1E42A

Beta2-adaptin appendage domain, from clathrin adaptor ap2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure and Function of the Beta2-Adaptin Appendage Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords AP-2 COMPLEX SUBUNIT BETA
total genus 60
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e42A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1e42A02
3VN5A 1R4XA 3H1ZA 1QNAA 1C9BB 3EIKA 1TGHA 1CDWA 4PY5A 1TBAB 1W80A 4ROCB 1QN4A 2G30A 1QTPA 1QN3A 1KYFA 2IV9A 1QN5A 4B0AA 1TBPA 1QNCA 1QTSA 1QN7A 1D3UA 1YTBA 3HS9A 5IYDP 1E42A 2D0CA 1QNBA 2IV8A 1NVPA 1JFIC 2D0AA 2MJ7A 1QN6A 1VOLB 1VOKA 4WZSD 4RODB 1KYUA 1KY6A 4ROEB 2D0BA 2VJ0A 1AISA 1QN9A 1VTLE 1QNEA 1YTFA 1VTOA 1PZDA 5IYCP 3HS8A 3OCIA 1NH2A 3OC3C 3ASMA 1QN8A 1KYDA 1KY7A 1B9KA 1PCZA 2Z8UA 1NGMA 1MP9A 1RM1A 5IYBP
chains in the Genus database with same CATH superfamily
3ZKQD 1KTRL 2MQGA 2X28A 4PSPA 1AGEA 1A9BA 4K3HA 5JPMA 1RZ7H 1EDYA 3NSXA 4XHQA 4OZIF 1ZA6B 4ZYKB 5I71B 4KROB 4I13B 2B4CC 2OP4H 1PGRB 1GGIL 2CDFA 3GSRA 3LPFA 4HU8A 3P4MA 2UZIH 1P5DX 4WO0A 2VW7A 1KDIA 2IPTH 4A7QA 4CSSA 4CSPA 3KDMA 5JHLH 4OJYA 1B2WH 1B9KA 1CIUA 5GHWL 1RUQL 3O6FB 5TGBA 1BIHA 1QHOA 2YQGA 3A6CL 1MI5A 3HPLB 2P80A 4KQ4L 5EO9B 1LE5A 2PP8A 3DIFA 4LOUC 1AANA 3BKCL 4IGBC 4IYKA 1A1MB 4NS0A 2GTZB 4F2EA 3EAYA 2FO4B 2Q2EB 1NGQH 1X5HA 1A2YA 1CGXA 1D6VH 1KF9B 1XFPA 1QBMH 4K2UH 4XO8A 3W2DL 5JPNA 3QWRA 4JHVA 3TH3T 4B7IA 1X9UA 1OAQL 3CZSA 3GMNB 1E28B 3ROLB 4JO5A 5GZNC 3DXAE 1DBBL 1HSBB 1DJZA 4ZS6D 3B37A 5AVYB 3NJFA 3X11A 4UB0H 4Y2DA 4HPOH 3Q1SH 2CNYA 3PUUA 2VQ4A 4PV9A 2J4WL 1F6LL 3D2UD 3FQRA 1XF1A 2FBJL 2Y4SA 3QULA 1WBZA 1ORQB 1YNLL 2JKNA 2ZWYA 3ET9F 3RVWD 4ADJA 4DVRL 5D2LE 3U0TB 4A1RA 3VG0L 2CGZA 1OCRB 1SXAA 4G80A 1DBKL 4OZHB 3V4PL 2MNWA 4JFEA 3ZL4H 4XE0A 1MSPA 1XR8B 2O5ZL 1UXWA 5GRXG 1YQRA 3V6OE 5I2IA 1IM9B 3MAWA 1TNMA 4WTXA 2YAOA 2IQAA 1MCRA 2CRZA 4ZO6A 4NQCB 3SGEI 5AD0A 8FABB 2AANA 4L4VA 5KSBF 2Z8SA 2DS4A 5IGXL 3TJHD 5KZCD 4I3SH 1UA3A 5D7EA 3AQYA 2QKIB 2Y9RT 4OGZA 3KPOB 2IV9A 1IC4L 5TF1L 2V5MA 3IJ7A 4U4IA 4FKKA 1U8IB 2IADB 5LBSA 3QYNA 3CW7A 2LFGA 3GMOA 4WSKA 1AO7D 2ARJQ 3CLEH 3SN6N 3QXDA 4AVJA 1A25A 1FN7A 1RU9L 3SDAC 4LCYA 2X1PA 3N42F 4YDVB 1NINA 2D7QA 4JFEE 4I9WD 5E4AA 5BRZA 2OJEA 4HC1A 4Z7VF 4HZAA 4P2CG 4XN8A 5HYJD 3PNWB 3E38A 4KMTH 1M53A 5HDBF 3S4SA 3ISYA 2OQJB 2NY0C 2OSLA 3MRRB 2D4FA 4QAMB 1CFTA 1TTAA 4XN5A 4M7LL 1F3JB 1AR1C 2G2PA 2WN3A 1JPEA 3FFOA 5EZOH 4HCRH 3RFRA 3TYGL 1GPOL 3ES6A 5HXMA 2EKJA 2O3OA 4N2DA 2QSVA 3E2HB 2DQTH 5IBTH 1ORSA 1F1AA 3RIFF 5I1GL 3DGDA 2GC7C 2Q76A 1LEKA 2OCFD 3NSCA 3QEUA 4NZRH 5JMRA 2QR1A 2B08A 1JZDC 2CZNA 3L2LA 3D85B 1NCCL 3QJSB 3FO2A 1EGJL 1IAKA 1DJWA 1RUPH 5DHDA 3RJOA 4D9QE 1DLFH 4AMKH 1MCSA 3EJZC 5A3ID 2WQSA 3X11B 4HKXA 4JDEA 1ACXA 5KSBE 3SE9L 5T1KA 1BVNP 4OZFA 5K59E 3OKLA 3RWDA 4N0UB 4BHUI 4UT7H 1FAKT 2WGXA 3SQOH 3FCSA 4QRPD 4X6CF 1H5BB 2UV3A 3FHAA 4MHHI 1C47A 4XODA 5CWSA 2BP0A 4U1MB 5EZPA 2PXYB 5TH2B 4YIQA 3O45B 1FLRL 3FSZA 1GMIA 2XICA 1BSIA 4M8QB 1JL8A 3AROA 2H9GB 5FIEA 2XQYK 2JB6A 5F70A 4HUCA 2BY0A 5DHXB 3DX4A 4TUOA 1MFMA 3VSQA 1DSWA 4OFYA 4TOYH 4DZ8B 4OLYH 2IBGA 4TNVF 1V54B 3BSGA 5AB1A 3SDDA 1QUPA 1UOWA 1JV5A 3IFNL 3QHZH 3KXFA 4DO4A 5KOVC 2Q8BH 5DVLA 2YGPA 2Y7QB 4UT6L 5A2AA 2KZKA 4XNUH 4MNGB 5L2KA 1P53A 3DURB 3ILPB 5FAAA 4ZRGA 1PQZB 2W92A 4N8CH 3O81A 5E8DH 3QIWA 2KERA 3NFNA 4JG0L 4MXWH 1BFSA 4W6YB 2GI0A 5E8NB 2X87A 1MIEL 2XTSA 3LDBC 2WVVA 5SWZE 1VGKB 2H26A 1J0IA 4MSWA 1KTDA 1NGPL 2G4GA 3FQWA 5I8CA 3ZKND 1UWXK 3P77A 1Z9NA 4NWTH 1W80A 3LV3B 4QHMB 3CZEA 2ARJA 3TJEL 1KCBA 2GVYA 1TU2A 4BFEA 4F15C 5MI0C 1RMFL 2YZ8A 1GL4B 4LVEA 3JV5A 5GS2H 4GG6B 2FX8H 1NC2B 1HHKB 3V4PH 1QN9A 1JRHL 3GRWH 4L9LA 5DRNA 4POYA 2GAZA 4XVSL 1IQWL 3DVFA 2VR6A 3HNVL 3QEGL 1E3FA 1PZSA 4MGXA 1WUNT 5FM5M 3JTBA 2WINA 2ESVE 4K7FA 4E2OA 4LHQB 5EU3B 5FYJH 5DSCA 3FO2B 2GUOB 5MENE 3B8SA 1JNLH 4EI0A 2EVHA 1IGYA 2OX5B 2YOAA 3A5VA 5ECGA 3NRFA 1IC4H 5IK3A 5TF1H 1DQTA 4HFWA 4RGNE 1JGVH 4M93B 3VRIB 1RKRA 2F1EA 3WJMB 4MDIA 4EN3C 2RCSL 4IRSD 1YO4A 4WWKC 1MRDH 1A8JH 2ICWA 3L54A 4HP5A 4N68A 1YQKA 2A1WH 2WKOA 1C8PA 3ZIYA 2X44D 2KL6A 3VI3F 2BIMA 3VGHA 2JLPA 5T1LD 3LNEA 4LLYB 5D7JC 2QSQA 1EK3A 1NCIA 4JO4L 3T08A 1QLEH 2FX9H 4ODWB 1AQHA 1RZJC 3CDZA 2AC0A 2VQTA 1DZ0A 3UOAB 1NCGA 2DWEB 4U1LA 1GAFH 2ZT9C 2GFBB 43CAA 4TL4A 1D3CA 3BYYA 5IBTL 4LAJH 4Q89A 3GBNL 4KRPB 4LL4A 3STBA 1KELL 1H3PH 4JZOA 1FFQA 2DQGL 4KHXH 4FP8L 3EGXA 3IDYB 3C75A 4ANUA 5FFOA 4ANXA 1X4YA 4JKWA 4A2DA 1ET8A 3LEVL 1EO5A 3WHXA 3HNTH 4MJ2A 3NJMA 2C34A 5EBWB 4IM8A 5F9WB 2PW2B 2UZYB 1AXTL 3BHBA 1LE9B 3OSEA 2YPLD 1E9PA 1YUKB 4MYWB 5F1OB 3SO5A 1MHCA 5E4OA 2GKIA 3MO1A 3GJEA 1QNBA 4WUKH 4P3WA 5A16A 4GSXA 5D1XA 2E7CA 1NCWH 4QKXB 2BNQB 3QISA 5EBLA 3ZE0F 3ZQXA 3O2VH 5HHPA 1VTOA 5TDNA 4Z6AT 2NZ9C 1T0NB 1OP3H 1HINL 3DTXA 5EOCL 1DR9A 4NKMA 5TQ2L 1OSZB 4R2GD 4BQ6A 2Q20A 3L3GA 3Q6GL 4C57C 2BY2A 3IFNH 1E6OL 4YLBA 3LNHA 4JB9H 4PJ9B 5DZVA 2QFPA 3QUGA 2Y22A 4KZEH 3BE1L 3DJSA 4HJUA 5DZOA 2WWMD 3DOSB 3ZHDA 1ASPA 4AV5A 5ESVB 1LO0H 1OAKH 2Y3AA 3DYOA 4KVNL 4PS4H 5D4JA 1KGXA 2AMUA 2Z8WC 5INCA 4UUJB 1ZHNA 4PJ5A 4IU2A 4IBQA 1V3JA 3CHPA 3WFDL 2TSAA 2DQUH 3MOBH 4YDNA 4B60A 3AT9A 1KNOA 1SDDB 4ZMZA 5SWZD 3DHPA 1KCVL 1HKLH 3T3MB 1UUSA 4A63A 1XR9B 2EEBA 3QARA 1DEEA 4JFOB 3ZTCC 5CINH 2GHWB 5DEZA 3FU7A 1P5UA 2YBRA 4ALAC 2FDBP 1BAGA 4J3TA 2EDLA 2VJ0A 4GW4B 1NC4D 1HXYA 3UH8A 1ACZA 1J8HA 4JJHA 3MBXL 4M5TA 4DGVL 3QDMD 3GLDA 3MRCA 1A21A 4HALA 4OGQC 5ITBL 1FZJA 2DKCA 4OF3A 1ZS2A 4MA3A 3RZCC 5DUBA 1ZWIB 3JV4A 3PAUA 4P9HH 4PJXA 4M1DL 3FOLB 4NHCH 2R29H 1R3JA 1S7UB 4CDHA 3BAXA 1A6WH 2P7TA 2EC9T 4HLZG 1JK9B 3OWRA 4XNXH 3ZTEA 4XPHL 2A74B 3GTNA 4CN4A 2F61A 8CGTA 4OBRA 1BQHA 4OQ1A 4ZYKA 1F90H 2D7TL 5DZLA 4KKCD 3LKNA 2CD0A 4P9MH 1YYCA 4XXWC 4C4KT 4MA1C 3CFJA 1FYHB 2YMTA 3U4AA 1SHMA 1E27B 1X7QA 4HXBH 2F7QA 4D0DA 1P7QB 2DQMA 2WO3B 4TLUA 4WU7A 2FX9L 5F72S 2HJLA 1C16A 2WCGA 2RA1A 2EE2A 3I50H 4TUJA 3TT3L 1O0VA 1PG7L 4JY4B 3QUZD 5EPMB 3ENOC 4GMTL 2YEZA 5DZNA 1NDTA 4GSDH 3QDME 2VYRE 3QEQA 4ODSH 3VXNB 2J8OA 3M07A 4AMWA 4LNRB 4NUGH 5CLWA 1N3NA 4G6AC 5IK3B 1SNRA 3LKQA 3JXAA 2CRMA 2ENQA 2OYMA 5D7IF 4CADA 2VXVL 3NCMA 1LWYA 1P7KB 2H3XC 3B43A 5F7WC 2P42B 1V5JA 3W1ZA 5HGGS 3VB8A 1QATA 4JFED 1ZRUA 2XHNA 2ZUVA 1O7VA 2E0PA 4LCUA 2P49B 3MV8D 4KRPC 4RRPG 4LFHD 4AGPA 3B7UX 4N22A 5D2LF 4ZQTA 3QUYD 2ZJSL 3E80A 5CHNB 5DJDB 2XOTA 3RZWA 5GS1B 4Z5RB 4XMLL 4NN6B 4JFPB 4BD4A 2XVBA 2VLME 1Y7VA 2O5XL 5JQ6H 1CE1L 3MCKB 3ULAB 3EOTH 5DO2D 5CEZE 2F8VA 4N5EC 5DMYA 3VN5A 4NO2A 3C60C 3DX8B 1F0LA 2QQQA 3BKJH 2IDQA 3LHPL 1NEPA 3T4YA 5JHLL 3OSMA 3FH5A 4OD1H 3A6BL 4YFEA 3MACL 4QRSA 3ECUA 1WLHA 2YLHA 3CVBA 5C6TH 4AEHL 4ICXA 3V6OC 4A37A 1NFAA 4N2LA 2DQIL 3S5LG 3DVIA 4P2RA 4P5KB 2CK0L 4HJ0D 3D0LB 4JNXA 2ZWZA 4UINL 5F44A 4DN4H 4FQCH 4LHUG 2DJUA 2R1XB 2DQEL 1U2HA 1SOKA 4G71B 2QBWA 3CFKA 3LPWA 4KOBA 1WE5A 1AGBA 2XI9A 3IVKB 3S35H 2L7UA 1X5IA 5DJ8B 4GRLA 1DLHA 1MCLA 1FNHA 1VRSA 4BXVA 4PH8A 1AD9A 5DLML 2VXSL 4WDIB 4YBLC 3US9A 4OZFH 3QQ9C 1EV2E 1RFDH 1LDSA 5C8JA 1D5BA 2P8LB 5C9KA 1REIA 3Q1SL 2ZXDA 3JVFC 3SOTA 3L1FA 4KNUA 1I3RB 4JPVL 2APSA 3LZQA 2H9GA 4UNIA 1OP4A 2IAAC 5A7BA 2EUWA 5ACLA 4JKKA 2NLJA 1MWAB 1SBSH 2XWJA 5FLVA 4NQTA 3WYRA 4KX9A 2ENSA 3GS0A 3L5XH 2BSDA 3RBSA 2OFQA 5AVXB 1DFXA 1OAUL 1AXIB 3RKDD 3U6RB 1SF3A 5DC9B 5D6CA 5B4MC 5IB4A 1IBZA 4FJYA 3SB3A 3V0WL 4YSAA 4S1SH 3NA4A 2ZG2A 3T0VA 3S2CA 2Y07H 3EDFA 4YZWA 1E4XH 3HI6H 4LLVB 4MNQE 4JPIB 2FRGP 4TQEL 2BZ7A 3MDJA 4XZUA 5HDQL 4LSRL 3N0PB 3UAAA 3V9EA 4PRIE 4ZO9A 3FAXA 5F9CA 1NEUA 3CN0A 5JW5A 2PP9A 3P4OA 4YE4L 5GGRA 3KBEA 2XG4B 43C9A 3F7RA 4CL7A 4GQPH 4QOKE 3D51A 3QH3A 2GG1A 4H8HA 4XAWL 2VUOA 3OKDB 5ICUA 1VPOL 1EFXD 3OKMA 4H1LB 3P1VA 1JV5B 3QUYA 4JO1H 2ZXEB 4X4ME 4JQIH 1AGCA 2QLYA 3V0DA 1LWJA 4Z7OE 5H37G 5IROC 3VGAC 1DUYB 1CDJA 2KDYA 1ZY9A 3KPTA 4N0UE 3EBAA 4MQ7B 3UAJC 1M1XA 4K7PX 4JZNB 3FQ4A 4Y19D 3FRPG 1IKNC 3ESUF 1G9MC 3QDJD 4G5AA 1UH4A 4Y16D 1CGVA 3H4FA 4P99A 2X38A 3MTRA 4BZ1A 5LUMA 4QPEA 1M2VB 4JHWL 3HE7A 1J0HA 1ZLSH 2WXGA 4Z7QE 1AQKH 3DYMA 1E5AA 3KYNB 5J9PB 5JQIB 3SE3A 3FZUC 3MV01 3SQRA 2BOCB 1RUAH 4HGWB 5KL0A 2N0MA 3D3VB 2D31A 1RJLA 2GJZB 3FCUB 1KXHA 5KVGH 4P4KD 5EWIL 1UKTA 4U3SA 2ADJA 4MAZA 2HFEA 1R46A 1GXEA 4FLOA 3QAZB 2VRAA 4P4KC 2CO4A 5E4EC 1QZNA 4KNQA 5C08E 5EF1A 3IWUA 4IMLB 4W6WB 4Y89A 2IG2H 3SD5A 4OUUB 4ZFGL 1DEEB 4PWFA 1YPZB 1HOEA 3KLHC 3D85A 3GPEA 1JIBA 3WS3A 3V10A 3IU3B 3PHAA 1QSVA 1QNCA 3HCVB 2NX5E 2NYYD 1GGBL 1MWAL 3S36H 4AENB 1I7UA 4YZFF 2D0AA 3CVHB 2BHFA 4PJEE 3FUDA 3L3JB 4AJVA 4ZNCD 3CQFA 3ARQA 2W9DL 5HHXL 1ECYA 1IIIA 4RMTA 5CAYB 2DQDH 2OMZA 2Q7YA 4UTAA 4UINH 1OTUC 3VNYA 3ULVE 4DW2L 1Z9LA 1DDHA 2HT4C 3C60B 3BT2H 5IVNA 4TS6A 5D8JL 1TMCB 1JZIA 2YD7A 5CS7A 3V52L 5F96H 4YSSA 5I28A 1EMTL 2PO6B 2Q2LA 3PFUA 4XWGL 3AJ7A 5EORH 3TN0B 5T5FL 3IFOA 1T22A 4OZIB 1D9KB 3N04A 4LLQB 4L4TA 1HAWA 5SWSD 4XN9A 2IALB 4YPGB 5CZXC 4Z7VA 5D7SH 4GO8A 3UJTH 3EJYC 1RD6A 1SXCA 2CO3A 5BQ7A 2DB8A 1HDMA 4BE6A 4G3YL 4UV7L 1HOCA 1S7WB 1S9YA 3IMWA 5K9QG 2J8HA 5F7BA 1AVAA 1J9TA 4PVNA 5AWNH 1JFQH 3UYRH 4FULA 4HK3N 1AGEB 1G7MB 3DXAB 2FKMX 1QNAA 3BAJA 3Q44A 4V2BA 1IGCH 1HCYA 2CUIA 3TNNB 3RRQA 1L0XA 1SJVA 1JGUL 1UXWB 4F8OA 3DDFA 4Z9KB 1PMYA 4GG6F 1I4FA 3BP5A 1A1OB 2B1HH 4AIXA 2XXMB 1W8NA 3WDHA 1MEXL 3ZDXB 3S88H 3RWGB 4FFZA 4OT1H 4WDIA 1VLXA 1OHQA 5GRJH 3ILQD 1DCLA 3GHEH 4JEGB 3LRSB 4ZS6C 1TIUA 4J28A 4P5TB 1WIOA 4NLAA 1W0WA 4GG6A 1ID5I 1P1VA 4J27A 3RWHA 2ZCLL 4ZUVB 3PWJB 4D8OA 4JRYD 2AV1A 3G5XB 1YZZA 1TFPA 3FPYA 2ZOKB 4MCZA 5B1CA 5HY9B 2BNUA 3RWCB 1UWYA 3MRLA 2VDLL 1TVHA 4HEPG 4ZMQA 5DJXA 3HC3H 3PGDA 5KVEH 3AM8A 5DJ0B 4O51B 3FU3A 4ZX6A 3MRJB 3U4BL 1G5GA 3IDIA 5AW1B 3FSWA 1U8LB 4D0CB 4ZMOA 2V9UA 4QRFA 2EIJB 2WLLA 5FOBB 5I1CH 1FFPB 1BG9A 3FB8A 2WWOA 1YNTA 4NFDA 3NP3A 3DX7B 1NMAH 5CN2A 2R0ZL 4N5ED 4N0FB 1S7SB 3G5YB 3A6OA 3ENEA 1RXLA 5IFHL 3WKMH 2FX7H 3O41B 2Z0UA 3CFIC 3RQ3A 1JVOA 2XG4A 3L5JA 5CN1A 4XP6H 1SYSB 5FF6A 4YXKH 5I73B 3HZYB 2HT4D 1L9QA 2EUZA 1JNNL 4G43A 1CI5A 3SDDD 4BSWA 3RB7A 4CVWA 1H0DA 2YGQA 4OY9A 4OIFA 3HNSH 1K4DB 4CC4C 3ULUF 2VSMB 1W6LA 3X3FL 5DMIL 2WZAA 4ZFGH 1VOLB 1X9QA 3ARDB 1XT5A 5AW8B 1UT9A 4UQEA 3VXMB 1NC4A 5T1MB 5T3XH 1VERA 4FLQA 5EBWA 5KEZA 5IVXE 1U8KA 4XR8C 3DIDA 4GIAA 2EXWC 2MPAH 2XYCA 5J12B 3WY2A 2OMYA 2HH0L 4M03A 3L4XA 4P4KB 3SJVB 3UCQA 1V7ML 1R9FA 2EABA 4JFZH 2MFNA 1I31A 4NUQA 2R23B 4B9KC 3AW5A 1K5WA 1R3IH 4A38A 3HHMA 5HHQB 1CU4L 4NERA 4DW2H 4N1HB 3DHJA 1EBAA 3O6FC 1TCRA 3DOIA 3L95A 3CHXA 4ZBJA 3UDWC 4U6HB 1H3XA 3STLA 1IIKA 1AOZA 4QF1B 3NPSC 3ZHLA 2WQRA 4FABH 1GYAA 5E08H 1RPQA 3MHZA 4XTRD 3HBGA 4PMFA 3N1PC 5KYXB 1OGAB 1IGTB 1Z0MA 4BJLA 4EIBA 5LB1A 1NAMA 4Z7IA 4UQCA 5D1QC 2Y36L 3W0WB 3LN4A 4OF7A 1J48A 1JV2A 2NYKA 4OV5A 3DURA 1ML0A 4I1RA 4QRSB 4G3YH 4JRFA 1BP3B 5JLZB 5EEXA 2BSTB 2OKMA 3MBXH 4IOIA 3MV9A 4RMSA 1JFQL 4X7CC 1PCXA 2X4RA 1BJ1J 2CLVA 5JXED 1YEDB 3TYFA 4HS3A 4UM9B 5AOKA 1U8HA 2DLHA 2E46A 1NAKL 4OZHF 4JG1H 4QKTA 4AQAB 4HOMA 4ODUA 1YTFA 3TXAA 4L1BA 3HE6B 5AVTB 5CHNA 4OB5H 4F7KA 2H0PA 3AZUA 1IT9L 2VM3A 4E41A 1XB6A 3BWSA 2DMBA 3FCSB 4NPYB 1ZLUK 1LK3L 1JVLA 2EVJA 1MDAA 2FBOJ 2NUPB 3GSNA 3VXPB 3CSFA 4Y5VA 1OCCB 5HYSB 5FO9A 3PWNA 3EJTA 2FQGA 2Y06L 5MEND 5BVJB 3GUFA 4XHJD 3C8HA 5FDWA 4Y2DC 4K9EH 4HHAB 5C0RL 1EHNA 2WMPB 1NCJA 4HUUB 4PSRA 3JWNE 1QASA 3REVB 4OUUA 2R1XA 4BRVA 4DOHB 4MA8H 2WZ0A 4G1EA 5DFAA 3QO1B 4Z7UB 2C9PA 4HV8B 2QQLH 2GK0A 4DK3A 3QHZL 3HI1B 1KB3A 1IC7H 4L9DA 1FGNL 2YD5A 5F7UA 3MXWL 3P2DA 2YD4A 3DBSA 1ETA1 1DUYA 4GPVA 4OKDA 4PTUB 3K8MA 4IBZA 1RIHL 4MMZC 1EGJH 2LR4A 2XN0A 4L1DA 2DYPB 5IB1A 1GHFH 3K80A 3ABGA 3WXVH 2Z35B 3RWEA 3VYNA 2APFA 4QTFA 4CILA 3P11H 2CCWA 1PSKH 1CLZL 1IGIL 4OZGE 2VZSA 1DJIA 1ETJA 1ZTXE 4X6BA 5GIRB 4MHHG 5E9DA 1UADC 2FBRA 4APQD 2RTTA 1QA9B 1HI6B 4JZOB 1CICB 3OLDA 1OW0C 4LBAA 1RIUH 4P2QA 4D3CH 1HWHB 3MJ9A 3PPEA 4Z8FL 4PLOB 1CE1H 4M7KH 5FYKU 2I32A 4GQQA 2NXZD 4ONFL 2P26A 1FZJB 1GS8A 3EH2A 4KK5C 5T3XL 3T2PA 2J43A 5IVOA 5EIVA 2NXYB 3BQUB 4LASL 4LSPH 4HULB 3UW2A 3SZ6A 4EIGB 4YXHL 3FQNA 1DCEA 1ZA3A 3BSZH 3QEGH 4LCWB 3TIDA 2FUVA 4XNQA 3AMLA 5JIHA 7PAZA 1QSFE 4GAYA 4Z95H 3OKEA 3RY4A 3UTSB 4R97C 3HR6A 4JFTA 2GUYA 2OSXA 1SEQH 1JTOA 2C7FA 2NUTB 2WVTA 3GMMA 2BWQA 3HAEG 4NQQA 4A04A 3UTZA 3RX7A 4HOZA 2QSTA 1YEFL 4EXPX 4U31A 5ICYA 3N06B 3RUGB 3GXDA 1CFTB 1A6ZB 1S8DB 1MRDL 4XGZB 2JPIA 3PWUA 1JPST 3PWNB 3WLWD 5JMVD 5I75C 4PW3A 3MGOA 5I6OA 4QR7A 3D2UA 1KIPB 4KTEH 3VFNA 2ADFL 2FNBA 1DYZA 1USQA 2A6DB 4I18B 3CXDL 2VN3A 2FZ3B 2CRYA 2I07B 5GGTH 1QO3B 4L3CA 4HFUH 4U2YA 3CFKB 1F13A 4HC1L 5LDUA 5EZLA 4QRRA 4OU3A 4YX2L 1YG9A 4G7VH 4X6DF 4GG6E 4E42A 4XWOC 2VDPB 2R8SL 2AKRB 4PJFB 3P02A 3R19A 4PN6A 4XCFL 4DVBB 4EI5A 4XVSH 4AL8L 1BBJB 3DMMC 4LLDA 1BQUA 2EKSA 2DQGH 4KXZI 1NAKH 4FQXC 5C0BE 3WFBH 2K6YA 5I1DA 3CZJA 2RB8A 4E9VA 1EQWA 4N6RA 4JHBA 2D0GA 3GSRB 5AAWC 1AO7E 3PRZA 5E2TL 2V33A 3R1GH 2XWJB 1MCDA 2P24B 5D5ME 5DJDA 3FSOA 1BA9A 1K5NA 3PFQA 5D2NB 3TN0C 1JZ3A 5CEXA 3VX1A 4EI6A 4JZJB 1S9XA 4MQSB 4MMZB 4XMWA 1NZRA 2NW3B 4YSUA 1PBYA 2D9QB 5E2VH 1TPXC 2F19L 5DMGD 1T3FB 3BAYA 4M1CD 4AGNA 2X6BA 4HJ0C 4Q9BA 3QNYB 3BZDA 3GZPA 3CZKA 4JQIL 4N90D 1KFIA 2NX5B 2WYZA 5D5MF 3WIHA 4OF5A 5IW1A 3VXRB 1AHWB 3HG1D 2Y7OA 2WVSA 3HJEA 1NLDH 4EZJA 5CBAB 1I1AB 1VACB 3P73B 2ZNXA 3FFDA 3HE7C 4X7DC 3HE6A 1QZ1A 1H3PL 3GSOB 1IC7L 3UBFA 3MV11 1QFWH 1MFEL 3UC0L 2VKXA 2AXHA 3CVSA 4FD0A 4G5ZH 1BJ8A 3F3HA 4TQPA 1H9DA 1ZVHA 2X42A 3B8YA 1NSNL 3WD5H 1MJUL 4U1HB 4R5XA 3O6ML 3VD1A 4PJGB 2X1QA 2NY6B 1NC2A 4JAMA 4RFEB 5IV2A 4O5LH 2F5AH 2NOBA 1QI3A 4L9LB 1QI5A 1KO9A 3EIKA 1CLCA 3TEYA 1W9XA 1KLFB 1SJHB 3VFMB 3KW7A 1F1GA 4KJYA 4L8CB 1PLGL 5I71C 2DL2A 3LNDA 3V6FA 1MCBA 3LXCA 4XI5C 4PQXA 5FKAB 5E6SB 1YN6A 3NK4A 4KGJA 1U0QA 5D7JA 1GTFA 3U7YL 2YJLA 2G60L 4BH8B 4DHLA 1Q72L 1KEGL 3EO1A 2V92A 1UH2A 4O2EA 2V3FA 1A3RL 4DO5A 4E41D 5ALCH 1U8CB 4EDXB 3I6KA 3JWNG 4LVNC 1XF4A 4QHUA 4AYFB 4HOWA 2XTJE 2Z0BA 1I7RB 3EDJA 3CFBA 3HZMA 1RJCA 2PTVA 2M83A 2PKDA 3B83A 1KBGL 2IPUK 3SDDB 4U1NA 1AHMA 3MRLB 1HIML 3WY3A 3ARED 1JCKA 3CE1A 1R3KB 4DGYH 3GJFA 3CLEL 2YC1A 4AYBA 4N2MA 4Z7NB 1JWUB 3LKRB 3T6QC 3NZHH 4J7RA 1UA6L 4FTVA 1CE6B 1U8LA 4D0CA 3IXTB 5FYKE 1FO0L 4G82A 5I0DA 4MDJA 4E9SA 3CVIL 3ERXA 2G5BB 2WWKO 2XFGB 5MEPB 2AJZA 4HSCX 4IIQA 4FMVA 4DGVH 3SYOA 5AN4A 1F00I 3H2PA 3GQFA 3RBGA 5E5RB 3K81A 4KWUA 3U0WL 4JANA 4K9JA 5J5EA 2FECI 3O3DA 1PJ9A 2DLEA 3L5HA 4IU3A 3HE6D 1CBJA 5CWSB 5KJRL 3PYCA 4GBXB 4L3ED 3JQOB 5F8QC 3R0MA 5FYJU 3GSNL 1MJJA 1TKWB 4H2AA 1BXVA 5F7NC 1TVBA 1MHPL 4L1SA 3RVUD 1G6RB 1UB5A 2F8IA 4XOBA 5F9OH 5HGBA 4WUUA 3DI3B 2Z7YA 3QQ3A 2WSPA 3SDYH 3VGAB 2WVVB 3ILEA 5H94B 1JXFA 5PCYA 4ZUTB 1DQVA 3MREB 3K8KA 5GJTL 4BK5C 3QRLA 2GY5A 3E8VA 3CU7A 4XAKE 4W9DC 2QPUA 5FYJD 4FQ1L 4HUWB 2ZKMX 3BDYH 3IT8D 3I50L 2NT1A 4LCIL 5DC2A 1CICD 1PG7H 1T1WB 3RVTC 3W9EB 5IMMB 4NCC2 1IC5H 1G0YR 2ZX5A 3IPBA 4P5TA 4U1JB 5I1IH 1DANT 1W0YT 3MACH 2VT0A 1WGVA 2R0KL 3ROOB 1TZIB 4AIZB 5BZDB 3QCUH 2W88A 2VZTA 3PL6A 5I8OL 2XPYA 5D1ZC 1KB9K 1IFHH 5I8EB 1T03H 2PNDA 2Y24A 3BH8A 2E27L 4MCZB 1AS8A 2MNJB 4OJAA 1N2RA 4JHAH 1PYWB 5IVXB 5C08B 3ZL2A 1MJUH 3NAAH 3GB7B 1AHWC 1UWFA 3D39D 3QXAA 1VA9A 4BELD 4ECNA 1MJ8H 5ICYB 3MV7E 1CLOH 3KBPA 3MRDA 4YHPB 4LPXA 3FSAA 4ZS7H 2J25A 3SDDC 5FK9B 4P0DA 1J1XH 2MZ8A 1A5FH 3TA3C 1RMFH 4R0LC 3B9KD 1EJ8A 4D8PB 4DZBA 3M1BA 4X7FC 2BOCA 3L3GB 4HUKB 3LIZA 4UTCA 1OTTD 3P40A 1N2RB 2G60H 1KEGH 2BFVH 1RZIA 4M5YH 3AAZA 5KBNC 3TBVB 4F8QA 4LBEA 4FKEA 4LAQL 4L2LA 5IR1B 1OQXA 5FWRA 2J71A 1T0NA 5DEJA 3MLYL 3V9FA 4DP1X 1C7SA 3ZZQA 4PMEA 4U1GB 3EFDL 5FO8B 4F57H 1QSFB 4GKSB 3PWLA 3N1GC 2K9UA 3DECA 2VDPL 1D5ZA 4U0RB 3SPCA 1KBGH 1JE6A 2CO6A 3I84A 2AK1H 4WNJA 3T4AA 5B3NA 5LBVA 2LGNA 5EN2B 3L7EB 4FXGB 5J57B 4JPKH 4WWNA 3GLEA 2E7MA 4RZKA 2XWTA 1CICA 4FQXD 2X1XR 4WTZG 2A99A 3UADA 1OHZA 5HYQB 2X4TB 1FG9C 4UM8A 1JPGA 2CDFB 4WI7A 1Z5YD 5B22A 2EDOA 2HJFB 4HCGA 4W9ZA 5AW9B 3X14A 3HI1A 4MQ7A 2A74C 3GHBH 3MCLL 4WW1A 2E9IA 2WKGA 3SBQA 1S5IL 2ADJB 3O6FA 5TGBB 1Z0NA 3M17A 4PTUA 3V7AE 3MYJA 5JPMB 4R96A 4MWFB 1BEYL 1ZV9A 5L2JB 2GBUA 4D0BA 1HU0A 3IDJA 1ZVNA 2GUOA 4ZQKB 5J9PA 4X9HA 2A6IB 3P4NA 1G7MA 3DXAA 5CZXD 3SDCD 3BH8B 3TH2T 4JHWH 1E4WL 2X6AA 4FQHB 4PM1A 2ZUTA 4WX8A 1M6OB 4TRPL 2BIQA 3VI3E 4YSQA 1CWVA 1BM3L 3PXLA 1MLCB 3DPBB 3VWJD 1IT9H 1UKQA 1QSEB 1NLBH 4A7UA 2HN7A 4KXBA 1TMQA 2ENYA 1MAMH 5SWSE 1X7TA 1CE6A 4FN0A 3GTTA 3HFFA 2Q8AH 5KSAC 1COBA 3D4ZA 1CDHA 1UCBL 3WHE0 4D9RE 5DUPH 4MS8D 5CCKH 1VZGA 3O0RH 3F05A 1BZQK 2FL5B 4MBRA 1T4KB 3U46A 3WE6B 5GRVK 5L0QB 1QSFD 3IXAA 1AH1A 1SUHA 1EAQA 3L4ZA 4G9FA 3CVHH 4HPHA 4F7MB 1CGSL 5DEFB 3O3EA 1SEBB 5GGTA 1HU8A 2K7PA 4UMGA 4AKPA 2ZAGA 2AMGA 2IQ9L 4MA8L 4RBPK 5I0WA 3MLWH 3CC1A 3M86A 4UQ3B 2W9DH 1CFNB 4F93B 1E6OH 1ICTA 2DLGA 4AG4H 5JHDE 3MV7B 3IDIB 3P69A 4KUCD 4R4BB 5C8JB 2DM3A 3IMVA 1M3HA 5CJQH 1I9RL 2VWEC 2XZCL 2Z91A 1CD1A 2F0CA 3KLLA 3KWUA 1W72H 1E5CA 1KG0B 1RIHH 5INDA 5A2CA 1FNEA 4AGLA 4PREB 1HHGA 3CTTA 5HVHB 4FA7B 4CGUB 1ZPLA 2XWTB 5ADPH 5C0IB 2FEDC 4NZUL 4OIIL 1GCYA 3TZVB 1B4TA 2CJ3A 5KG9B 1FO0B 4P3DB 2AK4E 4PRNB 4YDVA 5ECJE 3DUSA 3SE4A 1IGTA 3DSFL 4RGNC 2QELA 1QABA 3Q3GA 4PJBF 4JFFD 2K3TA 2OI9B 4IGBD 2ROYA 1G7LB 2VLJE 3ZDZB 1H5BA 4OFDA 3EDDA 3VFPA 5DVOA 3LKRA 3E3QE 3FMGL 4TVUA 3BI9X 4D3CL 5BMNA 2NY0D 4Y9BA 1UEMA 3VG0H 3HBPA 4QOKA 4OM1L 4Z3IA 5DMKB 2YPLA 2C1PB 5IQ7L 2JB6B 3PJLA 4IRZH 4KVPA 3ULXA 1MFAL 5BRZB 4NUPA 5MEPA 4W70A 4MMXB 1I8LC 3VFMA 1A1NA 2F58H 3OHXB 4CKQA 5HHOE 3NABH 3UZQA 1X5KA 2GCYA 4LT7A 2X88A 2EE9A 1UD6A 1J11A 3NIFF 3L7FB 4NNYB 2ED7A 3M1OA 2WO4A 4U6YB 4WZSD 5HDOA 4HUXA 2HX7A 5AVVB 4GBXD 4L3EB 4D9LL 3WFHA 2ARJB 2EDMA 4XZ4A 1YEFH 3AGWA 5IHUH 1AKJD 4OZFB 2DL9A 1B9ZA 3GNML 2CE6A 2JB5H 3PJSA 4GO6B 2BMKA 4XH2B 2UZXA 3HG1A 4NKOB 5KYWB 1RK0A 2BK8A 3FAWA 3NCJL 4I3RH 4Z77B 2EEFA 3A4FA 5C09A 1F02I 5I1KH 2F15A 5TK4A 1T5XA 5KVDE 3FYIB 2R5XA 3MLUH 1IM9A 4I0PB 1I7RA 1NCHA 5BOJA 3LEXA 3HBQA 3UPRA 2R15A 1WFNA 4FGMA 5CD3B 3HS9A 4KHTL 4YNYA 2B9BA 2NOYA 4M7LH 3LNGA 1NFIA 2X4OB 3QXVA 1NGYB 5SWSB 1PVSA 3QZWG 4AV0A 3C5XA 1FFNA 3CC5A 3DIFB 2YPKA 3DRQA 4WUUE 2YD8A 4R4BA 2Q6WA 1CQKA 2I7OA 3RL1A 4QCIB 1M7UA 4KK8C 4M00A 1E4WH 1RZKC 3V4UL 3BIAX 1DFBL 2P5ED 4TRPH 1MEXH 2C7UA 3T3PE 1XL6A 1A9VA 1BM3H 1Q4NX 2VZOA 4ZOBA 3JTSA 3P0GB 1OP3K 1L6ZA 1KIRB 5C0GA 3RDTC 5HYQA 4B53A 1YEIH 3BEVA 4UV4L 1AHKA 3K2KA 1HXKA 2DYRB 1Z5HA 2H8PA 4HWZB 4DEUA 3D52A 5E6RB 5AYUL 3BIBX 4H1LH 4Q7DA 3MNVA 3FOMA 2I9LB 5E4IA 3LRHA 4X0KA 2X9XA 2EXTA 5C07D 1AD9B 5EZJB 4PGEA 1UWGL 3VB9A 4XOEA 2NNAB 4Y1SA 2Q6WB 2CO7A 2CHZA 4LSVH 3B56A 5KANG 3GGWB 3CVHL 4JMNA 5DHVA 5JORB 1K2DA 4DETA 4EJZA 1CLYH 4GEJA 5IY5B 3MRNA 3WEMA 1SLUA 2YSSA 3NTCH 1XR8A 4F8NA 1NCAL 1PX3A 3NDZE 3ZZ1A 1IAOB 5KANI 2OI9C 1T2JA 1IC0A 1H6UA 5D6DC 2Z31B 3SDAD 3OKEB 3I6LE 2R56L 3CPUA 3IN2A 4WO4A 1I8AA 4XNZB 3AAZB 4JREB 5D1QA 1N8ZA 2BP3A 4FERA 3L3IB 1XQ4A 4AZ8B 3A4EA 4N90E 1VCBC 5L2KD 2BCKB 1N5YH 1M9WA 3UC0H 4DN4L 4KO7A 2J8UB 1I9RH 1D9KA 2XZCH 1FZKA 3NJIA 1TNNA 3UO8B 2CQVA 2J6WA 2VLRB 5CZKA 2BMKB 2D9CA 2GSGB 3I3EA 4TKWA 3D6GA 4HKJB 5ICZA 3VU2A 5FA3A 3M46A 5AKVA 5F3HB 4JFWA 1MHEA 1P4LB 2YRLA 1I82A 4IDLA 5F7DB 3J27A 1NIDA 4O5LL 2HCZX 4ACPA 1QOKA 4QGTA 3UPAA 5C0JA 4Y19B 1G0DA 4X50A 3GJEB 5DYFA 3S3JA 3WIIH 4HUWA 3UBXB 4M3KB 4G6ML 5DJ6B 4WY7L 1T7XA 4KK9C 1JTPA 4P3CL 2BC4B 1W0VB 1OGSA 1A4JB 1F11B 5D7HA 1UM5H 1YEDA 1JRHH 2XWZA 3SBWC 1KBPA 2BFGA 1JBJA 2YPKB 3DRQB 5AOMA 1KCWA 5E7BA 1K8IA 4WLCA 2BHUA 4J4PD 2ADGB 4ZUWA 4APXB 3N44F 4GAJH 3VXMD 5MERA 2APWA 3FKUS 4MA7L 3ESPA 1OV8A 1UHVA 2G9HB 3FT4A 4F37K 4WJ5A 5HHVL 2WNXA 3O11B 3SJVE 3T0BA 5C0AA 5AG9A 1EPFA 4JPWL 3CDGA 1A9BB 1AGFB 1N0XL 2PXYD 2YS4A 3N2JA 3OAZK 4G8IA 4PAZA 4R8WL 3RGVD 5I75B 3WY4A 3H55A 4IHOB 1MH5B 1FAIL 4W9LC 5LGHH 4UTBL 2RCSH 1FVDB 1CFBA 4BFIA 2OW7A 1WISA 1K85A 2IMNA 2KLRA 2D31B 3MLRL 5AZEL 4N4YB 4PJEA 1U95A 4H13C 4QWWD 2PPEA 4YO0B 2VXQH 3I9GH 1CF8H 4JFVA 1JNHB 3T65A 5C0BA 2IOIA 3GMRA 3L4CA 3UBGA 2QLVA 3QJRB 1CK0L 2F6AA 2H47C 4LCVA 5DGRA 3NCYP 2NMSA 1EO8H 4JPSA 1JVKA 4J23A 4KY1L 1MHCB 4IIQC 3X12A 1JK9A 3OHXA 1FNFA 1XMEB 4PG9A 4B27A 1U2YA 3QPQC 5J1AB 3KWVA 4PRDA 2QZQA 1Q0YH 1VSCA 3MRIB 3KPRD 1I1FB 2JKLA 4I88A 4P5MA 4QO1A 3V0JA 1FL5B 3DIVA 4OZGF 2ADYA 1SDAB 4X9YA 5DD1L 2OS7A 4HMCA 3WE1A 2OZ4A 1NVPA 3ARBB 3LKOA 2QGDA 2V8LA 3BGMA 4H26B 2YQ3A 1ZIAA 2B3RA 4CC1A 5AL8A 5JW5B 5C6PB 2R0LH 1TPXB 3FFCA 3LRGA 3P11L 2GJRA 4PV8B 4DP6X 4M8UA 1QAWA 4IOFC 4C8XA 4BZYA 1LK2A 5C0IA 5JYMA 1U8KB 4JFDE 3VWKA 1E9OA 1NCWL 2NSMA 4RQQA 3SKOB 5ABZA 5IB3B 4KI5C 4A66A 4L1TA 4U1SA 4ZPTA 5GJTH 2FAUA 1KN2L 1HWWA 2IDTA 4ELMB 5INCB 2HKFH 4RAUB 4OZFG 3TA4D 5TQ0H 2YARA 5D1XE 1IQDB 4JFUA 1MFDL 4N0YH 4HDIB 4OGXH 5HGDA 1U8CA 3S36L 1HEHC 1IBBA 2YXMA 4UF7C 5TE6L 4PS8A 3G5WA 3Q43A 5CZRA 3ZDYF 5GS0C 4OCXH 1XHHA 5ICXA 3T2NL 3UPCA 3VMOA 3O6KL 1UM4H 4I18A 4NX0A 4URTB 1I7ZA 3ARDD 4BFNA 2Y1YA 2P5EA 4I77H 2BNQE 1IAIM 3O6LH 5BS0B 5FGBA 1FH5H 4OCWH 5CJ8A 2A83B 4YHKL 4WV1C 1AZCA 3GSVA 4GXVH 3V0GA 3RHWK 1HXMA 3OKNA 1CFNA 1CT8A 3QJTB 3UGUA 1F4WH 4G6FB 1Q0XH 4A6YL 3BRFA 5C97A 4R2GB 1R3HB 3QIUD 5C0BB 1I1AA 3OJMB 5ANMA 1FQ9C 4OI7A 3QJFA 4XNMA 5KWYC 4KUCF 4PP1C 4ZUSA 3MUHL 1HNYA 1TQCC 3KGTA 1A5FL 2I60L 2Q3AA 3KPLB 1JD7A 1HVXA 1A7RH 1I7ZB 3FTWA 3ZDYE 3GFUA 4GKNA 1YEHH 1BVNT 1NAML 3E0GA 4YDLB 1TGHA 3ZYIA 2LU3A 3ZDXF 2MMXA 1IJ9A 3QUXB 1I9IL 4GW1A 2JQMA 4HK0B 4D0DB 2IBBA 1K4DA 5E9DE 3IN0A 1SUJA 4IHBA 3IAQA 3RWHB 1PQZA 4P9HL 5DFTA 3FBQA 3HUJB 1ZE3H 1ZJBA 3HMWH 1VFOA 3VXOB 1B4JL 3FDWA 4RWYH 4XNXL 3U1QA 4XPBL 3UABA 1NH2A 3TZVA 4Y4KD 4EF3A 3V55A 4MAUH 4WEMB 4MSWB 3FU7B 3NEOA 4BH7B 1YN6B 1IAKB 3V6OA 1S9XB 5LNEA 5FR3A 5FUZH 4ZFOA 2VIRA 3DROA 2UVFA 3SCMD 3SYQA 5TPWH 4Z7QB 3NCEB 4O2CB 1TCRB 3QDMB 3I9GL 2F19H 2A9AA 2WLLB 2HTLC 3C5JB 4GYBA 1ZLEA 5H35B 3KBHE 2EXYD 2ADFH 2NY3C 4PBXA 3T5WA 4NN7C 2CG9X 1U8IA 2YKLL 2KI6A 3AXLA 2AAVA 3B4NA 5IB5A 5I5MA 4OCLC 2EDEA 1IVLA 2PYED 3D7PA 3FUNA 3IJSB 3ZR5A 3ABMB 3ZUCA 4ZMTA 5EC2A 4PJ8B 2ESVD 3TWYA 4HSAC 5IJVB 3FRPB 5K1VA 4DUXA 1ADQA 4F27A 2NPLX 4S10A 1DHKA 4CGTA 5I66B 1YN7A 1H0DB 3QEQD 1CCZA 4TUUA 1QEWA 1QRNE 4S0HA 1NSNH 3WD5L 3QUZA 5FGCB 1PZUB 2P4AB 5KSAA 5JR1H 2YPVL 2CBPA 3C12A 4AK1A 4UT7L 1FRGH 4PJCE 4W81A 5EU5B 3PIQA 5CN3A 4MAYA 3BYTA 3IDJB 4F9PC 2MCG1 4WFED 3M1BB 5FYLH 4AE0A 1KN2H 5HJ3A 2NW2B 4ZD3L 3U6XA 2WINB 3K5SA 2FJHB 3B5HA 4LHJB 4XMXA 3ZN6A 1MCIA 5HHNA 4MJ5A 3MRCB 1Q9LB 1ZLWH 1T0PB 4FDWA 1F18A 3AC0A 4LKXB 1WUZA 4PJDB 3KPOA 1M1XB 1CGWA 3MJ8B 1WA1X 3ISRA 2DTMH 3HW7A 1E2VA 5BZZA 2H1PH 1FI8C 4PW9A 4EPSA 2VLMD 4HAKA 4BCYA 1V7MH 2VL4A 5I1LB 1KLUB 1QFWL 3O6KH 4MJJA 1HFUA 4NO5B 2GJ6B 1F6FB 5FKPB 3KYNA 2G30A 4UBDC 4WK2B 4HWZA 5H4ZA 1RZKH 1U8QB 3C8DA 2ZYRA 4L5FH 3DPUA 1TZHA 5I1JH 4HK3J 5GGRB 2VDRH 3I74A 5EG6C 1TUPA 3FNKA 4YNYB 1I7TB 1XB3A 3CN2A 1E5BA 1UOKA 2PW1B 3VXTA 2VR5A 2WUCH 2QRDA 3AACA 2O30A 2EEDA 5JOPD 1LE5B 5JDJA 2V9QA 4HS8H 4F7PA 1E6JH 4LCCA 5ALBH 5EU6A 3G04A 3JWNC 1L9PA 4KRLB 1CXEA 2MQ3A 1Q9UA 2R2HB 5EZIL 4PJCF 4JLRB 4ODWA 1N3AA 5DGQA 5BCAA 3QZWB 2ADIB 2LOEA 3TVMC 5CR8A 1I8LA 1BVLA 3L5XL 4HZLB 4WUUB 1G9EA 2VMFA 3AT0A 5I19L 1CFSB 3LXUX 1PFOA 4PVBA 1JI2A 3WL9A 3QORA 1KIRA 2X10A 3NJXA 1ZHKB 4G1EB 3D30A 2B1AH 4R7VA 2X53A 5CUSL 1GKOA 3GXTA 3BKMH 3PP3K 5DI8A 4N2HA 1UFGA 3BPOB 4KV5F 4MX7A 4KKCC 3HZVB 2X1OA 2JTYA 3BD4A 1MW3A 4I1PA 1GS7A 1T89C 2EDHA 3BMVA 3FB6B 2J6EH 4GKZB 3FONB 4X42A 1C9BB 4OZHE 1T20B 2APVA 2PW2A 5F89A 4DESA 4K7FB 3HE7B 2XXCB 1FIGL 5I1KL 1H8OA 4EKXA 3L3HB 2CHXA 3P4MB 4PY8I 3QHFH 2C3GA 4K94C 2W60B 1G87A 2VDKH 4PRIA 1XCQB 4E0RA 1C5CL 3AB0C 1BD2E 4G9FD 5JLZA 3W9EA 5IMMA 4BFRA 5D1QE 2H3NB 4LCIH 2N1TE 3PABB 1ROWA 5JXEC 1MCPL 4JDVA 5DQDL 5GHWH 4LP5A 4X6CE 4JUTA 5EH1A 1Y18B 4KQ4H 4WKZB 1HZHH 1FNSH 4H25A 1QYGH 4OFKA 4R83A 5A6MA 3LNFA 4LHUD 4TSCL 5IFAH 1JXJA 3V4UH 1EA9C 1MQKH 1MZYA 3V4VH 2X4UB 1KYUA 1P7QD 3MKGA 5C86A 2EICA 2IAMC 4JGNA 4OD3L 2G3XA 3VACA 1WCBB 3PL6D 4BM7A 4CMMB 4QTHA 2FR4A 1ZHLB 2TRYA 3MLXH 4AQZA 5E94B 2OTUA 2CR3A 1WK0A 3QA3B 3GXIA 1CGYA 2VQUA 5CLXA 5JA9A 1KXVC 3L9RA 5JOEA 1ZTMA 3I9IA 4KX8A 3QFGA 3QWOA 3APCA 2BM3A 3RVXC 3UEZA 2IOMA 2WTRA 3T4AC 3ZT7A 5DWUH 4DVRH 3KG5A 4OCSH 3OLGA 3IMBA 2W07A 4RMVA 3DUUA 4XP9H 1VGEL 2VC2L 5AAMA 4KKLC 5CBAA 2BVPB 4OLVL 1MFVA 3OGCB 2Z0FA 2Z1KA 6TAAA 1FL3A 3G6JF 3ZKXC 3QCVH 4QT5B 2FB4L 1KGUA 1EEUA 12E8L 3ECWA 3QRGH 3QCUL 5DZJA 5HHXH 5K9KA 3PDKA 1MY5A 3A4DA 1W6WA 1DVXA 4G43B 3NJNA 3D4GA 5IGXH 1RZQA 4O4YH 2O61A 3MCG1 1LP9A 3EG9A 1JYXA 2E8ZA 1NCTA 3LN9A 3V5DB 4ENED 1RHHA 4GI6A 1Q1JL 4MJIE 2WSDA 3NIGB 3P3SA 1MFBH 1E8WA 3NAAL 4J8RB 1PCJX 3NIGF 4BCZA 3T0EA 3VG9B 1EMTH 1ITCA 3B7YA 5LAXB 4PJGE 3GSUB 1GZQB 1TQVA 4WNSA 2A77H 5D6DA 4F2MB 3DJZA 2FEEI 3GRBA 4WZ9A 1ED3B 1OANA 2J4WH 3VYOA 3ZE2B 3AS1A 2CCLA 5EA0H 5E00A 1AI1L 2HVKB 3EO1B 4F37F 4X5PA 3QBTB 1T3FA 4MD4A 4G7VL 5JHBA 1CBVH 3KYOB 2BFVL 3DV6B 5IQOA 1JPTL 1S78D 3V5HA 1Z3GL 4PJ8D 5LCVL 4L1LA 4R7NB 4M1DH 3ZE1B 3QEQB 2D7PA 1UD4A 1JN6A 3VD5A 3MXVL 4ADGA 5AVWB 1RUPL 1EAPA 1ZT7A 5B8CA 5C7ZA 2YAHA 2DDQL 2HYMA 4OD2A 3RWDB 2K4AA 4ZPVA 1EHLH 5JXAL 1KGWA 1F90L 1H3TA 2D7TH 2HFEB 4X4ZA 1KCUL 3FTSA 2IGTA 2C9RA 4AQ1C 1U4EA 1BIIA 2R2BB 3QORD 4QXVA 1FZMB 2EACA 3CGTA 4U1MA 1HOCB 1GTNA 1H8NA 3HC4H 2LAAA 3T3MF 4NPJA 1XGTA 2XFXA 4UZGA 3PQYB 2VCOA 3FFDB 2ZF8A 4G8GE 1V27A 2VDLH 5B39B 1LWHA 3KE0A 1EO8L 4PJGF 1U33A 3UZEC 2NY4D 3STZB 3G9VA 1RM1A 3ULSB 2H2SC 4KXAA 1DVTA 3BFQG 3QUXC 3OC3C 3CUPA 3UTQB 4MQTB 1WS7A 2ORBL 3T4YB 2MHAB 3R06B 4ODSL 4P05A 5FB8B 4PV9B 1P7QA 1WQAA 4H8WL 3C2AH 2PYEE 3EFFA 1E0OB 3TPKA 3QYCA 2ATPA 2ZNWA 3EJYD 5CIPA 4ZW3A 4JO3L 4Y2NA 2P3YA 3P9LA 4U7SA 3QNXB 1B3IA 3MROA 4G1MA 4ZAKB 3FO9A 3VDAA 4G8GA 3NH7L 2YRPA 2YBRB 3UTOA 3R7QA 3QDMA 3ZTNH 3VXRE 4YXLL 1MAML 2C26A 2LVEA 4ODBD 1J7VR 4GFXA 3T6ZA 4N8VB 1DN0A 1T0MB 2Q8AL 4P06A 1DJSA 4Y5XC 3ZE0B 3BESR 4WW2B 4KXZH 1CFQA 1E4HA 4PJ7E 4CADB 2VISB 5ISZD 1YPZE 1QMUA 1KPVA 1XTMA 1W0VA 5DMIH 4K5OA 1V3MA 3VI3A 3L13A 2QPEB 2IANA 1BQRA 5D6CB 4LCCB 2DLFH 4QEGA 5KSAB 3CFCL 1AGDA 2HMIC 1HL8A 3KPPB 5HI4D 1XF3B 4MXVE 3OSVA 2ENJA 2WLHA 5M94B 2WXFA 3DC0A 3S0PA 5F0JB 1JDAA 1IAOA 4GQ9H 3RAJL 1A7PL 3O8XD 3WKYA 1NFDF 4HGWA 2VIRB 4ES8A 1GIGL 1PYWA 4NJ9H 4FQCL 4OF6A 3WG7B 4UT9A 3OAYK 4Z3HA 1TQTA 1W72L 2NNAA 5SV3A 3CFDB 2GBTA 2CM5A 3ZTJH 5KYWA 3ARFA 4Q6IB 1DQJB 1EGJA 1KFAL 3DTXB 3F00A 4RMRA 2KKQA 5IBUG 4GXVL 3LSOA 4YSDA 3GSNB 1WHPA 2YSSB 3T8XA 4YO0A 2X4QA 4JVUA 2CJSA 2V7NA 5F3BB 1Q0XL 2Z31A 3FCTB 4X6BB 4XPFH 5GIRA 2PYEA 3ZW3A 3FQNB 4LCWA 4KRMB 4QYOB 3M7FB 1AI1H 4KMLB 2JJSC 4M7ZB 4DEWA 3VUAA 3TF7C 1NDMA 3OGOE 1RK7A 3FCGA 3MOAL 4DGIL 2V2TA 1GAFL 4S2SA 2YXFA 5F8RC 5FO9B 4FXGC 1CXFA 2HLAA 2X0VA 4I2XE 1DQMH 3ZXAC 1MHHA 5AKSA 3WTUA 4QJ3B 2NYZA 4JZNA 2A4EA 4S0SD 3FC8A 1OXYA 2OCJA 4FCHA 3MBEC 3MC0A 2UXGA 2HRHA 3WJJC 5IEHA 3HZ3A 4AK2A 3DHMA 2UWEE 5DSCB 3L3OA 3F7LA 3DBXB 4QY8A 3QEHA 2X70A 3WO4C 4P2RE 3HR5A 4ZX3A 4KFMA 1JFIC 5JPMC 4ABUA 5D96C 2ZYSA 3S8GB 4UIKH 3MV8E 5HPOA 2A1WL 4JG9A 4IOIB 3SEPA 5HYSG 3EOAB 3QUYC 3OKYA 1CZ8L 1R33A 4M5ZH 2BVUA 1VPOH 3HUJA 4BFGA 4DN3L 2GYSA 2NY5L 3HHSB 4MD5B 3OR7B 4H7VA 1JPFB 2IPTL 3UEQA 5LWYH 4J3UA 4BUHA 2KMWA 4JRYB 5EF2A 5DC4B 2W07B 2AQRA 1B0WA 3IDGA 4LVHB 1D5RA 3JUZA 1AKJA 4KZCA 2GBAA 4P2OC 3GBML 3DX0A 4N1EA 3WN5C 5L7XL 3HMXH 3SPVB 3ZRCC 4ZODA 1OO2A 3BPOC 4X4MA 3PV6A 5HDRA 1INEH 3UTTA 1SOXA 5T5NG 2KT6A 3G08A 3QUZC 5EEUA 1MW2A 3EGSB 4L8SC 4QRTA 4AUYA 4C83B 3ZR6A 2IH3B 3KCWA 2FYYA 4GFTB 1LE9A 1YMMD 2FK9A 1CR9H 2EO7A 4FFTA 1BVKB 5IG7A 4NQEB 1N26A 3S5LA 1YEGL 2JI2A 5F9JB 3I2CL 3B9AA 2NT0A 5EEYA 4HZ1A 1MCNA 5DD3L 2X12A 4QTHB 2NNRA 4IGBA 1AS6A 5EOCJ 2CKBA 5IKCB 3CFCH 3O3AA 3SJVD 5AOIA 2F54A 5IM7A 3NTCL 3QNZA 3ZL4L 5DA0B 4YL9A 3EFFB 1QTYT 4LASH 2XKNB 4LSPL 3Q8EA 3TZVD 5ERWA 3LZRA 2PR4H 4FZ8H 3SKNA 1N10A 5I1DB 3CJJA 2P48B 5AW4B 2R29L 2YWZA 3QZPA 1I8MB 2C1OB 2ZAIA 4FMKA 4GRMB 1EAJA 3OJ2C 4KJYB 4L8CA 3FO0L 4PG9B 3B2UC 4N8VA 3BT2L 2P24A 3CDFA 4PI0A 1U92A 4FFVC 3O8XA 3BUBA 1IKFH 1GGCL 5A2BA 1A14H 1YAZA 3KS0J 4CVXB 3DTDA 3WEBA 5TDOA 1KTLB 1T80A 1ZHNB 3BUPA 3DK0A 1UWXH 4PJ5B 5IUCA 5IV2B 4LRNL 1HXMB 3OKNB 3GDCA 2ZUUA 1LWVA 2WGNB 3N1MC 3QNYA 1BD2B 3BKYH 1U6AL 4HIHA 3GMQA 1BG1A 3DVGA 1ASQA 2P5EB 3G9AB 3RWCA 1OARL 3ATAA 3QQXA 4ZSOA 3O2DH 3F65A 3ELAT 4IBTA 2Y7LA 3FCBA 3U83A 4EI6B 3NVQA 2CIKB 2OSYA 1UWEH 3HIZA 2M8XA 3KVQA 5KJ4A 1DQML 1IAMA 2X1WL 1N4XL 2UUDK 1WSST 4U7MA 5DK0B 2ATAA 4HHWA 4PY8J 4EDXA 2QADB 4U2ZA 2NX5A 3S5ZA 3N55A 4A2MA 1JK8A 3VFOA 3LH2H 3T6VA 3U1PA 3EYSH 3X2QB 1R3JB 3GZQA 1EUVA 2AW2A 4XN1A 1IEBB 1IM3D 1SMDA 2A74A 5JIIA 3O41A 1OGAD 5CILL 3SE9H 1BQHG 3ULVF 3UTPD 1ED3A 4AVKA 3UJJL 3S37L 1MJ7H 1OSEA 1DP0A 1AYRA 3H9SB 5C0AE 4ZXBC 1MCOH 1MI5D 4GG8A 4WTZA 5GRYA 1K6QL 4NJAH 1OB0A 4WW1B 3TU6A 4AYSA 4RX4D 4BE5A 2Y7QA 4RGMB 3BUTA 3CLFL 4KKPA 3TCTA 2K1MA 2WLYA 1M9SA 1MHHB 2Z91B 1RUKH 3VRLE 1IBHA 3MUJA 4ZG1A 1G7HB 1TZOA 5FYLE 1T89A 4OLYL 3CSTA 2CXKA 5E5UB 1QFOA 4EDWL 4FRWA 5HY9A 5C09E 2C9QA 4Q2ZA 2DIEA 3IU4H 4Y4HB 3WUWA 1NCBL 1A7OL 3ETTA 2E7LC 4QUOA 2X4SA 5I2IB 4CRPA 1N8OE 3QQ3B 4GLRH 4GW4A 4CBPA 3HG2A 4CVUA 3STZA 4HJSA 3BZFA 4B5EA 3FPXA 2JJTA 2D73A 4FTVE 1YC7A 2W95A 3CFUA 3SPGA 1BZ9A 3MU3A 1MJJB 4YDMA 3WTSA 4GKLA 2C9UA 1JHLL 4F2ME 4F33A 2AJVL 2Z65C 4X7TB 1BQLL 4X98A 3HG1B 4NKOA 4D9QD 3WNMA 2YMOA 3AG2B 2Y8LA 4XMKL 2WB7A 4KK5D 5K93A 3TJEH 2AEIT 1P84J 3O3BA 3ZTDC 3NIGE 2AV7A 1HC1A 4R26L 5DEGA 4M29A 4LGSB 1D7BA 2Y1VA 5HVWA 1QEWB 3RJQB 2VXUH 5FOJA 1JN6B 3TDHA 3ABKB 1RHFA 4JN2A 1NUGA 4KKLD 3LEYL 4XX1G 2PWHA 1S9VA 2DBJA 4N28A 3VFGH 4EZKA 1G4MA 2PR4L 3MJ9H 3QC6X 3ZRFC 5EO9A 4EOWH 3V6ZA 1YYML 2BNRB 2NR6C 3V9CA 3ZT6A 2R83A 2ATKA 1VFMA 2F53A 3IWVA 4OZIE 2X4NB 4O00A 5DK2B 3H3KA 1J5DA 4PJ7F 2XN9A 3RIAF 3ZHNA 2IPKB 4BFKA 2XCMC 1KWKA 2UUDH 1MNUH 5JTWA 2XSKA 2AEPL 3KCPB 1R5WB 1WEJH 3M8OL 3QXUA 4G7SB 43C9B 4AV4A 5C0JB 5CD5D 2XIIA 3Q3GB 2H0FA 1G84A 1ZKAA 2ICES 2K8MA 4NRXA 2ICEC 3UACA 1DJGA 3QFDA 2Z8RA 3WLBB 3K1KC 1R5VB 4UZUA 2EH8H 1Y6NR 4QCIA 1JGLH 3EFOA 2XZQL 1CYXA 4Y88A 1BFOA 1JOIA 5J06A 1RZ8B 4KZDL 1T1YA 5FECB 3LS5H 4Q14A 2IAMD 1MFUA 1A6AB 3QR2A 4JFEB 3RVVD 5KS9E 1FVCB 2O5YL 1CL7L 2J6EA 4U1IA 3BP6B 4DFHA 3SYCA 2NW2A 1CDWA 1IGYB 2PCPA 4XN7A 1MELA 4HCRA 5GISH 5I17A 1S7RA 2MPVA 3LEVH 3IB4A 2Y07L 4TNWK 4QRUA 4XVJL 2WAQA 3BEWA 3ATEA 1RK0B 2R1WA 4Z78A 2FE0A 2RIKA 4JQVC 2OAAA 1E5ZA 2ITFA 2YUVA 3AXIA 5F7MC 1YPZF 3JV6A 4MDJB 4RDQG 4HWEH 3AXHA 1E8XA 3I75B 2XA8L 4ZO7A 2OYLA 3S37H 3W39A 5MHSE 2AJZB 4Y5YC 3RWJB 1YY8B 2ZOWA 5F7KC 1DVFC 4PBVC 2WZPD 3R8BB 4QRBA 3AADB 3UG3A 1AGBB 1K6QH 1MCQA 4OKVB 2AEOA 3KNBA 3RU8H 1M71B 3BDYL 3GEFA 5E1IA 3TVMD 2B0SH 2XTJC 3K71A 1XTLA 4TSAH 2BSEA 3V4VA 3DDGA 1AGCB 3N6YA 3WKQA 3VSTA 1Q1PA 1O9ZA 2RBLA 3F6JA 3LD8B 4UI2A 3X17A 3Q01A 2X3AA 2HL8A 2VTFA 2WAHA 4BXSV 1Y1DA 4H8WH 4GRWB 1OB1B 5FHAL 3VI4F 4HJTA 5EOQL 1A3LH 5FYJE 2C4FU 2DBLL 3KPSE 4XC3H 5KVMC 4NUJB 3MXWH 1FL6B 1THCA 5TD4A 3V2AR 5BQDA 3RNKA 2VERN 3CQQA 5DRXB 1QKZL 3CVCA 5LAXA 2BXZA 2R2CA 5LG6A 3WOVA 4XVTH 2NOHA 3O3EB 2VLKA 2XA3A 3R0NA 4EAGA 4DNLA 3U9PL 2UXVA 3IH7A 5T3ZD 1E4KA 5F7LB 2L04A 3CBKB 3E3QC 3GRWA 4EMZA 4WKZA 1RJYB 4YQXL 2FYVA 3K91A 4MLIA 3IJHB 4PJXB 1T83A 3RA7L 4KJPC 1VESA 3DX3A 4Z8FH 3FQTB 3KWXA 3GI9L 5EN3A 5K9QI 2ICCA 5BZXA 3RP1A 2VDQH 4ONOA 4U1GC 3WUWG 1WCBA 3NFPA 1A6PA 1HTYA 2R29A 4K3JH 4GXUM 4P5SA 4JANB 3CH8A 5CP7B 4PR5B 3K6OA 4NQEA 4ODHL 3BP5B 3S5LB 5J7CC 2G2RA 1M3QA 3ZDZF 4Z95L 4FXKA 1IKNA 4WHTA 5MP6L 2CMRL 4F20A 2VDMH 3HMXA 4ODVH 4A7VA 3GWJA 4NQED 1UTDA 3FT3B 2V6HA 4HQQL 5FM4A 3HI5L 3H7BA 3PWJA 3GI8H 4JDVB 1MCKA 2XKNA 2W9EL 4PGZA 5H37H 1OP5H 3DSNB 1KEML 1IEAA 5D8JH 2WCSA 5B1AB 1ZLVH 4UQIM 2VDRL 3DX6B 3GSWA 4Y2OA 1RZJL 2ZX8A 2GIYA 4WI6A 1FO0A 2HLEB 4LGRB 4TPRH 1XCQA 3C5ZB 4DP5X 5KS9B 32C2A 1IKOP 3FQWB 1YNKL 3NUKA 1BZOA 5BVPL 2XXGA 3GF8A 5IMOA 3ALXA 2NTSP 4GEIA 4NP9A 4F7MA 1CK0H 2V5SA 1BPLB 1YA5A 3EJRA 2XV2A 3AU1B 1WIPA 3OKOA 2WKOF 1U8PB 3N43F 4Y16B 5HYJB 1AZUA 3BWAB 5I24A 1J1OH 4MA3B 4GUOA 5DQDH 1RCYA 5AG8A 3JWDH 1KENH 6FABH 3SIKA 1ZXKA 1WWAX 4X8JA 5D2LA 5I9QB 2AEQH 3QI9D 4Q11A 1XGPB 4MB3A 3TBTB 3D25A 4RH4A 4U6VH 3A21A 5FUCE 1BQHB 4GKNB 1OGTB 2E5EA 3P0YH 3TLRA 1EFXB 2X4TA 1SXBA 3KCPA 1TTUA 1XD1A 5KZCB 3D3VE 2E74C 4NQVB 3U9UB 3V4PA 1MOEA 5AOLA 5E2TH 4YBQD 2ODIA 2BX5A 2PETA 1EVUA 4LLDB 3MBWB 1Y6MR 1UZ6E 2EDYA 5CEYA 5EPCA 4XVOA 4HG4K 4P46C 4UIKL 4WAFA 5I1EH 3BAKA 2OZ4L 4RGOH 5D2LB 3X3FH 3U2SA 5HYEA 1JXGA 5K39A 1JF1B 2A9DA 3SGJC 5I76A 4O02H 2YEZB 3HC2A 1CL7I 3C5ZC 1PG7X 3SODB 3T0EC 1QQDA 5F1SA 2UVEA 4Y2DB 2HLFD 2NQCA 2J57A 5DHYA 5GXBB 2PCPB 4G6FD 2XC8A 2FB4H 3OMIB 5DRWA 3J2PA 3CFEB 1T2QL 3B9VA 2WLKA 2B3IA 1LYQA 1HL5A 1QYGL 2DQIH 3EHBB 1D2PA 2KUTA 4PRPD 5AZUA 3UMTA 3PDOB 4B9JA 5JHDB 4TSCH 2AQ2A 3BPLC 1A02N 3V0HA 5IB5B 1NMAL 1INEL 2K8QA 2W59A 1UQSB 5C6WH 1FE8L 3U2JA 1WAPA 4Q6YA 5LBSH 4JG0H 2CBQA 3HRPA 3IXTA 1WC7A 3C6SB 3H2WA 3JTSB 1D2OA 1PNCA 2XXFA 2VXSH 1XL4A 1QFWI 3H9SA 4C55A 3VWKB 4OGAD 1F4WL 1SJEA 4Y4HD 9PCYA 1PDKB 4R2GC 2OJEB 4XP5H 2ERJB 4XXCC 5JZ7D 2IEPA 1RSFA 4TUKL 5DS8A 5KSVA 3HNSL 2NY7H 1S3RA 2Y36H 1Q94B 5I74B 3HBZA 2DI8A 3BJ91 5DYOB 5F1NA 2VM4A 4PWKA 4R90L 2Q10A 3D06A 1QSZA 4LDEB 3N5AA 1UQSA 4NZTH 1Q72H 1NQBA 1DBJL 3H9SD 3H53A 4GUPB 5D1XC 2GSGA 2CO1A 3M45A 1WBXB 2K70A 3IETA 4F8PA 1IEBA 3NABL 5ACZA 4HYTB 5AL0A 1L7TL 3UYPA 4JFZL 2H2PC 2CMRH 1WAEA 4WEBL 3QH3B 2EXYC 3KYAA 4IBLT 4NQVA 5F21B 2QPSA 3LY6A 2CM6A 2XWBB 2P8MA 2EDXA 4MAUL 1F3DJ 1JGVL 3SCMC 1GA2A 4Y5VB 4P2RD 2VDNL 4DGYL 1P9MA 1PNDA 3PQYA 4Q9RL 4OCRL 3ZPDA 4E9WA 5L88L 1D9KC 3IF1A 4NI3A 1QW8A 3GXMA 1Z1WA 3JWDC 1N6QH 2YA0A 4IK6A 3REVA 2VMJA 1QP1A 4JM2B 5CP3A 5IHZB 4FNSA 5IJKC 1OARH 5I8EA 1J86A 1USZA 1UWEL 1ASOA 1WITA 4HIJB 1XAKA 4XBGA 2EDTA 3AQDA 1BX2A 3EBGA 1SY6L 4QI3A 5BO1L 3BVDB 3MV8A 5FHBH 1U8JA 1XIWA 4U1JA 4UTAL 4HGMA 3ARRA 3Q06A 2BP8A 1SN5A 3H7BB 4B9FA 3DMMB 5CKAA 4JL1A 4R5VA 2J20A 5AYQA 2K45A 3LZFL 1WZMA 3GK8H 4ZFOB 1HQRA 2NYYC 5F7YC 3D34A 4YDJB 2A0LD 2H26B 4BZ1L 4DH2A 2ED9A 1LK3H 1QWNA 2HP4A 3QEHB 4LEXL 5F9OL 5GZOD 4WUKL 1E2ZA 2DWSA 3B3BA 1HILA 1M7DA 2WXPA 4HJGA 2OP4L 4PJIE 4KROC 3ARFC 4AQOA 5ENWA 4HKJA 3UTTE 5ICZB 4PB0L 2UZIL 4ZNEE 1I9EA 2HPOA 1MQ8A 4FEMA 3VXME 3SGDI 3ZBMA 2PP7A 2F7OA 1WS8A 1SXSA 3JZ7A 1LP9B 3EG9B 5IT2H 4BV1A 4TTGA 2PCFB 5I8CB 5KSBA 1UA7A 1BWWA 4P46B 1ZV5A 1T6BX 4JO2L 5I5IA 3U79A 1M2VA 2FTAA 1S78C 2ZPKL 3FN0H 3MRHA 3FL7A 5CP7A 3F0ZA 3GSUA 1T6WA 4NHUA 1IFHL 4U7KA 5M7QA 1XF2A 1UYWH 4O9HL 4Z7NF 1U41A 2JCCB 2ZIDA 4D94A 1KTBA 2BHZA 3F64A 4NQCD 4F5CA 2LABA 3AITA 1KFAH 3OJVC 2OXHB 1GHFL 1YDPB 4MZIA 2Y7NA 3MFFA 5SX4I 1MRCH 3MGOB 3WE6A 4B95C 4BZ2H 2OMWA 1U95B 2W38A 2LTQB 1M3IA 1ILSA 3QPQD 2E9JA 2QGBA 3ZK0A 1HCVA 2FVNA 4AITA 1J5IA 4JRWA 1J8HE 3BP7A 4TUKH 2BS8A 1PL3A 1AR2A 4NQSA 2XX1A 3D39E 3W37A 3C6LD 3L3OB 3L3IA 3X12B 1MW1A 4N2OA 3BH9B 3L81A 2K6ZA 5SV4A 1VEPA 1S7XB 2Y1ZA 1P2CB 2H6UA 3VWKC 2JJTC 1FYTB 2WBXA 5I19H 4L37A 1SXZA 1EDQA 4KRPD 3LIZH 2B1AL 3PXHA 2PTTB 2E4FA 1MW0A 5ERWB 4R3SB 5J3HC 2HT3D 4MRCA 1BDYA 4I89A 1S7VA 2J72A 5CGTA 1BQ5A 1K5NB 3CK0L 4H8VA 1E67A 5HDBE 1Z3RA 2ZCZA 1CICC 4OKVA 1BMGA 5IESL 5DJ0A 2E6JA 2EDWA 1SEBA 3UBHA 2YRBA 4GAGH 3ZSTA 2WLIA 4KKQA 1U8MA 3G6AB 5IF0A 4FL4C 4FFZL 2L4OA 3QJXA 4JKPH 3QHFL 2QKIA 2X9WA 4Q56A 2G3ZA 4C59B 3CZUB 3RDTD 2FJSA 4UYPA 3HC3L 3MQIA 2NDFA 4QRTB 1SFDA 3PP3H 4P59L 4GS7B 5E51A 3BGAA 3KPSA 1OT4A 4J4PC 4WGVB 4XNDA 3GC3A 4P4RA 1LMKA 4V1DE 3NIDB 1HZHL 1NM4A 1TQUA 3C9NA 5ACMA 2DJMA 5D7IE 3RPIB 2P8MB 5TE7L 1YNTF 2F5BH 2HSIA 3E9UA 5T1LB 1ZMYA 3CMOH 4NP4H 3F7PC 3IDUA 3FQRB 2CGRL 2OTWA 3AS0A 3VFPB 1F2XK 1BIIB 2R2BA 4X80H 4X7TA 5KYYA 3EJCA 4UNTA 1P1ZB 4OLUH 2X6CA 4I5BA 4JCLA 2OMUA 2Y2TA 2CAKA 1W72B 3P3UA 4AJYV 1AACA 2AQ1A 2R27A 4TLSA 1BOGB 3INUL 4HJJH 4WWPA 3T04D 3TOPA 1QR1B 3SYAA 3U9WA 2FECL 2R4RL 1UACH 3MNMA 4RISH 5AUMA 2AXGB 1MVFA 2QV4A 4M6NH 4WFHE 5GGSB 5T33H 4XMLH 5DWUL 3SKMB 2D4DA 2BVOA 3ASWA 4XVUC 5KSVB 2YLKA 3KJ6L 1WBZB 3NN8A 3WS6C 4X8JB 3U48A 5LWYL 1EJOH 5GS1C 5EIQA 1QPPA 3PWUB 4A7SA 3O9WD 3N0AA 2BNRA 3S36X 4AEIH 2I27N 1OGTA 1XGZA 4Q74A 5IJBC 2DWXA 1Z7JA 3VVVA 1JS4A 1T21B 4OCXL 3K2UH 5JUEL 3REWB 5KYNA 1ADQH 4HBQA 4FQIH 2VLJD 3JYBA 5HGAB 3ULSA 1T1XB 2APXA 2FSEA 4MKTA 2IWEA 3ATFA 5DFVD 2WLZA 4YC2B 2C4FT 3MBEA 3W0WA 4ODXA 1XH3A 4JFDD 1LQBC 2A5UA 5DRWB 1MN4A 5ADPL 1A0QL 1SY6A 1YYLL 3IJEA 4YAQA 4PGBB 4FFYL 4JRXA 4U3SB 1BCIA 2CO7B 3D18B 2A6KA 1JGDB 1U4FA 3IKCB 2ZKWA 2A9NH 2JKRM 4JPVH 4P8QA 4CJ0A 1U3HC 4P23D 3DRTA 2BNRE 3KD4A 4OLWH 4PJ7B 3G6JB 5L4IA 1FO0H 3KRMA 3H3PL 5JHDD 3FRUA 1UGNA 1RJZA 1UOLA 2VXTH 4PJHB 5D72L 5JW3L 1RP9A 1OTSC 3FTXA 3S7GA 2FJHA 3BD3A 5IQ7H 3AB0B 4EAEA 4P4KA 4ONGH 4NGHH 3HUJE 4DP8X 6CGTA 4UNVA 2VR8A 1PLBA 2UYLA 4WWKA 2DYSB 1FZMA 2IDSA 2OTPA 3DNKA 3RL1B 2LFEA 2P8LA 5T1MA 2I5YL 4M6OH 1XXFC 4U6HA 3QE5A 5DWPA 2ITCA 4W68A 2HJKA 5KSUA 3ABZA 2VZVA 3G6JA 5LCVA 4ZDHA 1EHLL 4GMSL 1UOVA 2JB5L 3IRZA 2MJWA 3TV3L 2WO2B 4KVCH 1A6TA 3II1A 3IMTA 4G7RB 1TZHB 4I3RL 1G9HA 1OAYL 4UWQB 4JMXA 4U0RC 2H1LM 2DV6A 2EE6A 1JWMA 5ISZA 1JF5A 3NIDE 1S3KH 3KBFA 4QRQA 4RSYA 2I9TB 3T3PB 3B2MA 2QMJA 3DHUA 2YMXH 1UFUA 1Q9WA 2F54D 2VR7A 4Y4FC 1H3WM 1KTJA 1QSFA 4GKSA 5KN5A 1J0JA 4HD5A 4PJDA 3UTSD 1LVEA 3W11C 2VXQA 1MRFH 3C5SA 1KENL 3U0PA 2MCPL 2DKAA 1N4XH 4NQDA 4R0LB 4PJ9C 1KB5L 1W91A 4PLKC 2ZP8A 4P3DA 3JSSA 3TO2A 3S96B 1Z2KA 1TZAA 4AYDC 1N68A 2ZONA 1QLFA 1YECL 1N59B 5F3FA 2VQ1B 4QRAA 3SD2A 3RGVA 4Q6KA 1WT5A 3SCMB 3PGCA 1BXXA 3D0VA 1OE1A 1UJ3B 1YY9D 1HYSC 2ZCHH 1UH3A 2P5WA 4NQDD 2NR6A 4EAKA 1FLTX 3FH7A 3EYFB 3DETD 2JIXB 3VD7A 4GH7B 2AJ3A 1IGMH 5B7MA 3IVKA 3K72A 2OMBA 1LWWA 2BSBA 2NY3D 4ZMVA 3BVWA 3F5WB 5IEKB 4YL4A 4HIJA 1E9PB 1ZVSA 4HH8A 5DJXB 5IR1A 5K1JA 3U9UA 1G9NL 4LOFA 3H54A 4YEEA 2VZ3A 1KJVA 1WZ1H 2H45A 2QQKL 3BSZL 3MTXA 5DQ9B 3MJ9L 3RWIB 3GXNA 1CDIA 1Y18A 1D5MB 1NCBH 2KPWA 4WFHD 1ZK5A 1VZHA 3VM7A 2WBJB 3L3KA 1JYNA 3QXWA 3F8UB 2VW4A 4PHXA 3RHWF 4WCYH 5JXEA 1LO0L 1AISA 3QIBA 3CVDA 2LVCA 4JBSA 4RESB 5H8DA 5A2KH 2JCCE 4L4VD 3EYQD 3DX9A 2VLRE 3HRZC 3MNDA 1T0OA 1SYSA 5FF6B 4UM8B 4IRSC 1IGFH 1HJCA 2E75C 3FTYA 4F58L 1YC8A 4F9LC 1BQLH 3B3IB 1T7VA 1U91A 1CDYA 4JGJA 2EKSB 4ILDA 3FONA 2N0KA 3AUWB 4JR9L 4FQJH 1RURL 5LXGL 3SBWA 1PD0A 3CSGA 5GRUL 2CUHA 4IBUA 5E70A 1AD0A 1EDHA 4LQFH 4YHIA 4WI8A 2VW6A 4M5SA 2FHFA 2JELH 5CR1A 5F9JA 1QEXA 1ZOXA 5F7EL 3ZGHA 1J8KA 5FYLD 5I1GH 2R7EB 2CXGA 4MA7H 2XT1B 2IH8A 1YY9C 1HYSD 4PRDB 3QJZA 3IAPA 3IDGB 4PR5A 5FW7A 1LK2B 1N59A 4Y1AA 2H5AX 3RVXD 2ITDB 2G2NA 1AQ8A 4C4UA 1N39A 2ZWKA 1J87A 2BP5M 3FQTA 3N85L 4Z23A 2EZ0D 3G08B 4TTDC 3BC9A 4YH6A 3P9MB 3W39B 3WGUB 3MRPA 2UY6A 2EXSA 1QNZH 1YMHA 3QZWA 1RU9H 4P5TD 1AG6A 5GJSL 2LU5A 3FQ1A 4AUUA 1XGQA 2Z8UA 3KJ4B 2GI7A 2M1KA 2GJZA 4A7TA 1ERNA 4RQQB 4PV1C 4YE0A 1JGLL 4ICWA 3QCTL 4K8RH 3WS3B 1ZHBA 4ODTL 5C0ND 1S9KC 1WFTA 1AYOA 3T0ED 3LKNB 1D5IH 3C2SA 1KCRL 4OW6A 1IV8A 3ISWA 4OJFH 2ZE0A 1JMZA 3EUUA 1B0RA 3DVNB 2DMKA 3TA3A 3G5ZA 4K73A 5F7AA 5EEVA 3IAGC 3S35X 1DQLH 2I25N 3AGVA 2N7AA 3ATDA 4NZDA 5T5FA 2OOXA 2WP3T 1IM9D 1T83C 1W0WB 4GIPD 4AG4L 1X6NA 2OMZB 1HJBC 5L7XH 2ZYIA 1EUUA 5CEXB 5FKPA 3RDJA 3KM2A 5H2BB 3PF2A 1FZOA 2H2PD 3NA5A 1R5IB 4L8DB 4Y9CA 5EFIB 2XBZA 3HR5B 3VH8B 3F12B 5CEZL 2V4LA 2HZHA 4PVLA 2YWYA 4RSVA 1KCKA 3MLXL 5GRVL 5MI0B 4N5UA 1HXYB 2HKAA 1NIAA 5I6LA 1JI1A 2J56A 3N50A 4KJPD 2VO8A 3QI9C 3OC5A 4PRID 1ZDQA 3BRDA 1WO2A 4TVPD 1PVHA 3C09C 3OAUH 4PCYA 3TO4C 5FO8A 2D0BA 3D39B 5IJDC 3O0RL 4FMFA 3Q8CA 4ZUWB 4APXA 4JDTH 1TOXA 4JHZA 5T1DH 5BQ7B 1QWUA 3WN5A 2AABH 2ATKB 2OMNA 3BDXA 2FX8L 3KYOA 1GVIA 3GIVB 4PTTA 3U7YH 1IO4C 4PRAB 3HG4A 1L9OA 3G7TA 5G55A 4K3JL 5EBMA 1GRWA 4LNRA 5IQLA 3G6DH 3TNNA 1MFAH 4ZUTA 3TBYB 2QVIA 2J1KA 4CKVX 4QRRB 5EZLB 4DP7X 1L7IH 1TDQA 4K0OA 1X7SA 2R69A 2WNGA 4LO9A 2GJ6E 4LRIA 3U25A 5IMOB 4ZMYA 4PFEA 4UT6H 3NJLA 5GSRA 4EUPH 1NGWB 1QHPA 5DK0A 3LNIA 5BMFH 3ZIMA 5E1QA 1AZBA 1OALA 5BUPA 5LLIC 4EALA 4N8CL 3QXTA 4FEIA 2QHRL 2YXWA 3HAEB 3NJGA 3OQRA 5KW9H 4FOMA 2J1ZA 4DGWC 2PWGA 3IF1B 3SPIA 1MXGA 4NNXB 2NQDA 5HHOB 3Q5YA 3PNWA 1NFKA 1EZSA 1N5AB 1JZ2A 1T04B 2CHNA 1CGTA 1KB9J 2J21A 3VQLA 1QSED 5E0FA 3MLUL 4NYLB 4QDGA 1SVZA 5F88A 1EAPB 1ZT7B 4LVOB 4PJ8A 5IWLC 1BM7A 3RFZC 1MXDA 3HLAA 3MV9D 1U42A 2HVBA 4H8UA 5BZWB 2AJXL 3C6LC 3TV8A 4LSQH 1ZSHA 4XMZA 4RCAA 1JZEA 2VDQL 3ZQWA 1NBYA 5B7FA 2WXNA 35C8L 3FS9A 1QBLH 1DVUA 5F6IC 2KQNA 5FDYA 4PJ5E 2ZUXA 5F0PB 3WIFB 1N9PA 1DVFB 1QI4A 2AXJA 3P30L 4IKIA 4BKLA 2NY2D 5FYJL 1J9CT 3GSXA 3HMWL 4G9DA 1DSYA 2EVFA 3B7SA 2JQZA 4X8XA 1T5WB 1EWHA 4RGNB 5MEQA 5AW6B 1E9OB 4WENB 4NC1E 4NZ8A 5F93C 3HI5H 1T7YA 4IK7A 1RL1A 4S1DD 3KR3H 1U3ZA 2PPCA 1BF8A 1KEMH 4Q9CA 1NANI 4NWUH 2DZEA 3BSZA 4TVPL 2JH2A 3PWVB 5AYUH 5CIPB 3ULUC 5I1EL 4LARH 3LZLA 2WXJA 4K4KA 1RZ7L 4LCUB 5I1AA 4JAMB 4AOFA 3L4TA 4MYPA 1V10A 4DP4X 5JIKA 2PTTA 4JY6A 1L4IA 2MOGA 4XN4A 4XN2A 3KL0A 3MODH 5BXFA 4NFCA 5EIIB 2W91A 4N1CA 4GB9A 2D0CA 1OVZA 3MRMB 1TLKA 4LSUL 3QK0A