1KYUA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 69
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyuA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyuA02
2A7BA 5IYBP 1VTOA 1QN8A 4BCXA 1QN5A 4RODB 1PZDA 3MNMA 1TBAB 1VOLB 1CDWA 1RM1A 2Z8UA 1QN4A 4ROEB 4PY5A 2D0CA 1YTFA 1JFIC 1QNAA 5IYDP 2IV9A 1KY6A 1QN6A 1IU1A 3EIKA 1NH2A 1QTPA 2YMTA 1QN3A 4WZSD 1GYUA 1C9BB 2IV8A 1W80A 3H1ZA 1QN9A 1KY7A 1TGHA 3OC3C 2DWYA 1QNCA 1QTSA 1KYUA 4ROCB 1QNBA 1R4XA 4B0AA 5IYCP 1VTLE 3OCIA 1QN7A 2D0BA 3VN5A 1B9KA 1NVPA 2VJ0A 2G30A 5CN1A 2D0AA 1TBPA 3HS8A 3ZY7A 1PCZA 1KYFA 1NA8A 3ASMA 1D3UA 1MP9A 1AISA 1OM9A 5CN2A 1E42A 1YTBA 1KYDA 1NGMA 2E9GA 1VOKA 1P4UA 1QNEA 3HS9A 1GYWA 3ZHFA 1GYVA 2DWXA 2MJ7A
chains in the Genus database with same CATH superfamily
2W9EH 1DEDA 2CZNA 4BQ6A 2NY7L 2X10A 3LZOA 5E0FA 4BA0A 3I74A 4C56E 2IALB 3MQIA 1CCZA 4JZNA 3K71B 1V54B 4F9PC 4GO9A 5K59E 1WPCA 3GMQA 1L6ZA 4HX1B 4PIRF 4GBXC 3UEQA 3MREA 1BXXA 4WU7B 4HC1A 2CLZA 2WVTA 2AJUL 2WANA 3SDAB 5KAQG 4WWKA 2MQGA 5AOKA 4KXZI 2H45A 1CDUA 2V9JA 2KDGA 2EVJA 5I71C 4KVNL 1X5MA 1HDMB 3WDHA 3BPCB 2Q7YA 1KCUH 3EG9B 1MFEL 3MCLL 3O6ML 3Q6FB 5DJYA 1EHNA 4O9HH 2GK0B 1T5KA 1WA2X 1D5RA 4DULA 3CFCH 3BAKA 4GW4A 1J9QA 3AC0A 4XX5A 3BAIA 3WXVH 2ODIA 3ZE2F 1ET5A 3ULUL 5JW4N 3WKMH 1R47A 5L0QB 3VD2A 5HHOE 1TZAA 1P4BL 4CW1B 5K93A 4UDUB 4Y5VC 2VUKA 4QWWC 1D5IL 5DWUH 3MRNA 3QFDA 4UTAL 1BMZA 1JVLA 3KL5A 4LXFA 1LJMA 2EQDA 1VCBC 2AJSL 2F7LA 2FH6A 5GGVH 1QSFE 3HN5A 4OZ4B 2V0AA 1U8LA 5EU4B 2ZKMX 2GC4C 3JWOC 3T0BA 3UAAA 4DGYH 4JFXB 4XN9A 1R6VA 3EJZD 1QR4A 1UJ3A 4EI5C 1AKJD 4KXZH 4FNLH 4MMZA 3FO2B 2EYRA 1OPOA 1SHWA 4OGXH 4LBEB 3H0TA 1UFGA 5MP6H 3ZHNA 2UWEB 2B4CH 5CJXC 3EHBC 3HI6L 3QA3A 1IEBB 2H1PH 1YPZE 2JKNA 3ATFA 3DVGA 3QYCA 4MZ3A 5GRXG 3G08B 1ZTXH 1NFIB 3MV8A 1EO7A 1KTDA 3P77A 3V0DA 2G4GA 4IU3A 3VGAC 3BAEH 4OU3A 1LWRA 3BWAA 4D0CB 4PJAB 3T0EE 2Q1EA 5TF1L 4HJSA 1MH5A 2NY0C 2OW7A 4H0IA 2Z31D 3GLZA 4TOYH 3K6SB 4J8RB 2X6UA 1R3LA 1L9NA 3F04A 1R3HA 3VD3A 3PWPD 1XTMA 5EZOL 1JVOA 2WCSA 3U1QA 3ZTJG 5BQDA 3V79C 1W0VB 4MRBA 3MOAH 1ASOA 3MRGA 3U2IA 5IMMA 1NSNL 5J1AA 2F7QA 3L81A 3MYJA 4K9JA 2OMZA 1DQML 5D2LA 5AAPA 2XTJB 4BK4A 4OJFL 2YJQA 3NIDB 2Q0ZX 3KGTA 4PJDE 2CIIB 3LH9A 3N89A 4PGCB 5IYBP 4POZD 3MV9B 2PXYD 3FT2B 1CXKA 4QHUB 3S5ZA 2GIYA 5FYKU 3CC5A 5T3ZH 4OTXL 3P30H 2IFFL 1KFAH 3CJJA 5JA9A 4LLDB 3KBFA 3A24A 2TSBA 3KLSA 5C7XH 3D05A 2DM7A 3DOSB 3PWLB 1QNAA 1L4IA 2P42B 3FONB 4OY9A 5IB4A 2IOMA 1ND0A 3ALPA 2ZD0A 3LSOB 3ZVVA 1LE9A 4IRZA 3BDBA 1MIML 2AJYL 1YEKH 3QO1B 5B4MC 2PYEA 2EH7L 1JNNL 3BDYL 2VSMB 2WLYA 3OKOB 4J4PA 4O02L 1TZHA 3VXUA 4P5MB 1JYXA 2B2XL 1GCYA 1XGPA 2J5LC 3VI4B 4F8NA 4MJ6B 3WO4C 2AXFA 3QEQD 2X4SA 4PBDA 1XGRB 1Z9NA 3ELAT 2IWEA 2WK2A 3FZUC 4OQ1A 2ISDA 5DC2A 3VVVA 2Z34A 2FBRA 2QFRA 1JGVL 5HI3C 4WZSD 3BVVA 4NOBA 3T9WA 4HUUB 3LV3B 3PWVB 4FP8H 1KEGH 3O4OB 4IU2A 4ZNEE 2W9EL 4FXLA 4KU1A 3HE7A 1JXJA 1F4HA 4JCLA 3QR1A 4DJMA 3N40F 1BOYA 4LVEA 4OD2A 4YHPA 1BD2B 4A2FA 2D2OA 4RESB 2BP8A 1RZPA 4B9PA 5GRWA 5E8OB 1FG2A 2VC2H 1CN4A 5BRZA 3A4DA 3OWEA 2ZP8A 4MA3B 2BSRA 3QCUL 5EU6B 2WKGA 3QQXA 1YMHB 3RHWK 3WSQH 5MI0B 1KCUL 4N8CH 5AENA 4PTUB 4JKLA 3CFUA 4H1LA 3VH8B 5BMPA 3G5ZA 3KBEA 4O9HL 2JCCA 4KNSA 3M07A 1BZ7A 2FO1A 4H44C 3A4AA 3PAUA 4KVPA 2IBGA 2OMXA 3QWOA 1P69B 3WXVL 1EBPA 2Q10A 1T3FB 4PRNA 3F12A 2VLMD 4BE5A 5D5ME 4ZTEA 5GGRB 4X80H 2BX5A 5DWUL 2X4PB 3QDMB 1NDGB 4KNTA 1OGTA 4C54A 2NXYC 4L4VD 3FU9A 2QSCH 5IBLD 1KOAA 1IAOA 1NBCA 1F6LL 1CGXA 2NYZA 4LCUB 2FB4H 5GGVL 1S7SB 3FB5A 3GD1C 2A7BA 4ZMLA 3EF7A 3UZQA 4NT6A 2HUHA 3MLXH 4FNTA 4XP9H 4DGYL 5K1NA 4FG2A 4XP5H 3RL1B 2ZUSA 1MF2H 4O51A 4YHYC 4QXTA 4AIEA 4XZUA 5DLMH 1A1OB 1NANH 1P4LA 4DEWA 4OGXL 3D2UB 1OT1A 3ILPA 5DJXB 2B4CL 2NY1C 3ECBA 3DX9A 3QC5X 2H1PL 3G6AA 1R24A 2IANA 5IJKC 3L5WA 1ZTXL 1P9MA 2ZX9A 4X42A 2FRGP 5AWNL 5TK2A 2ERJC 1IE5A 2V5TA 2V2TA 1TCMA 3MUJA 3NA5A 3DX6B 4QKTA 4ERSH 4Z76A 2BWIA 4A68A 4HUVA 1BAGA 3MRQA 1IJ9A 4CU6A 1FGVH 4TOYL 2Q3XA 4OVVA 4FCHA 3V8OA 3FQWB 3MOAL 3AW5A 4JZOB 4ONHA 1YMME 4RCAA 4GKOA 4U49A 3FUEA 5KS9A 1XGUB 5LNEA 5DK0A 3TYFB 3WTSA 2UXTA 5EEYA 1X5IA 3O11B 3HN3A 4P07A 3S3CB 4Q8BA 3ZDZB 2CBTA 1OWWA 3DI2B 1QFHA 5T3ZL 3UTSB 3HOGA 3P30L 3PP4H 2P8LB 4K9EL 1WZAA 1KFAL 4ISVB 2DWYA 4HLEA 3FPXA 4JM2B 1SJHB 5C7XL 3UTTB 3IDIA 5AUMB 3PL6D 1BM3H 2XU9A 3LKSA 3F6IA 4D94A 5F3BB 3HRPA 3NCCB 1FH5H 1NGYA 2DIJA 3KM1A 3WAKA 1QEWB 3QO0B 4ATTA 1RKRA 1DZBA 2GJRA 3UTPE 4R97C 3QWRD 4HIHB 4NENA 5EO1B 2VXQA 2YD4A 4MHHI 1P2CA 2FYYB 3Q6GL 2VLLB 1OP4A 1YEKL 1TQUA 1KN4H 5GZOC 3B9KD 4Y4KC 4AEFA 5DURD 2H0JA 4R84A 4OFQA 5DUBA 5A3ID 1O7DC 1G1YA 2IAMD 5CSGA 3WNPA 1S9WA 1DANT 3ULVE 1ZANH 1XH0A 3MLZH 2B1OA 4HMEA 1UXSB 3RWDB 3WY1A 2C3VA 1CGVA 3NCJH 4FEIA 3CBKB 3UP1A 5K9OB 2NOFA 3CFTA 2C1PA 2GTWB 3HG1E 5DT1H 2JKLA 1AR1B 3CW7A 6FABH 5KZCD 4FP8L 1YY8A 2FYVA 1F6AA 2H5UA 5JO5B 3TBYA 2WLNA 3ZDYE 1M5Q1 3EO9L 1D6VH 4O2FB 5DHVA 1JGLL 1SOSA 4AQAB 1EUVA 2YUZA 4BSWA 1AD0B 1EXHA 1CFQA 3LRSA 3SQBA 5HGGS 4Y7OC 2Z31A 3AZUA 3CXHJ 3MNZB 5CIPA 2DYSB 4ODSL 3TLRA 1A4AA 1ACXA 1ECYA 3EADA 3PWPA 4WUUD 4S10A 3BIAX 3ZYZA 1N68A 3WSQL 1PZ5A 2EDQA 2A74B 3ETTA 4N8CL 4JE4B 1DBJH 3C60B 3FU0A 1EAJA 4ZRGA 5IVXA 4OZIA 2JKWA 2W0FB 2VQ4A 4LARH 2CLVB 1XH2A 2OMVA 4XI5C 4XX1G 2M8XA 2XHNA 2CQVA 1RMFH 2PXYA 1QFPA 3TEZA 3L4TA 2KHAA 1LNUA 4ZOAA 1Z5LA 5EA0H 5E6IC 5E23A 4Y5YA 1U6AH 1T4KA 2ADIA 2BJMH 3IKCA 5IESL 4F5CE 5HI5D 1GJWA 4I0PD 4J3OH 1XCTB 1TG8A 1I9IH 1FAIH 1EDQA 3F00A 5C0EB 2FB4L 1KGCE 3O0LA 1LO0H 3L3OB 1BQRA 1C1EH 3CQQA 3BGAA 1B6DA 1P7QD 2JXMB 2X6CA 3V7AG 1VKLA 5C07D 4ICWA 3KVQA 4XP9L 3MLXL 4PJFE 3SOBH 4JDTH 4XP5L 5BOPA 1A8JH 3MJ9H 5GRVK 4XAWL 1L6PA 3GK8H 4XP4H 2J1ZA 5DLML 1H9VA 5SWSD 5I8CA 4U6YA 1XGQA 4QRPE 5FYKL 5HTSA 3MLSH 1T83C 4PVBA 1IQDA 1KGIA 3QEQA 1MLBA 4Q2ZA 5DJDA 4F3FB 2CLZB 2XFGB 3HEIB 5A1AA 4M5ZL 5EIQA 2NXZB 4TULH 4QXVA 4P5TC 5T3ZD 4TVPE 1RD6A 2Q7YB 3WOVA 4ERSL 2R0ZH 1RERA 3K81A 4LRIA 5E4AA 3RPIA 1HEHC 5FM5O 4EZMA 1ZY9A 1OK0A 3ARED 1FGVL 2FJHA 4GW4B 1T1XA 4WI5A 4TQHA 5E9AA 3HG2A 4B7IA 5F88B 5EIIA 1SOKA 2GABA 4UI2A 5DZVA 3Q8CA 2OCFD 3FSZA 2OYLA 2EH8H 1B90A 5JORA 1E42A 4IBYA 2CM6A 4A7SA 2NY2C 3MRNB 4A67A 3QFDB 5DSCA 5BMFL 1NGMA 4AEHH 2XQYA 4QYOB 4N2DA 2DOCA 5HYFA 2YRPA 5KVGL 3TYGL 5DC4B 3UFIA 1FL6B 2OULB 3BGFB 4DO5A 1RUKH 3IAPA 2VDKB 1WAPA 1U8LB 3PP4L 1KBPA 4BDVA 3EGDA 3K2UH 2X1OA 5F7WC 1V27A 4F7EA 1UB5A 1JPSL 2HLFC 4X4ME 2IC2A 1UJ3B 5EDSA 1BM3L 2FT7A 4MMZB 2EYRB 2DB8A 5DC0A 4N2NA 3TTYA 1IC7L 2BXYA 2JB6B 1DJYA 3ZR5A 5I16A 3F7KA 3H0TB 1IM3D 1OCZB 3CIQA 4LCCA 3BWUC 4L4VA 1OAKL 3QA3B 5KJRH 3DVGB 4QY8A 5FO7A 1BPLB 4GEJA 3DTXA 3MV8B 5B39G 3MDJA 1KTDB 2Q76A 1EX0A 3FSAA 3P77B 4OF3A 2GUYA 4DEPB 1AI1H 1VFBB 2HG0A 4RMQA 4XT1C 4D9RD 3BWAB 3H9SD 4DKEL 4QCIA 4TTDC 4XB3A 3QWQB 3SPVA 3NP4A 2AAAA 1FIGH 3MLZL 4RMVA 3L9RA 3NCJL 4UQBA 1R3LB 4JJHA 1R3HB 1CYWA 1Y18B 5DT1L 5L4FA 3HC3H 5B3NA 6FABL 3MRGB 4X8GA 5J1AB 4EBQH 2OMZB 5D2LB 1GS8A 2YRZA 3LPWA 2VN6A 5FV1L 2FTAA 3VTAA 1BPVA 4Z7OB 1D6VL 1KWKA 1Z0NA 4XTRD 4JFZH 5I0DA 3OM3B 1IBYA 1DLHA 3MLVH 4KK6C 4PJCF 3RIAF 3CC5B 5DZPA 5EG6C 4IMLA 4ROCB 2HMID 4E36A 4PY8J 2O6FA 4IOIA 1A6WH 2H2PD 1ILSA 2J8UF 3E6FA 5BS0D 5HYIA 4HUNB 4JG0H 1SUJA 4L8BA 3J27A 4PUBH 2L7QA 1DBJL 2ZX7A 3T0DA 3TGXA 5IB4B 1V55B 3LQAC 1GC1C 4UM9D 5E5MA 1QI3A 3TVMC 7PCYA 1TJIH 3EKCA 4O02A 4XPTH 1LE9B 4OFDA 3BCDA 2N0KA 2PYEB 1RMFL 2EDOA 4GY4A 5FYKD 1MJ7H 4H40A 4UT6A 5HDRA 1CB4A 2R59A 4KTYA 4YFLF 1TZHB 2J72A 5IVZA 3V0VA 5EFIB 5EA0L 3MFGB 4DP0X 1C5BH 1IC5H 4MQ7B 3MV7D 5DR5H 2X4SB 5DD3H 2FNBA 4OJEH 1IKOP 1HKFA 4UB0H 3RRQA 2NLVA 3S3SA 3PL6A 1FAIL 1OLZA 5AW9B 1O6TA 4ZMWA 3FUMA 5D7KD 2EUVA 1GYWA 1C1EL 4OLXH 2VDNH 4IU2B 3MJ6A 1OP3K 2FX8H 3QWRA 7CGTA 1JZ8A 1KSRA 2GIMA 4X4XA 2CO6A 3HE7B 2JPIA 1G4MA 3SOBL 1JJUA 4JDTL 1QN5A 3N85H 3MJ9L 4OD2B 4JQVA 4DERA 3GNMH 4YHPB 3GK8L 4XP4L 2HFGL 2BP8B 3ARGC 5DJCB 4MKMA 5DYOA 1JTOA 2BOLA 2QHLA 1T89C 2X12A 1FG2B 1YNTF 1EAPA 4AYBA 5BRZB 2IAMA 3IJYB 1IAII 2YQGA 2YKLH 3LKPA 4QTHA 4ZPVA 4G5AA 1VFOA 2HTKC 2I5YL 2VXTH 2ZX6A 2QVTA 3T6QC 3BFOA 4TULL 4MDJB 3CHOA 2EIEA 4WHYG 1SLXA 3U7WL 4LASL 3LNEA 2GUOA 3G5ZB 2R0ZL 1F8TH 5J4MA 3N06B 2JCCB 1BZ7B 3QDGE 3BT2H 2C9RA 4ZAKD 1IILE 3HMWH 2HA1A 3UYRH 2OMXB 1NMCC 3QWOB 3NCEB 4IBQA 1ZRUA 4N1CA 2QHRL 4PGJA 4QXGH 2FLMA 1KCLA 3ARRA 5F7BA 5DVPA 5HDBE 1OGTB 4KJWD 4AEHL 1IAOB 3HVDA 1HC1A 4WUUA 1A6PA 3ARSA 3OWRA 3D0VA 3IGFA 1YVLA 1LWWA 4FNPA 3O9WD 3PRZA 4H1LG 3KLHD 3IVKA 3K2UL 2AK4E 1F4AA 3ARVA 2VJXA 2ZYHA 4OR1A 4ELKA 4UOZA 3WKPA 4O51B 3E9UA 3GSXA 4ALAC 4MMYA 4K71B 3TS8A 4XZUB 4H5SB 3T2NH 1P4LB 1RPUA 3ILPB 5EO9B 4MJ4A 1BQLH 4PJIF 1FPTH 2V2WB 3D48R 3UBHA 4G5ZL 1N0LA 5JOFA 4OI8A 3ECBB 3MZTA 3DX9B 3G6AB 3A6BH 4I0PA 3IB4A 1CD9B 1JPTH 1F3JA 4UQEA 4MMXA 1FI8C 1AI1L 2V2TB 1M1SA 4BFKA 1DVFD 1HQ4A 5DK3A 1JVKA 2Z8RA 1P7QA 3W9EA 4Z76B 5C07A 3G6JA 4DFIA 2E46A 3WY2A 4AQZA 3CVSA 3MRQB 3IFNL 4UANA 5HDOA 1BCIA 3AS3A 4G8FB 3SDAC 4OKDA 2GI7A 3QRFM 3POCA 4ZTOH 5SWSA 1C8QA 3CXDH 4KROB 3TBTA 3HC3L 3NEOA 3KDMA 1KT2B 4ONHB 3EYSH 4EBQL 2ZUYA 3QIUB 5KS9B 1FN4A 5HPOA 4BFJA 5H37A 1FC2D 4FS0A 3EFDH 3JV6A 5DK0B 4RAHA 3WMSA 3P54A 4JFZL 3VCLA 3AT0A 4HUXA 5L0QC 3MLVL 3U7AA 4ES9A 3RQ3A 2VTFA 4N6QA 4L37A 4JHBA 3QORD 4XNAA 1TXKA 3KZ8A 3KH3A 3SDXF 5BOZG 5BQ7A 3AREA 2N3JA 1FFPB 5HYSA 2XACC 1QW9A 4UZSA 5EOCL 2EACA 1E9QB 4TNWF 3CVIH 3IDIB 4YLBA 5F7HA 2ZWLT 4JG0L 1NGYB 3TEWA 1HEJC 4PUBL 3O6KH 3TJEH 4GUPA 5I9QB 4E9WA 1B4RA 4NENB 2NVMA 1B6UA 1YY9C 1P2CB 1X5XA 2LVEA 1U8QA 1TJIL 1JRHI 4XPTL 1L9SA 4PVMA 1EJ6A 4WFFD 4FAAB 1MJ7L 3STLA 2VKXA 5CJBA 3ZLQC 1IU1A 1C5BL 1IC5L 5DUBB 1TQWA 3LD8B 4NZFA 1QO3A 3SE3C 1S9WB 3NIFE 5DD3L 4UNVA 3PDDA 4U7KA 1J9CT 3BDXA 4UB0L 2C3VB 5LN4A 4U1IA 2K9UA 3NZSA 3WLBB 3FUIA 3DURA 4MKTA 1E27A 2LFEA 4XAKE 3E3QC 4NX0A 1IM3A 4ZMOA 1YY8B 3HKZA 2VDNL 3GSOA 1F6AB 1NGXA 1M4KA 3MODH 2CR3A 1JCVA 4HALA 4NLHA 4Z3TA 3HG0A 4DKTA 3VXRE 1T0NA 4JN2A 5DHVB 3T0WA 1BYOA 3ZX1A 3GNML 2ADJA 1G7MB 4JFVA 3RDTC 3CZJA 3QR2A 5C0AB 5C92A 3H9SA 1CFQB 4DGIH 4HBCH 1O7DE 1I3GH 3D50A 1RZJH 3LRSB 4GI6A 3SQBB 5B3JE 5GS0C 4JHAH 1HCYA 2YKLL 1FA4A 4NUGH 2Q5BA 3TURA 1FG9C 4G7VH 2WUCH 1T03L 1I1FA 4UNTA 1R34A 2VXTL 1JRHH 3PWPB 1IUZA 3FQTA 3BGMA 5IZ7A 1AKPA 2QRDA 3FUJA 1W8NA 1PZ5B 1K5WA 3U0WH 1WFMA 1EQWA 5IVXB 4OZIB 5C0NC 4U2ZA 4J6RH 5FKAA 4AKQA 3BT2L 4KI5D 3ZU8A 1MY7A 1KNOA 1QLFB 3TA4D 2OMVB 3UYRL 2YPLB 2VN7A 1I85C 2ETWA 4S1SH 5D71H 4FJYA 2PXYB 4M8UA 4MVBC 1NAMH 2WZAA 3LMJH 1LNUB 4QXGL 3V0HA 1Z5LB 1J5HA 4U4BA 2ADFH 3B7SA 1FFRA 2UUDK 4Y5YB 3MRHB 2ADIB 1T4KB 3IKCB 4A2EA 3LKOA 2DIAA 5AB2A 5HBBA 4YK4B 1NFDE 5EN2A 5EF0A 2FWOA 4U3HA 4H88H 4Z7UF 5MENE 5BS0A 1ZHLA 4G8GE 5CJQH 5IVNA 5GGUA 2MJ7A 2WVSA 1PJWA 3C5SA 3F5WA 1ULVA 4FFWD 3FSWA 2OAAA 4UM9A 1L0QA 4DGUA 2QTVA 4Z7QE 1RU9H 4XNMA 1USQA 3GLAA 4PGDA 1USZA 3OSEA 1KJ3H 3BPOC 4JDEA 4U6YB 1XGQB 2PPDA 3T2NL 3QARA 3UIYA 3C8KA 2D03H 4MJ5A 3RILA 1BQLL 2XWTA 4K7FB 1FPTL 2DL9A 1FHNA 3QEQB 3MV7A 1MLBB 3O4OC 4Q2ZB 5DJDB 3UP6A 1T6AA 3ILQD 1BZ9A 4B5EA 1ZT4A 5AAWC 5D7IA 3BYTA 4Q14A 3ARBD 5I8OH 3KM2A 1KB9J 3D52A 1B4LA 4OF7A 4JX0A 1RHFA 3HZ3A 4PLOB 2CHNA 1XMWA 2FSDA 1MNUL 1GGCH 1PCSA 3ZE0B 2IGFH 5I5RA 1DVUA 3RPIB 3AMLA 3ZE1E 5JQ6H 3P02A 3EIKA 2FJHB 4GXVL 1T1XB 4KY2A 1CE1H 4LBAA 4RMBA 3MC0A 2XICA 2Q87A 4XBEH 2F58H 4GAYA 4IJTA 1NC2B 4HKZB 5EIIB 4ZTOL 3FF7A 4HW6A 5IHZA 2H7WA 5FOJA 4ZW5A 2DW5A 3BPLB 3PPEA 1SXCA 3KRMA 3CVBA 4HFWA 4ZNCD 5I1EH 3OJDA 3EYSL 1AMXA 2MPAH 2WZ0A 3Q2CA 4Y5XA 2IFGA 5JORB 5MI0C 1XIWD 5DS1A 2ROYA 4FLRA 3O4LE 5J6GB 3EFDL 4EAJA 4NPKA 4A6YA 5I30H 5J56B 2XT1B 2H2SC 1I82A 2VW7A 4ZXBB 4PV9A 2YPVA 4BDVB 3OKMB 2NW3B 3EGDB 4NQDD 3NQKA 4ZAKA 2CCVA 4F7EB 1UB5B 5C0CE 3CVIL 4WJKB 2RGSA 3VSQA 3NCYS 3SQOH 5TDOA 1DJXA 2OZ4H 3HA0A 4L2LA 4DT2A 5I16B 1GGIL 3O6KL 2GG1A 2P3YA 4R7LA 5FK9A 3TJEL 3UDWA 1XCQA 4DGVL 4LCCB 4L4VB 5IWLA 4QY8B 4HS6A 2FQDA 4IIQA 1A21A 3RAJL 4EVNA 2ORBH 3DTXB 4X7CC 2KQNA 4D2NA 2Q76B 2E9WA 3PFQA 1KXQA 1H19A 3NJHA 4ONOA 3O9WA 2EDHA 3S97C 1QASA 3SDDD 3WNMA 4QCIB 3SPVB 3U30B 3MXVL 1MJJA 3RB5A 2ZOWA 4JAMA 4YXKH 4XBGA 5DXWA 3L9RB 1M05A 4ZS6D 5J11B 2C3XA 1A7NH 5T3XE 3QQ4A 4HEMA 3VM5A 3BN3B 3E6HA 3L45A 2E6JA 3QXDA 3QUKB 2DQFA 3D4GA 3OC5A 3MODL 3UGXA 3QH3A 3Q9QA 3S36X 1CU4H 4X6BB 1W16A 4PJBE 4NN5B 2KQMA 3SBWC 5JHLH 5E94A 1TVHB 1WJWA 2HYMA 3DGDA 1WFNA 3HNSL 1DVFA 1OP3H 1J0ZA 4WUKH 1OGSA 4DGIL 4HBCL 1I3GL 1RZJL 3ILEA 5JIHA 1JNJA 4L9DA 1C5CH 4JHAL 4IMLB 1I3RA 3S5LB 1QI4A 4NUGL 1MREH 4F37K 2MIZA 2WUCL 4G7VL 4IOIB 4MX7A 3QXAA 5HJBA 3RFZA 3VFTA 1JFIC 3E6FB 3JWNC 2LW3A 5I75B 5I26A 2FGZA 4W9JC 3U0WL 2DDQH 4E5XA 2DIBA 5DMIH 3QDJE 1KTBA 3MO1B 4PMEA 3VRIA 1FO0A 4J6RL 4JW3A 1S2EA 5E5MB 1N64H 4KK8C 5KSBE 4JM2C 4O02B 3KYOA 3QUYD 4S1SL 5D71L 1CURA 1FLRH 2A2QT 2P44B 1OAJA 4P49A 1NAML 4NFCA 1UWYA 5IVZB 3LMJL 1DQJA 5FYLL 4PH8A 4YZWA 2H4EA 2ADFL 1MN4A 2V7HA 3QORA 2YUXA 2VSKB 3V0WH 2P7TA 2P48B 2WSKA 4H88L 3A67H 4B9ZA 5DF0A 3BKYH 1EZUA 5CJQL 4P9HH 1GYUA 2N1KA 4F2ME 4X98A 2Z0UA 4UV7H 5DD6A 4X4XB 2CO6B 4OJAA 5DCCA 1JUFA 2X6AA 5HJGA 4NP4H 2XX1A 2ZG2A 1ETZA 1B2WL 1RU9L 5L2KD 1J1PL 1S9XA 2WQ8A 3RKDC 3SKNA 1KJ3L 5DURB 4DH2A 4LVHC 5DYOB 5IUSA 1AR1C 3QUGA 2IBZX 4NOFA 4PGEB 1EAPB 2NT0A 4CRPA 2IAMB 5CCKH 4FNRA 4HDIA 3LKPB 3NABL 4QTHB 3SE4A 2KYIA 2X70A 4J27A 5F1SA 3RL2A 4LOVA 2YN5A 2F54D 5CU9A 3PFUA 5I8OL 4MSWA 3H4FA 3ATDA 5MHSD 5KZCB 3DX4A 4ABWA 3B8YA 4RFEA 2XYCA 3RWHA 1GGCL 3ABGA 2GUOB 1V7NL 3B5HA 6PCYA 1NEZG 3SJVB 3TXAA 4JL2A 5JQ6L 3EBIA 4K5MA 3L3DA 1CE1L 1SVBA 2UVFA 4XBEL 2F58L 2EHBD 1UEYA 3SBRA 4A2GA 5CCJA 5J1SC 3PV7A 3SDCD 2APXA 5I1EL 1FZMA 2MPAL 2A74C 2GHZA 3C60C 2ATKA 2QQLH 2HWZL 4LFHD 1W91A 4OLYH 2DEXX 1ZGLP 4H8QA 4P4RB 2RQEA 5D1XB 4J2XA 3JWDC 3MCG1 2DD8L 2R2BA 5DD1H 3SPHA 3TO4D 5KN5A 3QP3A 3V6ZB 4XO8A 1TT6A 4U1HA 4NQEE 1H9DA 1IGTB 4ELKB 3MNMA 2CJ3A 4KO9A 4R4BA 2K8MA 3CDCA 3GSXB 2WVVA 3FSOA 3QJUB 3SQOL 2EDYA 2OZ4L 4DVRH 5ITBH 2NR6D 3QQ9C 3FU5A 1K5NA 4PJGF 5JOFB 4C4BA 3SE8L 5AW2B 1DBAH 5F89B 4I0PB 1T0MA 4L0PB 1Y0LB 1UB6B 2ORBL 1ADWA 1BIIB 2PWHA 2OI9B 4MMXB 3WN6A 2AEQL 3GXUB 1F18A 4NXSA 4HOWA 3B3IB 1HQ4B 4OIIH 5F0PB 1P7QB 3W9EB 5C07B 3G6JB 3JYBA 2E74C 4WGVB 1EIBA 1N39A 4YXKL 3P2DA 4WI4A 1CGWA 2QRCA 1LP9F 3S35H 4WWKC 4IOFD 1A7NL 5SWSB 3K5SA 3PDKA 2NXZC 4H0GA 1SJEA 3TBTB 5D96B 1IGJB 3L5XL 3VFRA 5EN3A 3KDMB 3MOBH 4X6CE 5A40E 1ZK5A 3KD4A 1L7IH 3QUMH 2XXGA 4JG9A 4D7RA 2ZWNA 1CU4L 1LTXA 3I6LD 1EMTH 4YL4A 4OZHF 3BE1H 3KLAA 4MFHA 3GJFK 3N43F 4I8OA 3ARBA 4YBQD 2D8KA 5FYLD 2ARJA 3CU1A 5JLZB 3VCLB 2ZWKA 3DUHA 4HUXB 1W80A 1ED3A 4AYEC 4WUKL 4PGZA 4UIMB 5BZXA 5EUOB 4L37B 3D4YA 4Y9BA 3CFEB 2Y23A 1MREL 1MKFA 5BQ7B 4JPQA 1K72A 4B7LA 5B8CB 5CGYD 5HYSB 5KW9H 2ED6A 2NY4D 4PJ5E 4HIQA 3TBCA 1SBSH 2CE6A 5DMIL 3BGFC 3I2CH 1XIWA 4LE8A 2EDMA 1JD7A 3MFFA 4NWUH 4U7MA 3MX0A 3B6SA 4FFYA 4N8PA 3TEXA 1U8QB 1N64L 3OHXA 4QLRA 5E9DD 3CBJB 2ZKXA 4EN2A 5EZLA 3RGHA 1FLRL 1UJ3C 2H0FA 2UZXA 3STLB 4MMZC 4N90E 1OTSC 4XN8A 2RAMA 1ECZA 4BYHA 1O6SB 1UD8A 2O6PA 2M2DA 2VABA 4NQDA 5I1GH 3QJXA 5JR1H 1QO3B 1AISA 4KXAA 1OM9A 3VFVB 2CXKA 3IFLH 5T33H 3V0WL 4ZD3L 2HZMA 4U1IB 3A67L 4R96B 1D6EB 3BKYL 1DDHA 1G9HA 3DURB 2UUDH 3N50A 2DEWX 1IM3B 1A4BA 3GSOB 3FULA 1NGXB 4KJQC 2OS7A 4FLHA 4UV7L 1FRGH 4NAMA 1DVSA 4R7VA 1LMIA 1YYLH 4PW9A 1UOLA 4NP4L 4JFYA 1U3JA 4B95C 4JN2B 2I07A 4HT1L 1QX1A 2ADJB 2ZF9A 1JK8A 4HGWA 3CFDA 1JL8A 3H9SB 3SDDA 5ISZD 1DEEA 4AM0B 4LL4A 2IF7A 3MNWA 5CCKL 1NKOA 2X3AA 2BCKA 1I1FB 4XMLH 4BCYA 2C34A 1MFNA 1JDAA 3BUIA 3NZUA 4O2CA 3FQTB 2BHYA 3BGMB 3E3QE 2DLIA 5EHFA 4ODVH 3WKNA 3EJPA 4WGKA 3D3VD 1U8IA 2XWEA 1WD8A 3JZYA 3V4VH 4LSSH 1D2OA 1QFOA 3GDCA 5FKAB 1XGYL 3H2WA 4RRPG 4LVNB 1KNOB 5L4IA 3SE6A 3UH8A 2YIHA 4BQCA 3A47A 4M29A 3RYMA 4NKDB 2YHGA 4OBSA 5EEUA 5EOCJ 1JGEA 2D7QA 4K3GA 1THAA 1Q1PA 3FF8A 4G6KH 2COVD 1WZLA 3LKOB 4LEBA 4UT9H 4OLYL 4ZQTA 5EN2B 4GAAA 3WLWD 3X3FH 4AV5A 5BS0B 1ZHLB 1UM6L 4J4PC 3F5WB 3C5SB 3KGUA 4WEEA 5DD1L 4ZQKA 1MPGA 4H13C 3RY4A 2R4SH 3BFQG 4PRIE 4AYDC 3FMGH 4N2BA 4FZ8H 4UM9B 5T1MA 4P3WA 4TQ8A 4OQTH 1GSMA 3QUYA 2Z7WA 4XNMB 3FN9A 4LIQE 1FNFA 2OL3H 2HL9A 1G94A 2OV0A 1M1XA 5D93C 3P11H 4JDEB 3DGGA 3N1FC 4NYLA 5AZEH 4DVRL 3NSCA 4JFFD 3C8KB 2A6IA 2DEYX 4MJ5B 4YZFF 2XWTB 4D0DA 1QRKA 4XP6H 1XEUA 3MV7B 4FXGA 1DBAL 1TVBA 1KTJA 2ICWA 2OCJA 4KUCF 1ZT4B 3HE7C 3GZKA 5F2FA 1NVPA 4YE4H 2WXKA 5ID1B 3RIKA 4PWIA 2FHCA 2X4NA 4QTFA 3M45A 4F2FA 3O0RL 5D7LE 1I1AD 1BF8A 4OIIL 1XF4A 3RWGA 2P5WD 5B1JA 5FHBH 1I1CA 1CI3M 1KYOK 1U58B 4MD5A 3S35L 4WRLA 5L2KA 1OO2A 4HJJH 4GAYB 2D4FA 4M93B 4YHZH 2H3KA 2IDTA 4HFWB 3QIBD 3MOBL 3OJDB 4F7KA 1L7IL 3QUML 2AXHA 2XI9A 5I73B 3QULA 2QJDA 1EMTL 3DUUB 3FTUA 3BE1L 3QCTH 4QOKE 2F54A 1SF3A 2DWTA 1N8ZB 2YRBA 1X5YA 4PV9B 5TTRA 5G5DA 4TM9A 2DKSA 2L3BA 4Y16B 1IGMH 2AQSA 4FQPA 3OQ3B 3T77A 4AJ0A 1CDWA 3IJEA 4IHOA 2EJ1A 4PJHB 2Q7AA 4XN4A 4ZAKB 4DPBX 5BZDA 5KW9L 2L7EA 1A6AA 3MRIA 4OZFG 1AXIB 5H35A 5TDOB 4QF1A 4RMRA 3SDCA 2BOCA 1NBZA 3I2CL 4R8WH 1XCQB 2O5XH 3KL3A 4I77H 3BUDA 4NWUL 5M95B 3WYRA 4HS6B 4IIQB 4H2CA 1E65A 1PKQB 4EVNB 2VXUL 3WUZA 4NXKA 3SD5A 4HAFA 3RWFA 4K71C 1UXLA 1ZDSA 3IMRA 1OAUL 3O9WB 3TO4A 5DRNB 1JFHA 2W1NA 3UEZA 3WXWH 4AIOA 5I1GL 3B2VH 3LTVA 4QHLA 4JAMB 5IR1A 2WTPA 2B16A 3AT9A 3IFLL 3BI9X 1M56B 4FNUA 4RZKA 1M05B 4X5QA 4YL9A 3SBQA 3BN9D 4A2MA 1QI5A 3MBED 5B1CA 1P9MC 4L8SB 5EWIH 1BECA 4NO0D 4WNSA 2NR6A 2IG2H 3LCYA 4C56D 5K1VA 2DQFB 4K2UH 1O9VA 3BYYA 1FRGL 3NJIA 3QH3B 4N9OB 3C5JB 1YYLL 4TUUA 5TDNA 3KR3H 4FMVA 2OMWA 3BZDA 3FT4A 3LVEA 4WK2B 5IB5A 4DZBA 1DVFB 2EE0A 1WG3A 4EO5A 5DVMA 3ULVH 1JPGA 3IETB 4HSAC 1I3RB 4NRYA 3HAEG 4MX7B 3MLYL 3QXAB 4K0OA 3IU4H 4FLOA 1YCSA 4XMLL 3OAWA 4ELDA 5C2UB 3VFTB 1JYWA 3RFZB 3ZUCA 5J9PA 3HNTH 5E6RB 4LRNL 5IHWA 4ZMVA 3DX1A 2DF3A 4I89A 4E5XB 2AQTA 3V4VL 2XBTA 4OZGA 4CC4C 4LSSL 3VRIB 1NEUA 1MCDA 3KYOB 2PWEA 2QZ5A 2BZ7A 2ZG3A 3BZEA 4IKLA 1FNHA 3CSGA 3GQFA 4K7PY 1YYML 2V7HB 3QORB 3IMUA 4G6KL 3MTRA 4UT9L 4ZODA 5BO0D 3RB7A 5I9QC 1IX2A 2GAZA 4EQ3A 3X3FL 3Q2VA 1F45A 4X6FA 2P7TB 5I1KH 3MVSA 3JWNE 3D69A 4TKWA 4PLNC 1IBZA 2IADA 1VEMA 4IBWA 2VRAA 1TJHH 3IU3A 5BVPL 3NCYP 4X98B 5GXBB 2R4SL 2EDLA 3TC9A 3U6XA 3LD8C 1JUFB 1RJYA 4YLQT 1ETZB 3OKNA 5E9DA 2ZP9A 2D3NA 3EJZC 4NFDA 2OL3L 2RFXA 1S9XB 4YEEA 3SKNB 3VRLF 3N44B 5AZEL 1ZGLA 3BZ5A 4L3FA 1JGIA 3HI1A 2VZSA 4XP6L 2RACA 1UXWA 2MTAA 1F4WH 4J3VA 3QXUA 4JKKA 1O9WA 2X70B 4YE4L 2EDRA 3RVUD 5T5FL 2VO8A 4MSWB 3QR0A 1AVAA 1OSYA 4U2YA 5CGMA 3WHE0 2VRKA 1Q9KA 4D9QD 3P0VH 4URTB 3D51A 1T22B 5FHBL 2PMZA 3U79A 1MEXH 2Z31C 3L3DB 3N1GC 1A5FL 2JVUA 2R2EA 4HJJL 2ZCHH 4YHZL 3OB0H 5J12B 1BVOA 2A6DB 3U9WA 5ISZA 1OZTG 1FZMB 4Y0GA 4X6DF 3I3EA 4U0RB 1F3DJ 2FAUA 3SGEI 3CSTA 1KIQA 2OXGB 5ALCH 2ATKB 1SHMA 1RK1A 2BVYA 1PFOA 4YFDB 3QCTL 4XX1E 4IBVA 4M4PA 4TVPH 1LDPH 1BZEA 4POZC 2PXYC 3D3VA 3NJLA 3REVB 1YEGH 4YMPA 1QN9A 2R2BB 4DP9X 1IGML 1WWWX 4U1HB 5GIRA 2J1WA 1KYUA 1NMBH 3GJFH 4Y5YC 3V52L 1U0QA 4R4BB 4YK4C 4FYQA 2WVVB 4B0MB 2OMTA 4LLWA 3ZHDA 2PTUA 4LPYA 4LSRL 1F1AA 2IXQB 1M53A 3BP4B 1SGKA 4OCMC 4R8WL 1OOWA 2O5XL 3MV01 3GSWA 4LPTA 5D2NB 3ZGIA 5SX4I 1T0MB 3ISYA 4C7PA 4EXKA 1DANU 5E6ZA 2VLRE 1HHKA 3WXWL 4PIBA 1OOAA 4G7RB 1KTRL 2Y1YA 1IBFA 1SVZA 3B2VL 3ZRSA 1Y6NR 2ZICA 4R0LA 2WD0A 4ICXA 1HL8A 1FNLA 3SPIA 3ZXAC 4NBYB 1SMOA 4XN1A 4CSTA 3E2HB 5IB3B 1SJEB 1N26A 4JFFA 1QSED 3VFRB 5EC1A 4GP8B 5DO8A 4CU8A 4K2UL 5J13C 4LRIC 2ZUUA 3W0WE 3KLAB 3KR3L 4N26A 4Q9BA 3ARBB 1J1XH 2ARJB 1WBXA 3BQVA 4Y2DD 1ED3B 1I1AA 3JWOH 3DHUA 3PHOA 2XCMC 4ZSOA 4E9QA 2FLBT 2P5WA 1GW6A 1ZD6A 2MSPA 3BPLC 3BZ4A 3D9AH 4NCC2 5FW6A 5LBSH 3ULVL 3GRGA 5LBVA 3D33A 4PLJD 3D25B 5IFJA 5FWQA 1L9MA 1M2OA 4DSYA 4GKLA 3HNTL 1D7CA 2WIMA 1DE4A 1R75A 4FN0A 2XA8H 1RZ7H 2OMYB 2CBPA 4UDTA 3LNDA 3QIBA 4LLYA 3UPCA 1ID5I 4OGAD 3KWXA 1F41A 2OSYA 5HGDA 4NGHH 3ESNA 3MFFB 3IK2A 4HPHA 4Z3GA 3B6SB 4I13B 3VRJA 3OHXB 2OP4H 3MMEA 4BFEA 1G7IB 2RCSL 5EZLB 1XB8A 4PVNA 4ZW8A 4GSDH 1NH2A 3DV4A 2X4TA 2AXGA 3P4MA 4U3CA 4ADGA 5AZ2H 4HZAA 1M3QA 4X83A 2VABB 1P5VA 3WEMA 4NQDB 4IOSD 1CD8A 2IMMA 2VWEC 1QFUH 4LCCC 4XR8C 1ASQA 4MXWH 1EZSA 1BLNA 4KK9D 1Q1JH 5IBLC 4Z7NE 3MLPA 5I1KL 5KAQF 1DDHB 2DPKA 3ZKND 3CDZA 5EO0B 5IREA 3S37H 3ZE2B 4JDVA 3HE6D 3DPUA 6PAZA 4EF3A 3U30C 3AABA 1E5AA 2EDXA 3DMMB 4I2XA 4JFYB 2I07B 1QBMH 1J10A 1C4GA 5ENWA 4BD4A 5FC9A 4ODUA 3CFDB 3CV5A 1CYGA 3HI5L 1OTTD 3QJRB 1B3IA 3BHBA 4LK4A 3SDDB 4MD0A 2FKMX 3MNWB 2LV4A 2E5EA 2W9DH 3BVXA 1F4WL 2BCKB 4OM1H 2VMDA 3MBEA 4O2CB 2Z4TA 3JVFC 4NO0A 3VWKD 1U8IB 4C56A 5JIMA 1SY6H 3GXTA 3MCYA 4L4JA 3VGHA 1S9VA 4F80A 2VMCA 1MEXL 1SJVA 2XA3A 4G80A 4K55A 4HG4K 5KVEE 2DQGH 2FIKA 2JKIS 1IT9H 1CF1A 3LZPA 2ZCHL 1FVEA 2B08A 1R19A 3N04A 1W9XA 1MQKH 3GC3A 4GI9A 5AW7B 5I75C 3EUDA 1ZLVK 2DH3A 4AMXA 1JGEB 1YTBA 1KYDA 4AKPA 4R4ND 5ALCL 5E6YA 2JB5H 1BQHA 3IBOA 1ADQH 3JT2A 3EIFA 4PFEA 4LOUD 4TVPL 1VTOA 3HB3D 4AZUA 1S3KL 5CWSA 3AQYA 4P2AA 1SUHA 4Q6YA 1WS8A 3ZGHA 1TIUA 2VSDA 4WI2A 4ZQKB 4DFHA 4AYFA 1TSRA 7PAZA 5HHOA 5T1MB 3QUYB 3OSMA 4H8PA 3EJRA 4J3TA 5HPMA 3UJJH 1MSPA 1X9QA 1M1XB 3PL6C 4NEHB 3DGGB 2CJSA 2GTZA 3NCFB 2A6IB 3IBEA 1TLKA 2D3LA 2C1OA 4D0DB 4PJCA 5ALBH 1ODAA 1TVBB 2ICWB 5F21B 1FFQA 1QSFA 5ID0A 4IQHA 2ZTBA 4G8IA 3W5NA 2DM2A 1WT5A 4FOMA 5SX5K 1YQLA 1MQ8A 2PYEE 3TESA 3KCWA 4JQVC 4KKPA 3B9KC 2X4NB 3TONA 2Q3AA 5E1AB 1MZZA 2FJUB 3ULVD 2J8UA 4AQOA 1XF4B 2Y5QA 4OUOA 4RWYH 5FUZH 1JXFA 1R17A 3BO8A 3EJCA 3OD3A 1CICD 4R5TA 5A3IC 4NNYA 2BSTB 2IAMC 3GB7A 2EADA 1TUPA 5L2KB 2QELA 1TCRA 2B9BA 4X9YA 2ZNXA 5D4IA 1SXZA 3QUMA 4A66A 2E7HA 2AERT 3MRFA 3HUJF 3V9CA 1DYZA 1YQVH 5F1KC 3QULB 2OSLA 1ZKAA 3KPTA 1EK3A 4V11A 2F54B 3CSYA 1L9TA 2N7SA 2BSDA 4M5TA 4LSTH 3JWOL 1CE6A 3QZMA 4AT6A 3II2A 1S7WA 3RG1C 1UWXK 4X8JA 3FS9A 5FLUA 3D9AL 4N8VA 1QNBA 2YAPA 2LFGA 1G1CA 2B59B 5BZDB 4U1LA 3QISA 2J55A 1A6AB 2RA1A 3MRIB 3OLGA 1EV2E 2DQHH 5H35B 2XA8L 2BOCB 2APBA 2WJ5A 4UM8A 4DF9A 1NBZB 4NGHL 3EGXB 1U4FA 1UCTA 2JCCE 4QXUH 1B0WA 1WWAX 1XEDA 4OIBA 1YNTA 3EJYD 3ABMB 2Y7SA 3LKNA 4GQRA 4OT1H 1OB1A 2OP4L 3PDGA 4Q0XH 1DL7L 2UXGA 1CVSC 3RWFB 5GGRY 1IGIH 5I6NA 2BIHA 5HHPA 3TO4B 4L23A 5J6HA 5AZ2L 2GJ6B 2B4CC 5AKRA 1YEFH 3RPBA 2Y25A 1A3LH 4LHJB 3C09B 2EYTA 4QHLB 1M42A 2XFXA 4LAQL 1ORQB 1QFUL 2VR9A 5IR1B 5HI5C 4MXWL 1KGCD 1XF1A 4PRPB 4I0PC 3L4UA 2YK1H 3TA3B 3NFPB 1HYRC 3UAEA 1MHPH 2DTSA 2C7FA 1QNEA 4MMXC 3S37L 2M26A 5JW5A 4X0KB 2R69H 2DICA 3T04D 1OM3H 2OX5A 3O2VH 4LFHG 4JPWH 4NHCL 5TDNB 1EZVY 3AITA 3OR6A 2OMWB 4P2RD 3FT4B 1QBML 3UBGA 1U93B 4ZFOL 4PJXF 4DZBB 1BEXA 2DQUH 4Y19E 5D96C 3RWCA 5AZUA 1S78D 5DMGD 3B8SA 2PW2A 4OM1L 1A7QH 1MWAH 2IANE 3RTLA 3AXLA 4L1HA 1FYHB 4M4RA 5J9PB 4ZNEA 5LGHL 1HE7A 2R4RL 5IYDP 1QSEA 3V4VA 4TS6A 4KITB 3KLDA 1SY6L 4K9EC 2OOYA 4DKFH 4OZGB 2ZSVA 2ZONA 4AIXA 3CZEA 1MIEH 4PJIA 4F8OA 4ZZFA 5T33L 3AREC 1A1MA 2YRLA 3RVTD 2DQGL 3HN8A 1ZIAA 4Y2DA 1J87A 3BZEB 4OLUL 2HVKA 2NOBA 5GPRA 1HZHH 1UGNA 1ZHNA 4FJ6A 1OQXA 5TPWH 2MZ8A 1Z5HA 2JB5L 5KS9E 1ADQL 2HL8A 1X5AA 2GAZB 4KGJA 5D7JD 2NY4B 2G4EA 4X6FB 5I74B 3D69B 1KF9B 1KBBA 1WIOA 3BZFA 2IADB 4OUUB 3LH2H 2ZXEB 3MCKA 4G8EA 5FWRA 3IU3B 5E0QA 3NCBB 3TFKD 2JNZA 2Q20A 3X3GH 4W9DC 5IUCA 1RJYB 4XMUA 5D5MA 5TD4A 3VFGH 4GUOA 5E9DB 4L8CA 3HMXH 3TU6A 4AVIA 1DQQA 2GC7C 4PHZA 2ED7A 5IW1A 1SJXA 3UW2A 3CH8A 3DYMA 2H6UA 5DFAA 2X2HA 1TQTA 2XOTA 3HI1B 2D0BA 4IOSA 1EUTA 2AQ1A 5ALBL 1UXWB 1TMCB 4GEIA 1OAXH 3QHFH 3T2QA 4BZ2L 5T5FA 5CILL 3H2PA 3GBML 3NRPA 4AGQA 4U3XA 3QPQD 4PRHD 4X4ZA 3PDOA 1LWHA 4JE0A 3WMQA 4EAEA 1PG7X 3HE6A 3QC6X 4HPOH 1DR9A 4LDOB 4ZW6A 4PB0L 1Q9KB 4Z7WF 2O5YH 2ITEA 4RWYL 1E0OB 2YD3A 1XVSA 1D3UA 1NFKA 1AQMA 2R2EB 2C3GA 4RX4D 5ISZB 1O9ZA 2VITB 4YXLH 1EFXD 5H4ZA 2F53D 1YQVL 4M43H 2DWXA 4JCMA 4F57H 3LEYH 2GJPA 1RK1B 3JTSA 4JFQA 3Q44A 4LVNC 1RIUH 3BKQX 2I9TB 3CMOL 4DKDC 2FEEL 5HYEA 1MCLA 3FTGA 4XTRC 3VWKA 3D3VB 4LSTL 1F02I 3ATBA 2DKDA 1UH4A 3QJOA 4HWNA 4LKXA 1M7UA 1CGTA 5F1NA 2HT4D 2HKHH 5CMAA 3R18A 5CU5A 5DVLA 5GIRB 5DDHA 4D7BA 5J7CC 1MI5D 2LVCA 4BH7A 4OV5A 2HMIC 1XXDC 4EJYA 1OAQH 4MQSB 1VPOH 1AE6H 2H2PC 5AOZA 5AD0A 3PWPE 4XXDA 1KCRL 5H8DA 3S6CA 2OMTB 2DQHL 3ARPA 4LLWB 3LIZH 3T4YA 3V4UH 2HPTA 1XF3B 3O2DA 2X6MA 3U2JA 1ZHBA 5AVWB 5IVXE 4TL5A 3L2NA 4UIKL 2WWOA 3GSWB 3ENOC 2EZ0D 2OJ1A 1QR1A 3L13A 4OT1L 4Q0XL 3IN0A 5DD0H 3C2AH 2ID5A 2XWJA 4YHOH 3LEVH 2VIRA 1IGIL 3AS1A 3FCBA 3ECUA 1HHKB 5TE6H 2BDNH 4JCWA 4WSKA 3GBNH 4XPGL 2HH0H 3NACH 1YEFL 3WELA 3QEUB 1A3LL 2I7SA 2V3EA 4YHIA 4JGJA 1UATA 3DHJA 5ADOH 4ADJA 4F93B 3KBPA 4EKXA 1N7MH 2FWLB 2YK1L 4POUB 2Y0SA 1Q94A 1A7PH 4CN1A 1UT7A 2V33A 4JFFB 2JWYA 4AXWA 3E8UL 3BOVA 2R69L 2NZ1A 3C5XA 1LEGA 5JW3H 4XBPB 1OM3L 3O2VL 4FHJA 4JPWL 2CPCA 2X2UA 3EJTA 3A4EA 3D12B 1JDCA 3RUGF 2H6OA 2BIMA 1WBXB 1IC4L 3ME0B 4RSVA 1T6BX 1I1AB 4M93C 2BFVH 2D7NA 4Z7UA 2DQUL 3PHOB 4ZSOB 1QVOB 1YDPA 2A83B 3BZ4B 4WY7H 1CICA 4Y5XC 3FFDA 1A7QL 3EYVA 5T3XH 4U4IA 2DKUA 4P9ML 1FVDA 5IFJB 1QHQA 1U30A 3HC0A 4L3CA 1BX2B 5L88H 3C6SA 4OFYD 2Z9TA 3QDGD 4MA7L 4UDTB 3QIBB 2ENQA 4LLYB 5IT2H 3CFIC 1VLXA 4YNYA 5HGDB 3AGVA 2O6CA 4M7LT 3C04A 3HPJA 5J57B 2NQCA 4HKBA 3VRJB 1V3JA 3L9EA 3ASOB 3FO9A 4ZAKC 3MMEB 3N5AA 4CNIB 1OANA 1TQCB 4JO2H 3WNLA 4N2CA 5MEPA 2DLGA 3DV4B 1BBJA 2WNGA 1CLVA 2X4TB 2BY1A 4ORGA 2AXGB 4RA0C 4U0QB 4Y2LA 3K72A 2FGWH 4BA8A 2NTFB 4UTCA 4AKOA 1P5VB 2YS4A 4M7JL 3UDWC 3PABA 1XD1A 4J28A 1WRFA 4KJWC 1NTDA 1AFVL 1BLNB 5IWLC 4IIQC 3CXFA 2VUOA 5F7FA 1E5ZA 4DP7X 5T1DH 5B3SB 3DYPA 2XQBL 1UZ8B 1PY0A 1ZLVH 3CDZB 2WBWB 2ZXDA 3LH2L 4XNZC 4JDVB 5GJTH 4BINA 4U6VL 3O9WC 4F7TA 3VU2A 2FJGA 3KLHC 1RUAH 4UQIM 2G0LA 3X3GL 2WBJD 3VFGL 1CWVA 3IJ7A 1C7SA 4I2XB 3PAYA 1H6FA 1HE8A 5GGTH 2CRMA 2VLME 2JHJA 2EAEA 3V9EA 4ODUB 4F5CA 1QN4A 4K7PH 4LAJH 4AGNA 4QDGA 1G6RH 3BHBB 3FTWA 3FH7A 1A7RH 4I3SH 5I6OA 5AVVB 1J1OH 3D1MC 4OLZH 2X05A 1U8NA 2HRHA 2X4RA 4L4VE 3PWUA 4X5XB 3BUPA 1T80A 2XTSA 1LO2H 3MBEB 1BFOB 4F27A 2IO5A 1OW0A 4NO0B 3V55A 1QPPA 2QADD 3EYOA 3LQAH 4HPOL 4C56B 1GC1H 3WAJA 1DVFC 2PYFB 2O5YL 1S9VB 3WNNA 1ZSDA 5SX5H 1BG1A 9PCYA 2QPSA 3AWFA 1JF5A 4G80B 2WXFA 4P2RA 2HZSA 2FIKB 1COBA 3RFZC 1OGAE 2XWCA 5GJSH 2YXVA 4XH2A 5IV2A 3K5RA 5I0XA 4I87A 2V8LA 4YXLL 2YARA 1ANUA 4ZW7A 1BQKA 4XCCH 1XBDA 4QEGA 2VISB 4F57L 3LEYL 1FCGA 3W5MA 2GCYA 3QJZA 1RIUL 2VUYA 1T7WA 5J89A 4XOAA 5DVKA 1KZQA 2LABA 1GGBH 1FDLL 4EKJA 2J21A 5DUML 4HUMB 5E7FA 4AYFB 2HKHL 3QHZH 2IQ9L 1KJMB 3QORC 1WLHA 5HHOB 5CJOH 4QYAA 1NCIA 3WJMA 1OAQL 3FTYA 1VPOL 1AE6L 4GRLD 2CALA 3T6XA 3EDFA 5FGCE 3V4UL 4PP1D 3E9TA 1UZGA 2CA3A 3LIZL 2GTZB 4KGLA 4MS8D 5DS2A 5E1IA 5IQ9A 4F7CA 3FUFA 2H4LX 4A55A 4ABUA 2C1OB 2VOTA 4W9CC 1UZ6E 1A3QA 1BQHG 4LLMA 1KLUA 1QSFB 5D7JA 3DJSA 4G8IB 4JFWA 1X9UA 3C2AL 1XGZA 5DD0L 4YHOL 3LEVL 1OHZA 1MCKA 1YECL 2DQ6A 5HSFA 3IN2A 4HIEA 2J8UB 2HH0L 3NACL 4YDZA 1JMXA 2JJVA 2YSSB 1PY4A 3ZMEA 3APFA 3BO8B 3LS4H 1HESA 4NNYB 4G6MH 2AABL 3QXVA 3GB7B 1FGNH 5ADOL 3SE4C 1N0XL 1WS7A 2I26N 1T20A 1N7ML 3V6FA 1NCDH 1JP5A 2XPYA 3BSZL 1U2CA 4G9FE 2X28A 1CMOA 3EO1A 3EH2A 5FFOA 5GS3A 4AUUA 4I4WA 4RIRA 3VXRD 3QUMB 5IQMA 1ZLEA 2FK9A 2APTA 3AQDA 2YLHA 3K6DA 3K8LA 5I66B 5A2LH 5F9AC 4PRHA 2DIEA 2CCWA 2EYSB 2AHIA 1ZMYA 4HPYL 3DSNA 3SO5A 2X6VA 3VD1A 2CHWA 1CE6B 2BFVL 1S7WB 1J8RA 5IMKA 4WY7L 4N8VB 4OCWL 4U0RC 3DVIA 4Y1SA 2WXOA 2Y6SD 3AG4B 5T3XL 3QPXH 5I15H 1KTCA 2E9IA 4D9LH 2CGYA 4ELMF 2OTUB 4RX4A 1AQKL 1EFXA 3ZDXF 1ACYH 4UM8B 4PJDB 5IT2L 1PKOA 1R3JA 2CNYA 2F53A 3E1ZA 4KKQA 3T6ZA 4DN4L 2JK5A 3GMLA 3QDAA 1YNTB 2OLDA 3LKNB 4KI5C 4LQ1A 1OB1B 2Z6FA 3B2MA 1HIMH 4JO2L 1AANA 3IDMA 4HIIA 4HCRH 5DJAB 1LD9A 2YMTA 2FGWL 3VXSD 1WHPA 3O2WH 2FO8A 3LDBB 1MI5A 2XFXB 4TUKH 1EJOH 4PR5B 5KSUA 2ZUWA 3U2SA 1TO5A 3OJ2C 2GITA 4WUUE 3QEHA 2F7RA 4MGXA 5T1DL 4Q9RH 2V6HA 5GJTL 1QFWI 1ROWA 1RUAL 4FFWC 5EEWA 1QG3A 2OX5B 4M6AA 5E8DH 3TEYA 4ZFOA 4BFBD 3Q8EA 4G42B 1WC7B 4MAYB 5GGTL 4CMHB 1BMWA 1EO8L 1D5XA 4K7PL 1J8SA 3Q3GA 3E2HC 1CS6A 3RWCB 1A7RL 4I3SL 2CK0H 1J1OL 1ICTA 3T4NA 1Z9SA 1FN7A 2PW2B 3WHXA 4L1LA 3QZLA 3ILQC 1WZ1H 5DEJA 1IFHL 1E9OA 3MRDB 1LO2L 5I6LA 4M4RB 1IKNA 1BVKA 3GUTA 1ZDQA 3ARBC 1V5JA 1QSEB 3V4VB 3LQAL 4MA1C 1VENA 3TH2T 4U1JA 2J4WL 5EORH 3D5OF 1R46A 2ZSVB 3G6JE 5C07E 3HTLX 2A9DA 4JFOA 4PJIB 1VERA 3EOTL 4O00A 4PJGA 5EV7A 4JANB 5B38B 1A1MB 4WAFA 3LXBA 4GKZB 4N5ED 3VFMA 3GZPA 2P24A 5DJ6A 2DLFH 5GJSL 2HVKB 1T5XA 5K1JA 1KWGA 4L5FH 3O4LD 5F7NC 3S5LG 1DLFL 1ZHNB 4PS4L 1J86A 1ADQA 1XL6A 4QXWA 4XCCL 1S46A 3L1EA 3U36A 1Q0XL 1XIWC 3LKRA 1O6VA 1ZEAH 5DEGA 5JMRA 4GRMA 1A14H 3OHXC 4P46D 3FPYA 1NFAA 4L48A 4OFYA 1WFOA 1LP9A 4KQ0A 3QDGA 1ETA1 2Y06H 1GGBL 2BW5A 2R5XA 2CRIA 4G8EB 5K9QI 5C0CD 2C9UA 1EJ8A 2IH8A 3LS5H 4IRJB 4YSSA 3QHZL 4IBTA 3K8MA 1H6EA 3MJ7A 5D5MB 5CJOL 3ARDD 4QHMA 4DHLA 4L8CB 5DJ8A 1DQQB 5GS0H 4OZHA 3MRKA 1L0PA 3DK2A 1WZMA 2X2YA 3D30A 5IW1B 3SN6N 2VQTA 1MCWM 4QRRE 4YPGA 4YIQA 3GHBH 5KANG 1RUPH 4BZ2A 4DESA 4QTIL 5F6IB 4BBWA 4R7XA 5T1KD 4JKNA 5KBLA 1KO9A 1D2PA 2V2XA 3CZGA 3PDOB 3CH1A 2R83A 5LAXB 1N6VA 3HE6B 4G6JH 4BJUA 1VZIA 4PD4K 1H3UA 3SDDC 3P4LA 1F5WA 2WBJA 4G6ML 4BH8A 5C2BL 3DA0A 1G87A 4LVOB 4FE9A 1FGNL 4KKLD 5HGBB 1QN3A 1NCDL 3D0LA 4PU2A 4R2GD 4ZS6C 5F97E 4B9FA 3L54A 1AO7E 2GPZA 1ZHKA 2J7LA 1TO4A 1D5MB 1JE6A 5KTEH 5F0LB 1JN6B 2Z7ZA 1X4ZA 1MXGA 4TN9A 3JTSB 3WD5L 3OGDA 4JFQB 3O6FD 4B60A 3P9WB 1WK0A 2FX9H 5DI8A 3X1GA 3FTGB 4PRDA 4UNIA 3VWKB 4ZO7A 4D9RE 4BHUI 5BRPA 3H9SE 4HJGA 2ZWYA 5F1NB 3QS3A 2EC8A 5CMAB 1A4JA 2V9RA 5EZJB 3FTSA 5DDHB 4BH7B 4OV5B 1QZ1A 4GMSH 4ZUSA 1KCBA 1V3MA 3NEEA 3QPXL 5AD0B 2YWYA 4XXDB 4D9LL 4HWBH 2LOEA 5HVGB 5JXED 2MKWA 4TV3A 3AM8A 3T4YB 2NY5C 1QKZH 5C86A 2DS4A 1ACYL 4UMGA 3TFBA 4HH9A 4E9YA 1ZHBB 1YUHA 1F58H 2PO6D 1DUYA 1I3UA 1XZ0A 4F7PA 4WTQA 5JIKA 1QR1B 1BP3B 5IB2A 2XWJB 3RJDA 3K3QA 1HWGB 1HIML 1NPJA 3HB3B 3MGOA 3QUYC 2VIRB 3WKYA 3LXAA 1OL0A 2CUIA 3VXOB 1TPXB 1WBZA 1VZHA 4P48A 3O2WL 2WXPA 1ODUA 3IKKA 2K4WA 3CN4A 4TUKL 1EJOL 4YHIB 4FXGC 2Y3NA 4JKPH 4PB9H 5E7BA 5JQIB 5I6KA 1UG9A 4GRLA 1UD6A 1E4JA 1E90A 5BS0E 1Q94B 4Y7MA 4Q9RL 1NLDL 3K91A 2WLHA 3A6CH 3QG6A 3WFEL 4AXWB 4GIPD 4X8CA 1F0LA 3DJZA 3E8VA 2BP0A 1BFVH 4G43A 2DM3A 5EPMA 5B1JC 1U3NA 1VSCA 5LWYH 4RGMB 1UD3A 3DX8A 3IRPX 1G84A 2X4QA 4PWGA 1OALA 1MCRA 5AVRB 4Z7IA 1ES0A 4CGTA 5FYJH 1EH9A 3AADB 4CKVX 3VNZA 1EHKB 4V33A 2NLJA 2CK0L 2R9HD 1CICB 3QXTA 3UZVA 3W39A 3MV7E 3ARWA 1UOVA 5D7IE 1WFUA 5C6PB 1FVDB 2V37A 4PCTA 2X5PA 3LZRA 4K15A 3C6SB 3ZDYB 5FW8A 5GHWH 4XPBH 4WO4D 5D7KE 2BNUA 1NEPA 3VXRA 2J2ZA 3MJGX 3VXTB 5EORL 1IFRA 3FAWA 4YNYB 4AW4A 3BRDA 4Y4KA 3HPJB 4HKBB 1DSWA 3FO9B 5DRZB 4PP2B 4CSZA 3OPZL 1IBHA 1PD1A 3T3PE 4ZFFB 1TETH 1JWSA 2DLFL 3L1FA 5MEPB 2PR4H 1LLAA 1WAEA 3VFPA 1N3AA 4ORGB 2CPUA 2WOBA 1MDAA 1Q9LA 2YFNA 3K72B 2AEPH 4GSXA 4PJ9D 3SDCC 3FYEB 3NTCH 4DPRA 5GS1A 12E8H 3PABB 4CKQA 2PKDA 2W07B 1ZEAL 3BWSA 5DZOA 1ZGLM 4EAGA 2G3NA 3ZTDC 2J8OA 3BLBA 1O5DT 1UWGH 2XYBA 3LQMA 1OP9A 4MJIE 1Q38A 4NQED 2Y06L 5FGBA 2IV8A 3G5VA 5C08E 3TO4C 3LS5L 1KTLA 4NQVA 4F7TB 2FJGB 5E2VH 4OH2A 1K4CA 3C09C 3HZVB 4NO2A 4F8QA 2C9SA 2WKOF 4Y8AA 3ALWA 1G9NH 4DPCX 4PVLA 2R0KH 4AI7A 2BLFA 4WTWA 5A16A 3VXSA 2JKSA 3GHBL 2NR6C 1RUPL 3RX8A 3HBQA 5AVTB 3J7HA 1AQHA 1CPUA 1CFTA 1U8NB 2H6PA 2X4RB 3PWUB 3JWNH 2ITFA 2D0AA 4GJTB 3OC8A 1NWOA 4NCC1 5LN8A 4HLJA 3EYOB 4I5BA 3LXUX 4G6JL 1A6ZA 5T8IA 5EF2A 1ZSDB 4NHUA 2BVQB 4QRPB 4LIQL 4P2RB 2D73A 1LXTA 5JPNB 2VN5A 4IOFC 1PX4A 5JMVD 4HEME 4P2QD 1KLGB 4XH2B 4U1SA 4AE0A 3BH8A 5KTEL 4JRLA 1INQA 5ABZA 1E8WA 4OW6A 2EC9T 4JHWH 3TT1L 3L8QA 3GIZL 2GCYB 2BK8A 4HIPA 4WLCA 3CXHK 3HPLA 3Q7JA 4YBQC 4BK5A 3TBVA 2LR4A 4HP5A 4UU9B 5EBLA 5LUMA 3P4NA 4J2QA 2N4IA 4PJ5D 4WEMB 4D0BA 4GMSL 1S5HA 2QR0A 1BM7A 3WJMB 3ABLB 5CGYC 3BD5A 2NY4C 1KCVH 4CVZA 3OKYA 4HWBL 5I74C 3DTDA 5IQ9B 2CBMA 3NDYE 3O4LA 1QKZL 4F7CB 3BP6B 5AVUB 2NQDA 5I71B 1GH7A 1CLZH 1OAYH 4I1NB 3GXMA 4JHZA 5D7JB 5AW4B 4Y1TA 4P46A 3SE9H 1O5PA 1AGFB 5A6IA 2MH4A 5D4QA 1A7OH 2Q2LA 3FT3A 3MRMA 3K8KA 3PS6A 4HIEB 1UWEH 3CHSA 5C0CA 2X1QA 3K1KC 3VI3F 6CGTA 1BZOA 2JTYA 5E4IA 2IAAC 4JDZA 5C9KA 4UQ2A 3BSZA 3ARDA 4EUPA 2FUQA 4JKPL 4PB9L 5I1IH 4YN3A 1M71A 1T20B 5AOLA 3V6FB 1U3HD 4K4KA 4B50A 4OJDH 3EO1B 5FGRA 3QZWG 5JDJA 2ZAHA 2VM3A 3A6CL 3FRPG 4I4WB 4RIRB 5AB1A 5FO8A 5LQBH 2UVEA 1QATA 5T1KA 2WTRB 3DX0A 3U82B 1N59B 1UEMA 2FD6L 1UOKA 2A1WH 3JWDH 4YWGH 5CEYA 4WFFE 2A5UA 1U8JA 2XPGB 4E68A 3DSNB 4WJG3 4CADA 2RJMA 4B9YA 1RK0B 1R4XA 5IMKB 5TDPB 3MTXA 1QN7A 5EPCA 1RI8A 3BUBA 1LE5B 5MEQA 1TZ8A 3PY9A 1EHAA 1LXMA 1E3FA 3PGCA 4XPBL 4MB3A 4PJBA 1QSZA 1EFXB 1H3PH 3MXWH 1R3JB 2F53B 2NRDA 3UBXG 2JK5B 3RGVD 4PJ7E 2OMBA 1E2WA 3O6FA 3GBLA 4KKZA 1SVCP 3EDKA 4JMXA 3ZKQD 1TTCA 2NY0B 3PMGA 2X4OA 25C8H 3ASMA 3CX5J 2PR4L 3IDMB 5FW7A 4L05A 1LD9B 2MCAA 2AEPL 2GTQA 3NTCL 2X9ZA 4TUOA 4PY7A 12E8L 1MI5B 1H3WM 1HVXA 1P4UA 2I27N 3U2SB 1W6LA 1CBJA 3WLWC 1B2YA 5JXEA 4K3DH 2BIIA 1TTFA 2JQMA 2X3CA 1F90L 2XKSA 5I1LA 2PO6A 4JY6A 5E2VL 3KXFE 1CLOL 2QLVA 4KI5E 5DGRA 3S3BB 2KERA 1MW3A 3HFMH 4ZFOB 4R0LC 2JV6A 3PAZA 1G9NL 2RR3A 1D5XB 4MQXD 2R0KL 2FX7H 3FQUA 3Q3GB 1F56A 2PPCA 4G71B 2B7DT 2GBAA 2VZUA 1Z9SB 3TM6A 4YR6A 1PCMX 1EXGA 4JFUA 4RDBA 3AGWA 1E9OB 1NUFA 3VXMD 1BVKB 4GT0A 1OAZH 3V4PH 3TVMA 4K23L 1YNLL 4N28A 1XX9C 1I1AC 4U1JB 1WDAA 2O1AA 3QQ3B 1ET8A 3LNFA 1QQDA 5C97A 3ISWA 4JFOB 3WUWA 4I48B 1RPKA 3D34A 1VEOA 2QBWA 3PGFH 1HT6A 1MAJA 2P24B 5L8LB 5DJ6B 4JL1A 4FRWA 1T5XB 1G0XA 4MHHG 4UOQA 2Z4QA 5IEKA 2AJXH 4NUMA 4QOKD 3QIBC 3PUUA 5SWZD 4UQDA 4ZS7H 2CUAA 3U36B 4I85A 3LKRB 4BEIA 3BMWA 5DEGB 1LEIA 1B0RA 2V4LA 2VDLL 5FECB 1LP9B 3PIQB 3QDGB 4FMFA 4WO4A 1GJUA 3CVHA 2H41A 4JRXD 5TQ0L 3ARGA 1AZUA 2WIIB 4HCGA 1XSOA 3OKDA 3MJ7B 4ZMZA 5KVEH 5KUKA 2XQYK 3TO2A 5DJ8B 4JPIA 1P6WA 3R8QA 1SDAB 3QJHA 1KCVL 5I0VA 1KCSL 3MKKA 2EDDA 4PN6A 3F7VA 3RZCD 4J3OG 4PJ9A 3I3BA 4YIQB 1BJ1J 4TNVK 5D4HA 3MRBA 1CLZL 2WUBL 4R3SB 1OAYL 4PJ6A 3BVDB 4W93A 4EALA 4OI9A 4OD1H 2UY7A 3OAUL 2DQMA 4AZ8B 4RSYA 2G9KA 1TTUA 4FABH 3CH1B 4NQEA 1TTBA 1UWEL 2WAQA 4WCYH 2H1LM 4AUYA 4NQDE 3EJUA 1PTZA 2WBJB 4BH8B 5BZWA 5I1IL 3C8DA 3LB6D 4JGMA 3D0LB 3HZMA 4ZFQA 5BV7B 3BN9C 1JNLH 3MBEC 1HH6A 3U6RA 1ZHKB 3RX5A 4KZCA 1HCVA 3UYPA 3P73A 1L0XA 4IRZH 1A9BA 2X38A 2A1WL 3JWDL 2CK2A 4U33A 4KRPD 1MFDH 2PPFA 4PG9A 4FULA 2HLAA 4PRDB 5DQJB 2QADB 2FE0A 4JEGB 4F24A 2CDFA 1LM8V 1ZVHA 1A4JB 1MJ8L 1OZUA 2C4FT 4X99A 4ZUSB 2CR0A 5AW1B 4WHYH 2KPNA 5CEZD 2NY1B 2OCCB 3BUTA 4P2QA 3ULXA 2R51A 4TNFA 4GRWF 1A9EA 2WO3B 1QAWA 4A38A 3KPSE 1H3PL 3MXWL 4HH9B 4XVSH 1UM5H 1YUHB 2NNAA 3VD9A 5HXMA 3NFSH 1DUYB 1XZ0B 4F7PB 5JW4R 3ARZA 3W3BA 5IB2B 4OFPA 4ANVA 1XWVA 2BRRL 2F8IA 5A6LA 1OT2A 25C8L 5FIEA 1E4XL 1E6JL 4WFHD 4P3CH 4YSAA 1UACH 1WBZB 2YPKA 3EH1A 5BV7C 2YKKA 4PJ5A 3TNNA 4TMPA 4KTEH 5ESQA 3T65A 1BF2A 4ZMPA 4JS7A 2CA4A 3VDBA 4UQ3A 4Q9QL 4LPVA 4FQHB 1WT5C 3QRGL 1X7SA 4H1LH 4P5RA 4YS4A 5CBAA 2ARJQ 1SM3L 4OIFA 4G43B 4LMQI 1E3XA 3KGRA 1KY7A 4OD3H 5EPMB 5ANHA 1MOEA 4MDRA 5DZJA 3TF7C 2FECL 2R1YA 3C6LD 3DX8B 2X4QB 2F18A 4LSPH 3KYKL 1PZBA 3NIFB 2FX7L 1FBIL 3BAYA 3H3BC 1HKLH 3GFUA 2NLJB 3UZVB 5KVFE 3W39B 2A9CA 4RAUA 3ZIYA 1W2KT 4N0FB 2BS71 3FQNA 1U3HA 3PU7A 3V4PL 1CYXA 1JTTA 3RVUC 3BH4A 2BNUB 3BEWA 3VXRB 2J2ZB 2WWNA 3V0AC 4M03A 2YXWA 2QEJA 4Y4KB 4NJAL 1E2VA 4XVOA 1V3LA 5L2KE 3PGFL 1MP9A 1KXHA 1Q0EA 1JWSB 3QAZB 2JF1A 3RFRA 2Z8VC 3T8VA 1M3HA 3KBHE 1CL7H 4DZ8A 1Q9LB 2AJXL 4E9LA 3DVFA 5GS1B 1G1OA 3EYFB 1IL1A 1GMIA 5D7SH 2PW1A 1EXUA 2WZPD 3FT1A 4JB9H 1WUNT 5TK4A 1X9LA 1WV7T 5MHSE 2VZOA 2NZIA 3NCWA 1DJZA 4J3SA 2QLYA 4CC0A 4M1DL 1KTLB 4NQVB 4I0CC 1RIVH 3RGVA 4CDHA 1TTAA 4KFZC 2ITDA 1TR7A 5KVEL 3ZR6A 3HUJA 2FT8A 4W4NA 3KPRD 5JQHC 1EERB 5I23A 1Z9MA 5KYNA 3EGSA 5CNHA 4PY5A 4AJVA 1NIDA 5A16B 3VXSB 1BZ8A 4ONGL 3CCHB 3R7QA 3TF4A 1CJYA 1A25A 3CHXA 4W9ZA 1CFTB 2H6PB 5C0JB 4XO9A 3CZLA 1OK8A 4OD1L 1XHHA 2Y8LA 1ROCA 3FCSA 2XN9D 4ETQA 3LPPA 4I5BB 4GO8A 5KVGE 2PN5A 4Z7QB 1CDGA 3EFFA 1QTPA 4NHUB 1FC1A 2AQ3A 1LQSR 1H0DA 3DC0A 1OCRB 1HAUA 5E6IB 5E8EA 2A0LD 2CO7B 2J71A 5I24A 1D9KD 3AUWB 5G4MA 4OCLC 2FL5A 1BQUA 3W0WD 4C55A 3BH8B 3V6BR 2VXQH 5E95B 4FF9A 1KLFB 4R4FH 4IRZL 1F42A 4ANUA 1DVQA 1U8PB 4NDMA 1Y6MR 1PVHA 2VJ8A 1MFDL 3VXMA 3HPLB 3QJSB 4AC4A 1S7UA 5BJTA 5F70A 1DJSA 3EDJA 5B21A 4Y2DC 3ZE1B 3CWAA 1WAAE 3F58L 5EBLB 2A77H 2FUTA 3P4NB 3ASWA 4V1DD 5AOMA 5J8OA 1E7VA 5CGBA 4D0BB 3HHSB 5DEZA 4PLJC 15C8H 1S5HB 2QR0B 2FZ3B 3PJLA 4HWBA 4WHTA 3RVXD 3KNBA 1AIFA 3VGBA 1IJNA 4CVXA 4CVZB 3I9PA 2G5BB 1E8ZA 1P7KA 4GG6F 2ZCZA 1N67A 3O4LB 1DVXA 4HS3A 4PJXA 4QOKA 4YH6A 4OGAC 3PJSB 2UWEF 2DWEA 1VGKA 3NFSL 5DHVH 4ENZA 3VTMA 2KMWA 4P46B 1KPRA 1JFQL 3QG7L 5EOTA 3FT3B 1F1GA 5IFHH 4P3CL 3MRMB 1UACL 4UZUA 4R7DA 5C0CB 5DU7A 4PJAF 1PYWB 3NCXA 2H8PA 5F6HI 3WFDL 5CIPH 2V3DA 4GG8A 5F6IC 4JPVH 4OBRA 4KVCL 3ARDB 4UQ2B 1W72A 5D4JA 4EUPB 3EYQD 2H9GA 1VOKA 1M71B 4IKJA 4KK9C 2JI3A 4WDIA 1RZKL 3ZKNC 3RZCA 4LF3B 4EQ2A 5FO8B 3B2UD 3HE6C 3JSSA 4JN1H 1INEL 4F8PA 5T1KB 3CGTA 4OD3L 1D3CA 4HBQA 4IK7A 4Z6AT 3NIDF 4LVOC 1NCBH 5E9DE 5CEYB 2BIQA 1U8JB 2CG9X 2HVJA 2XIBA 2WNKA 4BFRA 4LSPL 5M94B 2QGBA 4GT7A 1OTTC 2ZOKB 4HHAA 3B2DC 3UJTL 1UT1A 4WEUD 3CFBB 1R3IL 1YTFA 3CVTA 3OR7B 4AQ8A 3GPSA 4K73A 1A66A 2H32H 3HHMA 3MRLA 3U4EA 3OLIA 4R2GB 3VQ1C 1A4KA 4AVJA 1IGYB 3ENCA 1X4XA 3PGCB 4PJBB 1SRDA 3VWKC 4XVJH 1FNGB 4XBGB 4UAOC 1FSKC 2OYMA 3Q9PA 1MVUA 3O6FB 3ILDA 1G0YR 2UXVA 2X4OB 2XX0A 4M9OA 1CL7L 2MCPH 5ISZE 2WXJA 3ATEA 3VI4F 2IOOA 4PY7B 1SYSA 4R4NC 1EWHA 4Z7WA 5D7SL 4RZCA 5B7MA 3WFCL 2DWSA 1MFEH 2XN1A 3O6MH 4LOUC 4JB9L 2V8MA 2V92A 2DMKA 4FI7A 2PCFB 3HB3C 3D3VE 1TVDA 2ROXA 4AVKA 5KSBB 2XBZA 5I1LB 2PO6B 4JY6B 2QLVB 4G7SB 1SLUA 5JIIA 5C0GB 3FNKA 4NSKA 3WFZA 1Z9LA 3W2DL 1AACA 4U1NA 1LO3L 4RGND 4IKKA 3FQUB 3OXSA 1YRKA 3FXIC 1CGYA 3BUYA 5JDSB 1BFSA 3BMVA 4L0YA 1J0YA 1MCPL 5DHYA 2HXAA 4RGMC 1TYRA 1KDIA 3TVMB 3O3AA 4JHUA 3KW8A 4M62H 4NQQA 1NA8A 2Z92B 1DN2A 4NC2B 3T1FA 1QQDB 1DQKA 1CICC 3WUWB 3C6LA 4PJ7F 3V5DB 3O3DA 2DLHA 3LRGA 1NCCL 2B15A 4GYBA 1L9RA 2Z4QB 5IEKB 1XMEB 2VXQL 1UTDA 5KSVB 1N10A 3SODB 4AK2A 4FD0A 4R4FL 2A6KA 4BKSC 1ZOXA 1LEIB 5IY5B 2YEVB 3UJIH 4KDVA 5LXVA 1B0RB 1J0IA 1TTRA 3QNYA 4BCXA 3FO1A 5HDQH 4IM8A 4XNUH 4WO4B 5G2NA 1JDDA 1X7QB 3CVHB 1I8MA 4P5SA 2YD8A 2A77L 2P5WE 2B3RA 3OAZK 3NRQA 1GMEA 1CDBA 3ARGB 2VT0A 1S7TB 1UT9A 3OKDB 4PCSA 4AENA 1RJZA 15C8L 3TO2B 1JHLL 4HAKA 4C8XA 1QNIA 3QJHB 1QBBA 2G2NA 4AQ1A 5HHNB 5JA8B 5D55A 5LGYA 1DQMH 2EXYD 3C8HA 2W60A 4M02A 3F7VB 5KANI 4PJ9B 2CAKA 1HINH 3GDBA 3UYOD 3MRBB 3BQUD 3FH5A 4KQ4L 2IQAA 2VSCA 1KJ2H 2E56A 3MLWH 3EJYC 3N1MC 2VGLM 2WZPA 3X11A 2FLRT 4E41D 3AU0A 4NQEB 3MKGA 1DQTA 2EDWA 2YZ1A 4HIJA 2VM4A 5AKTA 1PQZA 4ZI8A 5ITFA 4AITA 3S9DB 3WIAA 2F1EA 2WC7A 3D85D 4KTDH 4XOBA 1HNGA 3TDHA 4JPVL 5BZWB 4EI6A 3AROA 3KPRA 4Y88A 1QYGH 3X12A 3RTQD 1HH6B 3QZBA 1OW0C 5HDLA 2VXVH 5IQ7H 3ARQA 4JN1L 4XN5A 1KXTA 3P73B 1JNNH 3BDYH 3UYPB 35C8L 1A9BB 5BW7A 1C9SA 4L4TE 1DBBH 5DEFB 5D1QD 4YPJA 4AGOA 3LQZA 2B2XH 4UT6H 4Y19D 2XN9A 4PG9B 3US1A 3NFNA 2HLAB 4Z3IA 3ABZA 3ZDZF 1DVYA 2QPEB 4AE1A 2ZWSA 4HEPG 1JWUA 4TPRL 1X5ZA 1S78C 1FUNA 5DMGC 1RJCA 4X99B 2OR9H 3K4ZA 3WE6A 1D9KA 2F8XC 5SWQA 4JQIH 5JZ7D 4P2QB 4WXAA 2X88A 3PUCA 3QFJD 1UA6H 3CU7A 1RVFH 3GMPA 1A9EB 3W0WA 4FLQA 1U4EA 4XVJL 3RVVD 2ZXCA 3HCVB 1FNEB 2NNAB 4AK1A 2TSAA 4HOXA 3PE9A 3GXDA 1XH1A 3L17A 3GEFA 3RVTC 4Z8FL 1DCLA 2MNWA 1CDHA 5A2CA 2UY6A 2MCPL 1MHEA 2YPKB 3QCUH 4NCDA 4UQCA 2VR8A 4PJ5B 4JY5H 4V1DA 5JOPD 3TNNB 5IBUG 1CK0L 2ZKWA 1TNMA 2BNRE 3T65B 3I50H 2WXGA 4AYID 4UQ3B 3VD7A 5D7JC 4M1CD 1RHHA 1ID2A 2ATPA 2N7BA 3B2PA 2YQ3A 1T4WA 5AL8A 2KDYA 5CBAB 2A9MH 2HT2D 3DARA 2F1BA 5KYUA 3WIIH 3B83A 4N0CD 4UWQB 3TFKC 4NKMA 3TZVD 3MRCA 4HU8A 2R1YB 4GQQA 1RZQA 3ESVF 1K4DA 3S2CA 1ZK9A 4I9WD 2G3ZA 4S1RH 3JUZA 4Z7AA 4LCWD 2DTML 1HZLA 5B39A 3IDXH 4PJCE 4Y9FA 4RAUB 4XB8A 2WYTA 3HG5A 3IE9A 2XV2A 3V4PA 3FQNB 4LEOA 5FB8A 1U3HB 1AC0A 3UXFA 1NIEA 2L0DA 4CMMA 1NKRA 3QPQC 1W8OA 4NO3A 3Q1SL 2XNAA 2J8UE 3QQNA 4M62L 1UM4H 4C4UA 1BOGA 4U6HA 2R8SH 2MWCA 5FO9A 2PWFA 1UGKA 2VE6B 3QDHA 1RJLB 3P3RA 2R1XA 1PS3A 2O72A 3DUSB 4RQQA 2ENJA 4DZ8B 5D7HA 3G5XA 2MKLC 5AWNH 4F1SA 1LK2A 1IM9D 1OKEA 3WS3A 2DMGA 2NW2A 1IL1B 3VG9B 3DV6A 2Z35A 2PW1B 3UJIL 5DS8A 3QQDA 1JS4A 1EXUB 4UOW1 3ZBMA 4L8DB 5ICXA 5HDQL 4NZDA 1KV3A 4XNUL 2X3BA 3CAFA 3TL5A 4D9QE 1L3NA 2Q2EB 3RDTB 1A9VA 1BDYA 4LP5A 2Y2WA 2HT4C 2ITDB 4ZTPL 4ODTH 3VB9A 1KXVA 3APNA 3TN0D 4ONFH 1XF2B 3CSPA 1FZJB 3KYMA 2B14A 3EGSB 4NPYB 1K3ZA 2AV1A 3KWTA 1HNFA 2LU5A 1HINL 2BPBA 4JM4H 2V8QA 1VESA 5H37H 2VJ0A 4GXFA 2PETA 3KGSA 1FYTD 1KJ2L 2EZ0C 3MLWL 5DJZA 3FQXA 3EOAA 2EKJA 4IRSD 5F96H 3EXJA 4PRIB 4K9EH 4FTVE 1LQBC 2F7IA 3NYKA 4LHUG 4HWEL 4ETQB 4ELMA 1ZJAA 4ODWA 4IS6B 5KBNC 2W59A 4KTDL 4ZMYA 1SYVA 4BZ1L 2TRYA 3CWGA 1H0DB 3Q05A 3L6FA 3ES6A 1QYGL 2R23A 5E8EB 1R5VA 4P2YA 4YOKA 3M1BB 2FL5B 1IKNC 1KG0A 1MRFH 1NL0L 3GM8A 3Q6GH 2B77A 2VXVL 5IQ7L 4G7YH 4KNUA 3ELQA 1TZOA 2AXWA 1J0KA 1DBBL 1VFUA</