2GABA 3BWAA 4KHXL 3QIUC 5GRVL 2VXQA 3NT0A 3QEUB 3RVVD 5E8DH 1T1XB 4QTHB 2O30A 4BFJA 4HJ0D 3I3DA 4J3UA 1PIGA 5DZNA 4QLWA 3KDMB 5D2LB 1HIML 2VDNH 2XTLA 1OLLA 3LKNA 4GW4B 4TNVK 5TD4A 1IM9A 1WBXA 3DXAA 2E3VA 2OR9H 2CXGA 3DK0A 1JJUA 4TSAL 5F0LB 3V55A 5E99L 3CMOH 3IXTB 1U41A 4J8RB 1EZSA 3HS0A 3P69A 4JKMA 4J3XA 5BJTB 3VRIA 3U79A 1UZ8B 1LEKA 4QO1A 3CC5B 4A6YA 1L0QA 2YBRA 5DJAB 5C6TH 5K9JL 4UQDA 1HHIB 3FT0A 2XQYG 3WSQH 1NH6A 1CB4A 2CGRH 5JMOC 2VL5A 5DJXA 3FB5B 2VJ0A 4XNUL 4F7EA 1E5BA 4EKJA 1V7NL 4EI6B 5GRWA 2PKDA 2VZOA 3OSTA 1MF2H 4DSYA 1O6VA 3JYBA 1JWUA 4KOBA 1A02N 2F5AL 3HZMA 4DJMA 3D4VA 4NO5B 1IU1A 3N1MC 4KI5F 4XVUD 2PO6B 1SEBA 2FJSA 5BQ7B 2F58H 2QQQA 4WUUB 5B8CA 4DQAA 4LL4A 4L5FE 1P69B 1JF1A 3RG1C 3WFBH 4I88A 4LESA 4XPFH 1OAZH 4XX1E 3UBXG 1E4KA 3UGUA 2I60H 1UFUA 4ENED 1LK3H 3ARGD 3G6JA 3K6IA 3C5ZB 3O45A 2CKBL 3WKQA 3ARTA 1MREL 1OSEA 1WCBB 3AT9A 3FUMA 1H19A 3PHAA 1G7PB 4XWOC 4UYPA 4PB9L 5DJ8A 3VYPA 4ANVA 4B9YA 3ZKMD 4AE0A 4KZ0A 1ITBB 4U1KA 4HKBA 4FL4C 4X6CF 3ARWA 4HD9A 3HE7D 3VWKA 3QQDB 3EGSA 1KGYE 3B5GA 4P3DA 3TM6A 3CH1B 3DO7A 4QRPA 2GW5A 3SQRA 4KC3B 2VABB 1E4JA 3QUMB 2LAGB 5F7HA 2QV4A 2IXQB 5HYEA 5A1AA 3BVDB 1ZLWK 4AYSA 3ETBF 4XN9A 1RSFA 3UO8B 1CLOH 4ADIA 1HHHB 4FXLA 3GSVA 4GRLC 3QIUB 3ABGA 4QKXB 1W6WA 1KB9K 2BOBB 4H8WH 4WWKD 2YUXA 1X5IA 5BRZA 2WK2A 4G71B 4PGEA 2CDFB 5C9JB 3BYTA 5GRZA 5AENA 3OMNB 3PG2A 1S9YB 2UX6A 4IOFD 2ED6A 3GEWB 4WW2A 5KYNA 3O6LH 3QG7L 4Z7VB 5DRXA 4O9HH 3SDXA 3ZBMA 3P4MA 4CC1A 1ZWIA 3EDKA 3IGFA 4XVSH 3DK2A 3QHFH 2WLKA 4WI3A 4AYGA 1WHOA 5BXFA 5IK3B 1II4E 3OAZK 3CVHA 4EBQL 5FF6B 3K4ZA 4ZFOA 4LCVA 1KFGA 1S8DA 2R1WB 1GIGL 1C12B 4PJ9A 2ATKA 1SBSL 3DX6B 1SJEA 1I1YB 2Z8WC 2G4EA 4NBZB 1ANUA 2E7HA 4X9BA 4A2MA 4OFKA 1B9KA 3LKRB 5EPMB 4DP2X 2DJUA 5MHSE 4NZFA 1LK2A 5CO1A 1I8AA 4PRIA 1DQKA 2QR0A 3B9VA 3CZGA 5DMGD 4C4KT 2ZX8A 1GZHC 3WL9B 1I85C 2WQRA 3ULVE 1OHZA 3UZQB 1BZ9A 4NZRL 5B1CA 4OBSA 4WCYH 4BFKA 3NDZE 3VVVA 2WBKA 4ZMAT 2YH5A 4LE8A 3ZR5A 5KBMA 1VESA 4AGMA 4OD1L 2O5YL 2BCKA 1ZPLA 4HSCX 1J9QA 1FN4A 4M62L 1UM5L 4I3RL 3AW5A 2EIKB 5I6NA 2V7NA 1FIEA 2NDFA 1HINH 1N3AA 1U21A 2GJRA 2EYTB 3GRWH 3MO1B 4FL4B 3GB7B 4QXGL 3QEQB 1BM3L 1JXKA 3RB7A 3MLVH 1F2QA 4P04A 4V1DB 3QXAA 1LEGB 4QRSB 4WO4A 5GZNC 3M1OA 2KYIA 2YIHA 3BO8B 1DJXA 1P4IL 1UACH 1N39A 4CBPA 5A40E 4WK2B 4GRLB 3D0LA 3NFNB 1NEZG 1YPZF 5HGHB 5D7LA 1BVNT 5D9SB 2AEQL 2OL3B 1FYTD 4HGWB 4YE4L 4LHQB 5JW3L 1HILA 3OZ9L 3KPNA 4KGLA 1VGKA 2ZD0A 3VI3F 2K7QA 4BWTA 1SEQH 2WNGA 3SZKC 2VXUH 3QZWA 2FSDA 4LOFA 2V3FA 2VDOL 4QXTA 1CD0A 1FFPA 4B96A 4ZUSA 5FECB 1IFRA 3H3KA 2H0EA 3IXAA 3JV5A 2N1KA 4LZKA 4L1SA 1U4EA 3TFBA 4CDHA 4PJDF 5E6ZA 3U4EB 3IS1X 2XVLA 5I8CA 3SN6N 3WHXB 4JHWH 1DFXA 2VDNL 4U0RC 4OCRL 3WKYA 1T0PB 2XKNB 1OGSA 2OR9L 2J56A 4DH2A 3PJSB 4UTBH 4U1HB 5I1JH 3CMOL 5TDOB 4OF0A 3TP4A 5CAYB 4DPBX 3RPIB 1JFHA 1MFVA 5C6TL 4ZTPH 4W6XB 4R6UA 2DV6A 1QTYT 3WSQL 4EEEA 1BREA 2CGRL 5I8OH 5KVFL 2BIQA 4RZCB 1FF5A 3BPOC 3EO1B 4PJ5A 3T8XA 3O11B 3N5AA 1GC1H 5JTWA 4D7BA 3TBTB 3HZVB 3WMSA 2AQ2A 4MAYC 2VDMB 4I87A 4JE0A 3GMLA 43CAB 4AIZA 2NLVA 1NAMA 5DMJB 4Q4EA 5IW1A 2AXJA 4G6AD 4ZZFA 1HJCA 2AK4B 1R5WB 2RBLA 3HFMH 2L3BA 2F58L 4JFDD 5JMVD 3T9WA 5F9OH 3MRGB 2XWJA 4P5KB 5IIEA 3MOBL 1XSOA 2VO5A 4XPFL 1OAZL 1QN9A 2BSCA 4XPBL 2WLHA 4YSAA 2I60L 3X12A 3I50H 5HHVH 5IKCA 4HT1H 2GHZA 3EJCA 1LK3L 1HKFA 4XPGH 5L4JA 4LPUA 1KMGA 2X41A 4HS3B 1BVZA 1BEYH 1EAOA 1A4JA 1OOWA 4M1CD 4WNQB 4JFXB 2EACA 4V1DE 3TEYA 4WUKH 5E23A 3D87B 3PWVB 1AHMA 3S7GA 4E41E 1ZHLA 5BRQA 3ARGA 5IYDP 1F4XH 2Y72A 2CZNA 1LO0H 4NENA 3LPWA 4LVEA 4LPCA 5FYLE 1OM3H 3HC4H 4JFEE 4CSTA 3TNMA 4NKDB 2IDUA 4UNUA 4NNPH 1SN2A 3MSPA 4JRWA 5TQ2H 1P4BH 1CLOL 5EUKB 4NUMA 1IVTA 2DYSB 3BAKA 4TVPD 4XTRD 4DTGH 4CU7A 5IUSA 3HE7A 5F89B 1GJWA 2DLTA 2UXTA 4PWIA 5KS9E 4H8WL 5DZPA 4ZBJA 5LQBH 4K94H 1DBKL 4M6OH 1HCFX 2GSGA 1GH7A 1EZVX 1CYGA 2YAEA 4PS4H 1TU2B 2CRZA 1F00I 3IJEB 4PJ8D 4U0RB 3O6LL 2GAZB 4N1EA 2VSMB 2DQGH 3L4CA 2OFQA 4BDVA 5KYYA 3DGGB 3OG6B 4WWKA 3SE9L 2ZCHL 3QHFL 4X5WA 3G9AB 1NGYA 2OMWB 4NT6A 2J2ZB 5GISH 1KYUA 1SUHA 3B3IB 4JPIA 3BPOB 4K4KA 1T83A 3NCJH 5A6IA 4KQ0A 4X6CB 3WXWH 1FNAA 4K3EH 1PLGH 3O2WH 3NIGF 5F1KC 4GAYA 1JZ8A 1M05B 3EHBC 4R4NC 4MAYB 5GIRB 4DP0X 1DN2A 4PJHB 5F72S 5EO9A 4MLSA 5I0VA 3RNKB 1EDQA 4M6ML 4PJAF 4GUPA 3AMKA 4D8PA 3LZNA 4OZFA 4FTVE 4LSPH 3BP6A 4XR8C 2J6WA 1Q9OA 4WCYL 1PX8A 4KI1A 4GT7A 5JNYB 1F6AB 2A6IB 3ZVVA 4NQSA 3D08A 3QQ4B 4BK5A 4GW5A 5D5ME 4GEIA 1X5MA 2XDHA 3PHOB 3HE6D 4JO5A 4D7PA 4XB7A 2W92A 4WDIB 5LVEA 1NC4B 4QEGA 2V2TB 1HINL 2VXQH 3GRWL 4N9GB 1G7HB 2XC8A 3P4NB 2F2HA 4QTIH 5DHXB 2I9TB 4LLWB 4AVKA 1H8LA 3MLVL 1OD7A 2D31B 5E6ID 3FUNA 1R3JA 1IAKA 1L0XA 1N70A 5FW8A 1XB3A 4MQSB 5DF0A 4XXWA 5F7FA 1UACL 5EZJB 3VE0A 3Q2CA 2DQHL 3M1BB 3CBKB 4A6YH 1MH5B 2ZE0A 3G5YB 4I9WE 4PRAA 1UWYA 3BGMB 1TBAB 4HH8A 4C47A 1DVFC 4AIEA 1TPXC 3DLQR 1SEQL 4XHQA 2VXUL 3MZGB 4G1EB 3NQKA 3GZQA 2XACC 2AERT 3KCWA 3RFRA 4DKEH 3RL2A 5ECGA 1QATA 3FQXA 3HZKA 5LG6A 1BAFL 1FYTA 3C75A 1EJFA 1KJVA 1YN7A 4Z77A 3VXSB 5I30L 1GYAA 4MCZB 3CFKB 4JHWL 1OTUC 3B7UX 2HT4C 4WJ5A 3SE4C 3KZ8A 3DDFA 4UTBL 5I1JL 4W70A 2MCG1 3B83A 1MCWM 1W6LA 4OVUA 1KIRA 2SEBA 5CP7B 2WVVA 3EHBB 2AANA 4HHAA 3HC2A 5BS0D 3MV9B 5BZWA 1HH6A 3ZXAC 4ZTPL 2N01B 3NTCH 3BVWA 1NOFA 4JFTA 4FXKC 5T5NG 2YUWA 4PJHE 1YTFA 2AGJH 4J4PD 3O6FD 5JOFB 4JGJA 2DQMA 1A7PH 1GC1L 4IU3B 1CIUA 5KANG 4IK7A 1HQRA 2GHWB 3H3BC 4LF3B 4XXCA 1KB5H 2LLGA 2AEIT 1I1AD 3VI3B 3HB3D 2IALA 1TENA 4E9YA 2KKQA 1A4CA 3C8KA 1RZQA 3KWWB 1TEFA 3UJIH 3VFWA 3WMQA 4GO8A 2JXMA 4XHJD 2VLJB 2WB7A 1R3LB 3V4VL 5EFIB 3I50L 3OX8A 5D1XC 4PJDB 4HT1L 5CHNA 5HHVL 5IESH 1G9MH 4L4VD 3RIFK 4XPGL 3NZUA 3NVQA 1IEAB 4JO4H 2DQ6A 4JFDA 3SEPA 3B7TA 2UZXB 3GSWB 2OV0A 3G6DH 4PP2A 2JJTA 4WUKL 5HP5A 5FB8B 4J7RA 3HG0A 1QLEL 2YQGA 4HMCA 1KTBA 4Y1TA 2UY6B 2X12A 2WBJD 3K2MC 1LO0L 1NOLA 3L4YA 2J25A 1DBMH 4DFIA 1OM3L 4Z3FA 3CVHH 1AO7D 4GKNA 2XWXA 1XGPB 4L8CB 1DVFB 5AOIA 1TPXB 4NNPL 2CJUH 2G9HB 5TQ2L 1P4BL 1DJWA 2YKKA 3MUUA 2MOVA 2PR4L 4DTGL 1CL7H 5J11C 3I3BA 3UIYA 1XBDA 3O2DA 2ZSWA 4KWUA 1EUUA 1G1CA 4YGAB 3DX8B 5LQBL 1MJ8H 3BKYH 4M6OL 4X5XA 1H8SA 2BS9A 2B9AA 4KJQD 4ZMOA 4PS4L 1HEZB 2BSSB 5DJZA 5SV3A 4ZRGA 1T66C 1VFUA 4HZLA 4RFOH 4LGRB 3GF8A 5T3XD 3VXSE 2BMKB 2DQGL 2PYEE 3GRGA 1UQSA 3F3HA 3QO1A 5I28A 3ZQWA 3UAJC 1M7DB 4E36A 2RFXA 4IBVA 1CFBA 3KH4A 4PJ8A 5BVPH 2AJSL 4FXKB 2ITDB 4M9OA 5GISL 3S6CA 3FQWA 3MNVA 1RURH 3NCJL 1QN8A 2YEQA 3WXWL 4K3EL 1SXAA 2P48B 1PLGL 4G42A 4NQDD 3O2WL 4XVTH 5KSBE 3V9EA 2YPKB 4NC2B 5AWNH 5LGHL 3CFNA 1X6NA 5EU6B 1C5DA 1QPPA 3T65B 3JT0A 4K5OA 3TBYA 1J5IA 3G5XA 3AACA 1HXYA 5FUCC 3BP7A 4UAHA 1ES0B 4CMMB 4LSPL 2IOOA 1RZKH 3KXFB 3V6ZA 4OI9A 3X11A 4JRYB 5D1XB 2BXYA 5EUOA 5J8OA 2VLJE 2HRLA 4UIMB 1YEGH 2GK2A 2XV0A 3QJTB 3WUZA 2F54E 1TJHH 5INDA 3PJLA 3T1FA 5E6YA 3U0TB 2W8CA 2XN9B 2VR9A 1UEMA 5LBSH 3ALPA 4GKSB 2OCCB 4JJ5A 3KEDA 2JLPA 1DLHB 4PIBA 4NRYB 2VXQL 1P4UA 2GYSA 2Q3AA 4QTIL 1UJTA 1JZ3A 3MC0A 3B6SB 2CLZB 2HJLB 1RAMA 4S1DC 1ZLVH 3VXQB 1WWWX 2EVGA 2P3YA 3ZMRA 3OR7B 2WLZA 3HE6A 3QRFM 4IMLB 3PP4H 3I6LE 5CEXB 4GG6A 1KBPA 4YDKL 5I26A 3F7VA 5CJXC 1WFUA 4M6AA 2R7EA 2WKOA 5J11B 3G5ZB 2FT6A 3GHEH 4A6YL 1TTUA 1LE9B 1Z3GH 4O00A 4Z95L 4H0HB 1AP2B 3HZYA 1LXTA 5E6IA 4PJAB 2OI9C 3IETB 5DD6A 2HVJA 4NYLB 2XZZA 3FN3A 1DBAH 5HI3C 1Q72H 2EDBA 5EBWB 1L6ZA 1TOXA 4H8WC 3WFDH 2YC1B 1IKNA 4NBYB 3ZE0E 4DKEL 1LILA 1Z9PA 3B34A 1NCBH 2WY3B 1NAMH 3S34L 1WSST 2A74C 1AOHA 1NMAH 2R59A 4MWFB 4AZ8B 3UTQB 3UX9B 2GQHA 3C6SA 4HOZA 3HKFA 1CC3A 5BO0D 2R4RH 1ZXQA 1SHWA 4IMKA 4ZOBA 4Y2DC 1YMMD 2Q3ZA 4QTFA 4M1DL 5FX3A 4DERA 4EZMA 2AEPH 2ID5A 1NGPH 4ZFQA 3VXTB 3LKQB 3VJ6A 1E42A 5LHDA 5C2BH 2N4IA 4P2RD 4PCSA 5DXWA 3NESA 2FZ3B 1CXFA 1CFNB 2AGJL 4X7FC 4Z7OE 2NWVA 5HI5D 5C07B 1NWOA 4CN4A 4LCWD 3I0WA 1UXSA 4E5XA 5BS0A 3RZCD 2E7LA 5IJVA 3KJ4C 1CUOA 2FEEI 3EJUA 1ZE3C 3VTTA 5KANI 2J1ZA 3KXFE 3MRMB 3CSGA 3BLKA 4ZFGH 3HAEG 1NCCH 4MA1C 3EYQD 3H85A 2EINB 2HZHA 3O6FA 4J4PA 4UOW0 3MFGB 5ISZD 4AH2B 3WDHA 3UJIL 5K1NA 4M43H 5GRXG 3FZUD 1CDIA 2XN9E 1CZ8H 3MJ8B 2W80C 5A16A 5T33L 2CR3A 4F2ME 5IESL 1AS7A 1ZTXL 1G9ML 1I1AA 3SY0B 4IBWA 3TPUB 3HPLB 4JO4L 2LABA 4PGCA 4JPKH 4NQTA 2CBTA 3PY9A 5IMOA 1TZOA 4LNRA 3G6DL 4EXKA 4ELKA 3FB7A 1LO4L 4PJGE 2AKRB 4L4VA 1MVUA 2AQPA 1K8DA 2LHAA 2YK1H 3IMVA 3L4XA 5I66A 1DBML 1LTXA 2OI9B 4YHLH 2W9DH 3CVHL 5IB1B 2H1PH 3EZ8A 2NTFB 2WLYA 4ZFOL 3IT8D 1RZJH 4N86A 3GM8A 5AVYB 3VO0A 3DGDA 5A7EA 4CN6A 4LT7A 3IKCA 1CL7L 2WBJA 2AQSA 3CN3A 1CFQB 2DKMA 5AYTA 5MEPB 1H9DA 2LAEA 3MNZB 1MJ8L 3BKYL 4KK6D 2A74B 1T5XA 5E7BA 3LRHA 4NFDA 1YZZA 3VFUA 4RMTA 4NRZA 4OZFH 4D3CH 4WFGE 4RFOL 2BNRB 1UVQA 4GQRA 2XLLA 4HUXB 1UKSA 5B39A 4Y2DB 3RWGB 4BSWB 1E5CA 2IH3A 4N90E 1KTLA 1JXFA 2VJXA 2IAMD 1VACA 3J07A 5E70A 5KVFE 3QYNA 4G7QB 4HEPG 5BVPL 4P06A 2JCCF 5L0QC 1KY7A 3PL6C 3ILEA 1EA9C 3GQFA 1SUJA 3D39D 4U1NA 4R0LC 4YN3A 4DN3H 5F8QC 1UWFA 2AJVL 4XVTL 1KBGH 3QIWD 1WIPA 2X4QA 4KXDA 1BVLB 3D3VD 5AWNL 3KJ4B 5C07E 2GUYA 1IQWH 2FUTA 4QHNA 3EFFA 5CBEB 3E8UH 5KYXA 4MA1B 1UWXK 4N1HB 2XFGB 1W8NA 2H0FA 4NQDA 2YZ1A 4NHUB 1RZKL 3Q2WA 4L9LC 5HGDA 3TNNA 4AYDC 5CZKA 1QUPA 2WZPD 2MZ8A 2EDXA 4AV0A 1Q0EA 2ITEA 1YEGL 4JDTH 1TJHL 5HHMD 1H6TA 1AD0B 2C3GA 3O9WC 5DHDA 5HJ3A 2AXGB 1AHWC 4P46B 1AY1H 3BDYH 1FHNA 3O3DB 1Q9WA 3HBPA 1FUNA 3CPUA 1WC7B 3FU6A 3L2LA 3ZDZF 5KVMC 3LX9A 2H41A 4Z5RA 1MCQA 2NY5H 3KBEA 3C6EA 2D7QA 3WY1A 4KXCA 4X7TA 2XXMB 4TRPH 5JA9A 3QIBD 4U1MA 3D7QA 3AU0A 1Q0YH 3KPRE 4FYRA 4EZJA 3PP4L 4H0GA 6TAAA 2W59A 2QVMA 3AADB 4KKLC 1OSZB 1KGWA 3VH8A 3C9NB 3L3JA 4XRCA 5FWQA 3QG6B 4HULB 1VJSA 4N8VB 2HT3D 4WK0B 4BXVA 4FP8H 3GHEL 4MYWB 1MJJA 4G6MH 1Z3GL 1C1EH 2Q76A 2K1MA 1WBYA 1J18A 3P4LA 1HI6B 3ARBD 5FXCH 1SJMA 3GEFA 4KDTA 2R69A 4CKVX 1X9QA 3N04A 3EYVB 2HB0A 1F4AA 4DF9A 1DBAL 3D2UD 1Q72L 2HH0H 2D0CA 1SHSA 5EEUA 3WFDL 5I5RA 4OJDH 3V5HB 4RWYL 5DJCA 1DJYA 2F74A 3UC0L 2MKLC 5KAQF 3NSYA 1Z2KA 1IGJB 2G2PA 4BSVB 3O41B 1BVOA 1NCBL 3W3BA 1NAML 2OM5A 4UQ2A 1D5IH 2L4OA 1NMAL 3HI1A 2K7PA 3BAIA 4OGAD 4MJHA 4JUTA 4IGBC 3SKMB 1QN4A 5L0QB 1CGSH 2R4RL 3WMPA 1OAUH 3PL6B 4NQED 5LNEA 3MBWB 4R0LB 4OZ4A 2AEPL 3QPKA 3RB5A 3L1GA 1ESOA 1NGPL 5HGAB 5C2BL 5FO2A 4GLRI 1NBVH 1T0NA 2NY2C 5I1DA 1EUTA 4HIJB 4XZUA 1XSIA 4NPJA 1ETZA 1YMMA 3VD0A 3RX7A 3NCYS 2AJUH 2WTOA 2KPWA 2ZXCA 3NK3A 4Q58C 4RFNC 2XOTA 5EH1A 1DN0B 2DI7A 5IROC 5IBUG 5EA0H 4L9LB 1NGXA 4G1MA 3ZTCC 2YGPA 2QMKA 4NQXA 4P2RA 3SYOA 4N85A 2FO4B 3APDA 4G43B 2UVFA 1CVRA 5I17A 3O9WB 3V4VB 1NCCL 2Z7WA 2Z6FA 3OR6A 4QYAA 1AHWB 2EEAA 2YJLA 2ZT9C 3P4OB 1HYSD 4YHPB 2JCWA 2BVQB 1TFPA 5SWQA 2X9WA 3BP5B 3O2DH 4HX1B 4LCWA 1CZ8L 3RZCA 1HHKA 2NX5D 1ASQA 1N8ZB 2YD0A 1YCSA 3DUHA 5AAPA 3FO0H 5GS3A 3QPXH 2E0PA 3ZQXA 5JHDD 5I73C 5TTRA 5JW4Q 4GI9A 1LO5A 1MRCL 4JPKL 1QKZH 5ISZA 1QLEB 4AT6A 4C8XA 4TVPH 4TYUA 4LLUA 2DQFB 5A2FA 2XUWA 3EJYD 5DUMH 1SYSA 1GGCH 1WAPA 1IM3D 1TZGH 2GBVA 4ELMF 2ZYSA 3MKKA 1V3JA 4HALA 3IMTA 2YK1L 1ED3B 2D73A 3CVBA 5EBMB 1RIHH 4YHLL 2W9DL 2H1PL 4NWTH 4GINA 3DROA 5BZDB 1RZJL 2Y7MA 3ATFA 1TCMA 3AC0A 1FQ9C 4X5RA 1S9WB 4FADA 1T6WA 1N0LA 1P1ZA 4QAWA 4L8DA 3PQYB 4MA7H 2H8PA 3L1EA 4R7XA 1S7TA 1BJ8A 1PJWA 2AZUA 5AQ0A 4MDJA 2HRPH 1F11A 1P7KA 2X0UA 3BVUA 4MZ3A 4IGBB 1V5JA 4AEIH 4D3CL 2MMXA 1JPGA 5E8NB 1QN5A 2FBOJ 4XO5A 1AI1H 3GIVA 4V11A 5B8CC 4Y4FC 3D34A 2DEYX 4JDEB 3VFOB 1FA4A 3KYMB 3MRFB 2EKSA 2NT1A 1E4KC 2NY2B 4JGMA 3FHQA 3RNQA 4ILDA 3U0PB 5CD5C 3EIKA 3CVDA 1YN6B 1BQLH 4F57L 4M7LT 3AMLA 4ZMYA 4RFNB 2TAAA 3HI5H 3DO4A 2NNFA 1KBGL 1H0DA 1DQJB 1PZ3A 2IAMA 3FCTA 2P9RA 3G08A 2Q6WA 5ITBH 5J5EA 1IQWL 5SWZB 1BOGB 1A6ZA 3PUCA 1NC2D 1IAIH 1FGVH 3B1TA 3E8UL 4ZOCA 2XRAL 3D39A 2N7SA 1QNCA 2GJZB 1J9SA 3QIWA 1N0XH 4AQEB 4HLZG 4YSPA 3GXNA 4PCTA 5PCYA 3X13B 1MZYA 4KO9A 4QKTA 4F93B 3CWAA 3D3VA 1ZTMA 3EFDH 4H40A 5EN2B 4Y7MA 1QFPA 4FMVA 4JDTL 5I73B 2KL6A 3F6JA 1OWRM 1A7RH 1AY1L 1DUZA 1EDYA 3IU3A 3DO3A 2P24A 2XFXA 2VE6A 4LLDA 4PJBF 5D7JD 5IHUH 2WZPA 4WW2C 4B41A 4Z7WF 3RY5A 4ALAH 3UABA 1WBXB 3DXAB 2ODIA 2NY5L 4PTUA 2KS0A 4GUOA 2JCCB 3MBED 3N6YA 3DRQB 4TRPL 4XNAA 5AUMA 1Q0YL 4A6YB 2DQUH 4FJ6A 4I2XB 1ICTA 2FNWA 3BMVA 3GLZA 5EO1A 2VL5B 5DJXB 3U4KA 4F7EB 2R8SH 4L1BA 1YEDA 3MREA 4G6ML 1UXMA 3QIBA 4PJ9C 2XX0A 3US1A 2ZYHA 2BSED 1BM7A 2X4TB 2HH0L 1N6VA 1NMBL 2ARWA 4P5MA 5I1KH 2JB5H 3MPCA 1PCXA 4OUUB 2DEXX 4KROC 4LCCC 5FS5A 1CT8B 2P26A 1SEBB 1WITA 5JDSB 2EYRB 4Y4FB 3HW7A 2X2IA 3ARBA 2ED7A 3STLB 3VXUD 4AQ1A 1HQ4B 3LDBC 4NNXA 1D5IL 5ID1A 2X6UA 3D2UA 3HVNA 4AL8C 3IMUA 4YBLC 5AYUL 5HYSG 4PRBA 1TDQA 3MRDA 1RLWA 1DO6A 1CGSL 2H6PA 35C8H 3TS8A 1OAUL 3V4PB 3ORJA 1CLZH 3FS9A 4PM1A 2QSVA 2AQ1A 2VL4A 3O45B 3SKNB 2MTPA 3P54A 3CN1A 5FKAB 5CR1A 4KK5C 1NIDA 3RJDA 4MJ6B 3H55A 4OFQA 3ZO0A 3PIQB 4HKBB 3BEVB 1MFBH 2ETWA 4NQEA 3F2LA 5ESQA 3DO7B 4WO4C 2AJUL 4F3FA 4UQ3A 4XWGH 1KV7A 5BV7H 2WN2A 3NJGA 5EA0L 4LGPB 2HG5A 1TEGA 3UG3A 4GH7B 3V0HA 5I19H 3MDJA 3QEHA 2CLRB 4QPEA 3ILQD 3MROA 1B4LA 4L3ED 2COVD 1RZKC 4P4RB 1UM4H 3BDXA 4PGEB 5IFJB 4IBUA 1KV3A 4GQPH 3V0AC 1DSYA 2ICEC 4UU9A 2VDPB 3DOSA 3LZPA 1J5DA 2VMFA 2EDLA 3O2DL 4CNIA 3K5SA 1E4XH 3QEGH 4MCYB 4Y19D 1YYLH 2IMMA 4WW2B 4PY5A 5DRXB 3GMPB 3QPXL 4FF9A 1M3QA 3SDXB 4KKAD 1XF4A 3BAXA 1QKZL 4PSRA 3DXAE 2BOCA 4XPHH 4UQCA 5T1JA 3EUDA 1AQKL 1Q1JH 5H4ZA 5DUML 5BXFB 4OF7A 2NX5A 1GGCL 3QARA 1CDBA 4BFIA 3CVHB 1TZGL 2VM4A 1GGIH 4I18A 2CHNA 4I9XA 4F3FB 1S8DB 5J1AA 5C7XH 4PJ9B 4PWHA 4YAQA 3RVVC 2ATKB 5ACZA 3B8YA 5ECJE 2CG9X 5T3XH 2EUVA 2D0AA 2CRIA 3CV5A 4NWTL 3CTTA 4FRWA 3PDKA 4A2DA