1KYUA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyuA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyuA02
4PY5A 4ROCB 1RM1A 1KYFA 2D0AA 1QNAA 1NGMA 1KY6A 1NA8A 2D0BA 1NH2A 2DWYA 1QTSA 2IV9A 1KY7A 1QN3A 1TGHA 2A7BA 2DWXA 1VOKA 4WZSD 1QNEA 3OCIA 2VJ0A 1JFIC 1NVPA 2MJ7A 3H1ZA 1QN4A 1PZDA 1VTLE 1KYUA 3HS8A 1YTBA 1W80A 1AISA 1TBAB 1VOLB 1IU1A 1QN7A 1QNBA 1VTOA 4RODB 1C9BB 1CDWA 1TBPA 1GYWA 3OC3C 5IYDP 2E9GA 1QNCA 5IYBP 2YMTA 1QTPA 2D0CA 1OM9A 3HS9A 1QN5A 1D3UA 2G30A 5IYCP 1QN6A 1YTFA 3VN5A 2IV8A 4B0AA 4BCXA 4ROEB 1GYUA 1R4XA 1QN8A 1KYDA 3ZHFA 1GYVA 3ASMA 1PCZA 3EIKA 3MNMA 1MP9A 1E42A 1P4UA 5CN1A 1QN9A 1B9KA 5CN2A 3ZY7A 2Z8UA
chains in the Genus database with same CATH superfamily
1K9TA 2WO3B 4Y7MA 3V4VH 1OE3A 3PS6A 3S7GA 1UZ8B 5E1AA 5F6HJ 3HN8A 4HPHA 1MIML 1JTOA 1F56A 2IAAC 2J6WA 3TX4A 3QIBD 1CLOH 4LSQH 1S7RB 2DWYA 5C0BA 1FC2D 4JUTA 5J1TC 2OMUA 4LU5L 4U2ZA 3FN0L 4PLOB 1EFXB 3GINA 5GQBA 2X88A 6TAAA 3BCFA 3CHPA 3MRFB 5IIEA 2FX8H 1G7PA 1IGIL 3POCA 5EO1A 5GS1B 4GAJL 2NY5C 3BKJL 5C0RL 1NCAL 1F86A 3COOA 1ZHNB 4N9GB 2WKOA 4GXFA 4P2YA 4IIZA 4BKLA 4DVBA 1GPOH 4KZEH 4JHWL 4IDJH 1QACA 3OLPA 5D2NA 2KS0A 1D7FA 3JT0A 5AW1B 1HHHB 5D1QB 2KBGA 3VDAA 4C7PA 1OB1B 2WVUA 3W1ZA 4EAEA 1M3JA 4DGIL 3UTZA 4X0NA 4FQLH 3NCFB 4P57B 4WCYL 3FO2A 4X9HA 5IYDP 3RFZB 1T5XA 2ZUQC 1WJ3A 5CF3A 3CFCL 1OL0A 1OF2A 2WQVA 4QWWD 5EN2A 5JPMB 1MHEB 4P5RA 5E2JA 1XF2B 2P5WE 4HJ1A 3L9EA 1CF1A 4FMFA 4X6FB 3E7JA 1CFVH 3S5LB 1FG2A 4ESKA 5JLZB 3FONB 3TIEB 1QHPA 2Y7NA 4DVRH 2JI3A 5IQMA 4QI3A 5KVDE 1YEEH 3D33A 2XV3A 1IQDB 3KWWA 1DQIA 1P1VA 2Z92A 3A22A 5C6TH 5H37H 1TYRA 2KQMA 1IAOA 5FW7A 2YPVA 3P0YL 4POUB 2VISB 3TT3L 1C16B 1MIEL 3CQFA 4UYPA 3CFUA 3GI8L 3QG7L 3MDJA 3T8MA 5FA3B 4HCRL 4IKKA 5A40E 1INDL 1UYWH 3UEZA 1SYSA 2H0EA 2X2HA 5L0QB 5IB2A 4NN5B 4S1SH 4XPHH 3D8MA 4QXTB 1ZK5A 2HFTA 2OP4L 2WMPB 1IFGA 3HB3B 1MRDH 3HG5A 1MSPA 3LDBB 1WICA 2AJ3B 5DJYA 1TTCA 4L29B 1OTUC 1FV1B 3NCYS 1E8XA 2M26A 1BOYA 2NNAA 5HYSA 3P3TA 1PX8A 2HJKB 2J4WL 4XWOC 4UU9A 5IF0B 3WFDL 3BUYA 1XMWA 4G6FB 4OUOA 2H5UA 3T77A 2VZTA 1HJBC 1LWRA 4H1LB 3FTSA 3DKHA 3M1BA 4OJCA 4XNZC 5E5MA 2UZXB 3L45A 1XZ0A 4F2ME 5IJKA 1W2KT 5GS2D 2QGDA 5L2KB 3BDYH 3N1FC 2HG5B 3WJJA 2ZAIA 3NEXA 1HAWA 3JYCA 3QHFL 3PP4H 1ACXA 3O3DB 4OH2A 1AC0A 4TNVK 4YE4H 1DJWA 1JMXA 5C08D 2ZG2A 3NSYA 3VSTA 2FJHB 4LIQL 2RCSL 4UI2A 4R97C 1XF4A 3GSQB 2J8UA 5E7FA 3QXAB 5DDHA 3RWHA 2B39A 4HUXA 1NMAH 1WFOA 2FJUB 3C6LB 4K8RC 1O5PA 4D0CB 2PCFB 3MUZ1 5DJ8A 3LRMA 3QCVH 4DWHA 1QO3B 4WWKD 3E6FB 5T5NG 4GT7A 1MFNA 4DERA 3OPZL 4Z78A 4RISL 3DA0A 3WUWB 4FF9A 1LP9B 3JWNC 4DTGL 1TBPA 1QNCA 1I8UA 2IGFH 4XMUA 2K1MA 3EYUH 3N89A 2FJGB 3ZO0A 5F3BB 4WVRA 4N8CH 5DYOB 5IHBA 3TBSA 4KK9D 4HP5A 3ZMRA 1KN4H 1NTDA 3K1DA 4LCIL 3W39A 3CVHH 1KB5B 1FAIH 1F18A 3D5OF 3DDFA 3ZE0E 1C5CL 1FYTD 4P9HL 3P4OB 4K94L 4KJWD 4P05A 4PYHA 3HPLB 2RQEA 4IGBC 1IARB 3HE6D 4PJDF 3BAJA 1NGQL 4N2KA 2X89D 5D8JL 3LNHA 1BHGA 4TN9A 3TBBA 1M7DB 3K74B 4LVHC 5GJTH 4HOMA 5JXAL 4FE9A 3QZOA 1QYGH 3W38A 3HMXH 3NTCL 3EHBC 4JRLA 1FSKB 3LKNA 4HUUA 1L9SA 3FCSB 3ZYOA 4PAZA 4R4FL 4MZIA 1QSEA 2ADFH 4AEFA 5FF6B 3C6EA 4PJEB 1P7QB 2P5EA 4YHML 5G4NA 3RFRA 1J1XL 4WSKA 1CQKA 3AS1A 4DH2A 4QRAA 2ZXWB 3CQQA 5FKPB 4NJ9H 3BN9D 3KPRB 1N6VA 1MJ7H 3MXVH 2G3NA 4ORGB 5DK0B 4R7LA 5A2FA 2MTPA 1I1CA 4LCUB 4XVJL 1EBMA 2IBGA 4WFGD 2EIJB 2EDWA 4BWTA 3LKQB 4EJ1C 5GGUA 2QPFA 4WUUA 1RV6X 4QHMA 2V2WB 1A4JA 4IKJA 4MHHG 1EZUA 4XNDA 4K71B 4XC3L 3OXSB 1NBZA 2BP8B 4ZUVB 4A38A 5JNYB 1OAKL 1PAMA 3AJ7A 3FQNA 4ZMZA 2KI6A 3KYOA 4L8SB 3VXPB 4GUCA 4A63A 1T2QL 4TPRH 3QUYD 1PLGH 1WUNT 1QI4A 3S9DB 2YAPA 1B9ZA 1BYOA 2JCCA 3HS0C 4NXSA 1E50A 1FNAA 3CXFA 3ZKXB 1G1OA 1R3JA 3DK0A 5EC1B 3HC4H 5GRYA 3O2WL 2BIIA 3PGCB 3T4NA 1HX0A 5FC9A 2FSDA 3EDDA 1WIOA 3FTZA 3GEWB 4NQXB 5HXMA 5DJCB 5DZVA 3SDCC 4H7VA 1PG7X 2AP2A 1F3RB 4S0TD 4XCCH 3WHXA 2YN5A 1N18A 1NMBH 2B8OT 4K0OA 5ERWB 1JNHA 1WHPA 2EDXA 2I25N 1BBJB 3DMMD 1CTNA 4MA8L 2CO6A 5I6XC 5CP3H 3BPNC 2EXYC 4Z1PA 1HESA 2R83A 4KX8A 1SPDA 4IMLA 4YDZA 2Q10A 3I6SA 3IMSA 4WU5B 4MA7H 2NMSA 3SDAC 5K9JH 2NY4D 1FFNA 3BYYA 2UVFA 3HC3L 3US9A 3FQUB 2G3MA 2ROYA 2PYEA 4PJIE 2OMYA 1J5OL 2X6VA 1T21B 1HH6A 1NJ9B 2NY5L 4ODSH 4QNPF 2WNGA 4RETB 3MUJA 3QUKB 2A0LC 4FQXC 2R2HA 2R29A 2XQBH 3WJLC 2DICA 5D96B 5FPIA 4NRZB 3LQZB 5E56A 1HCZA 2ITEA 2BOBA 5JQ6L 1QUNA 3TPKA 3MRJA 4GFXA 4S1RL 2VXSL 1JF5A 3MO1B 1EIBA 1JWSB 1U8MB 1ZVNA 2B1HL 3QI9C 4JFOA 4L4VB 1E3FA 1E6JL 2MSPA 5LHDA 5FFGA 1ZA6B 4EVNA 3DDGA 4RGNC 2CRIA 2WBJA 5HDOA 2H9GA 3FOLA 2EO7A 3WIIH 1NCWH 1U8JB 2O1AA 4ONHB 1CGWA 2VDLB 2NZIA 1D5ZB 2ZKYA 3L5IA 3MJ9L 3MRIB 3DYMA 4R4BB 4KDWA 2E5EA 2IIJA 2VAAA 3MREA 5KTEL 4QDGA 1VFAA 1WWAX 1AC6A 4L4TB 4EI5C 4PRDA 5T1MB 5I8CB 4B0MB 4Q56A 3CWUA 1OANA 1YY8A 2NX5A 4FFYH 4NC1C 3CX5K 3QYCA 5JW5A 3ZT7A 1CGSH 3QUGA 5JHDA 2FRGP 1FAKT 1DEEA 1KCKA 2EDTA 1KY7A 3GSVB 3QORD 4WFFD 5JDSA 4UM8B 1DQDL 4KTDH 4ZW6A 3QPKA 1CDYA 1KPUA 4MD4A 5T1LB 3VXSB 3RAJL 1Q9UA 2BOCA 1HIMH 4IS6A 2IQ9H 5C07D 1HQRB 3BWUF 3GIZL 1Y6MR 2XN2A 4IOSD 4N8UA 3TWCL 3BAEH 4MXVE 1WFJA 5HHMD 3IYLW 5C0BE 1KIPA 4WNSA 2DTML 4OKDA 3PPSA 2ZWYA 4LSPH 2J56A 3F62A 3NJVA 5CP7A 5F1IA 5ACLA 4K7PL 4AG4H 5ISZB 4QY8A 2C4FT 5LGHL 3EOBB 3QZPA 1JZ3A 2X5PA 3QK0A 1T3FB 5AUMB 1C47A 1KIRA 3WMPA 3BWSA 2XX0A 3QCUL 4XVUC 2FKFA 4OIBA 4Z95H 1JUFB 4BZ2L 3CLFL 4PWKA 3WFCL 2ZWZA 2OMTB 3GXMA 2E7MA 3GSNL 3RDTB 4TVPH 2OMBA 2FCBA 4WSGA 4PJ8D 4L3EE 5E2VH 5I75B 1E4WH 2V8LA 3F84A 1UURA 4OCXL 1JRHI 4YPJA 3SGKA 3OAUH 2E7LC 1J3MA 5JMOC 4PBVC 4QRTA 2UVEA 1KXQE 4GQQA 3UROR 1PYWB 3OMZA 3RBSA 3TBWA 1L6PA 5IW1B 1G1KA 3JVGC 3IFPB 4ZFZB 3UBGA 1ZD6A 1VACA 2NY0C 5DVLA 4BQBA 3GHPA 3OR7A 5TQ0L 4ZFGL 4FXGB 4U1GB 1F41A 4FXLA 2QFPA 1Q0YH 4WV1C 4F1ZA 4F57L 3CU1A 4FCAA 4BXVA 3LKOA 3RILA 4G7SB 2NT0A 4FYTA 3AREA 5KS9B 2O5ZL 2VMEA 3PAVA 1I3RB 1ZHLB 1PD6A 2WWMC 4KHXL 3NJFA 3T5WA 2ZUUA 4XNMA 2CXKA 4K8RL 1FFPA 2XG5B 3I6LE 2ZCLL 3T0EA 4XZUB 3ULVE 4FG6D 1PNCA 1AZCA 2UZIL 1SJMA 2ZXEB 4ES8A 2XZQL 1S5HA 3VXRD 4HIJA 5HYSG 5C2UB 1W0VB 1F1DA 4Z23A 5ADPL 4RZCB 1JWMB 3ZHDA 3L4ZA 3JV0A 2GEEA 4PD4J 5AW8B 3DHPA 4PJFA 3EYSL 2QHRL 2DRUA 4UQ2B 4W9JC 1YN6B 3ZYIA 3EOYG 1LK3H 3MA9L 1P6FA 5IROC 4G43A 2VO5A 1H3VA 2QDVA 4JM4L 4WKZA 5JDJA 1R34A 1OEZW 5F8RC 3SCMB 3TWYA 2DLTA 5CU5A 4AJYV 2FWOB 3NCWA 3H9SB 4I85A 5E5RB 3WL9B 4YAQB 3B7RL 3U0WL 3KGTA 1CLVA 2FZ3B 3TO4C 3OSKA 4YNYA 1JXJA 3BUIA 5CBAA 4TSCL 3SQOH 5D1ZC 1KV3A 1U33A 2P1YA 1Z9SA 3NIFB 1FNSL 2KKQA 4DGYH 1P6WA 4HK0A 2A2QT 2YUXA 1GRWA 3ALXA 4KO6A 5FOBB 1KFQA 3BRFA 4NC2B 3PAYA 1JFIC 4JQIL 4HD9A 1O0VA 3C8KB 1NOFA 4OVVA 1F6FB 2ZKHL 4ORZC 3OSMA 2YLHA 3FQ2A 5GRJH 1I85A 1YTBA 3H42H 1U92A 2G5RA 1QSFB 1XGTB 1M7XA 2Y1ZA 3L3HA 3BVXA 5EU6B 1F00I 1PF3A 1S46A 4DN4L 1T0NB 2CLRB 4OIAA 2XA8H 4IRSD 4YHIB 2RH0A 4R7XA 3MRLB 1NIFA 5I9QB 4M1DL 2X4PB 2YD9A 5A3IC 4QF1B 3VU1A 4QGYA 4NM4H 4N2OA 5FCUL 3UP6A 2DY2A 4R8WH 3JV6A 3F00A 1E8ZA 2FWUA 3VXME 1G7LB 3U4AA 1IM3A 2XU9A 3H85A 3GMQB 4AC4A 4QMEA 4PHXA 1QI3A 1X7QB 5E6UB 2Z1PA 4J39A 3TH4T 1CDIA 4POZC 4AM0B 3LV3A 1YMME 4NWUL 2FGWL 1LO2L 2DS4A 4FMKA 4WFEE 3S37X 3ZDYE 3OB8A 3MA7B 1BLIA 4I7ZC 4JPIA 2SODB 3MU3A 4FS0A 1QP1A 1I7ZA 4F20A 3O3EA 3SDDA 3NA9H 2EE3A 1NAKH 3UZEC 2QQNH 3CMOH 2LTQB 3U7WL 1ZGLA 2O6PA 3TF7C 5EULV 3ZKMC 2Q3ZA 5FB8A 2OMXB 2GJZB 5CGBA 2J57A 3HJ0A 5KW9H 3BQUC 1NC2B 5KSUA 1WWCA 1CICC 3O3BA 1NCTA 3LSOB 4LF3A 4MJIB 4XPGH 3GXTA 4NBZB 3IDGA 3UTPD 3L9RB 3HAEG 2Q8AL 5DI8A 5CJXA 4Q6IA 4HXAH 2B14A 3U82B 3QIBA 2ED7A 3ZIMA 4X42A 4PHZA 3WEAA 5B3SB 4J6RH 5D93B 2QQLH 3CMGA 2V9QA 4HWUA 1F6LL 4XMXA 3OHXB 4YJZL 4TTDC 1ZY9A 2P5EE 3WHE0 3MYZA 4ZMTA 4L8CA 1OAQH 3ARDC 3WN5C 5EUOB 4I9XA 4Y19B 1RUQH 5LXGL 2GPZA 1CE1H 4XNXL 2EDKA 2WB7A 2E74C 3EYVA 2WGXA 2AEIT 4JE4B 3RPKA 4B50A 2F68X 3ZLQC 4MA1C 4WZSD 5E6SB 3QPXH 3WBDA 4KUZH 1JPFB 2CBOA 2X53A 3MOBL 5J1AA 3KTUA 5AENA 1HHJB 2YD0A 5JZ7D 1OKEA 4KBPA 3PDOA 3ECBB 2WQSA 3MRPA 4XH2B 4UAOB 4JDEB 5DEFA 4KJYB 4DKAA 3MX0B 5KYYB 4FFWC 5CAYB 3KPSD 5JUEH 2IFFL 3HKFA 1GCYA 1MCEA 4OFYD 2EVGA 1NPNA 2AERT 5BCAA 2MOGA 2C5DC 2L8AA 2YS4A 3DGDA 3MVSA 5SWZD 5J3HD 4DP1X 1GCFA 1FIEA 3ZR5A 2FD6L 2VLME 5IUCA 1QRKA 4YDIH 5C0FB 2FSEB 2R9HD 5FYKH 4MX7B 2JTYA 1NQBA 3KGUA 1QBML 2N59A 4JDZB 4HIHA 1BZ7A 5DEZA 3B9KD 3FUIA 1ZVHA 3OKLA 4LSVL 4ZX6A 1A1NA 2FBOJ 3LEXB 4KO9A 3X12A 3QUZB 4EJZA 1QBAA 3Q5OA 3WTVA 1TVBA 5J6SA 2I5WA 3FTYA 5JW3L 1E9PA 5A2AA 5I1AB 3C08L 4NX0A 2FR4A 5IMOA 2XIIA 2BNRD 3D7PA 2JSFA 5C2BH 1H3TA 5AL8A 1AHMA 1J1OL 4UUJA 1O6TA 3WXVL 1U3HD 4BH7A 5AALA 4H0HB 3SPJA 3MRKA 3HG0A 4YLBA 1OGAA 1YEDA 1G9NC 3L16A 3OZ9L 4AKPA 3PUCA 4WZ9A 5IHZB 4H8WC 2C3VA 1YNLL 5IBUG 1MP9A 3RVTD 4LFHG 1DYZA 4U3SA 1YC8A 3IJSB 2F1AA 4ABQA 1MW0A 2P5WB 5JHLA 3QDMB 2CAKA 4GSRA 4CW1A 1EJOH 4XN1A 5HI3C 1T0MA 1DIZA 2VDKH 4LPVA 5F7FA 5ID0B 4FG4A 1AOZA 1RFDH 5DHVA 2DLIA 4Z77B 1ZSDB 2A3TA 4JDVB 2ZSVB 4XWGH 4OM1L 4EF3A 1K5NB 4CAGA 3NCEB 5AOIA 1AZBA 1PZCA 2EDRA 5FXCH 3I85A 1KGCD 4YSUA 2I9TB 3SYCA 2JIXB 1PPIA 3DRQA 4Y4FC 4KJQC 2IOMA 4GRWB 4C83A 2XV2A 3S48A 1CS6A 4G2AA 1NGMA 4A7QA 3GRWH 5D7JC 1U95B 4M6ML 2AK4E 2CG9X 1YPZA 2X9XA 2XG4B 3MBEB 4HXBL 3VWJD 4LCWE 3U9WA 2AGJL 1IAIM 1MHHA 3KMDA 3ECWA 1K8DB 3V0VB 3LAFA 1WBYA 4NZRH 1DUZB 4NZFA 3VFWB 2BJMH 4PV9A 1XR8B 3CC1A 2BNUA 3QFJE 4M4PA 4WHYH 1TUPA 1FZMA 4KJPC 1LILA 4RWYL 4LEOB 4WW2F 1WZLA 3GD1C 4FMVA 4K23L 1H8LA 4JFYB 4X98A 1G7MA 3U79A 4XMZA 4U6YA 3KVDD 4MMXC 3QEQD 1DN0B 1QLFB 4G7VL 2NX5E 1FO0H 2XWRA 1WZMA 5FO8B 2RB8A 5KWYC 1VIWA 2DWEB 4OKVB 4GKZA 1MCPH 2C9QA 5JHDE 4LDCA 5MENA 1XFPA 3KCWA 3W82A 3RU8L 2MNUA 3MRQB 3LYRA 1O9VA 2BHZA 2OZ4L 1K3ZA 4TVUA 4R5TA 3V9FA 4A2GA 3CZNA 1JD7A 3NIGE 3IGAA 5E99H 5EEYA 3FFDA 5FK9A 4YDNA 2QMKA 1EEQA 3VFUB 4FP8H 3HN3A 4PGCB 5GGRA 1P5DX 1FHNA 5HHXL 4L3CA 3LD8B 4AEHL 1QUPA 3G9VA 4OB5H 3S4SG 2B1AH 4HJJH 5EIIB 1G9MH 1VAHA 4ZT1A 1RLWA 2HVJA 2J20A 3GUFA 3KPPA 5D7IF 4AVJA 1JTTA 3GSUB 3V2AR 1E9OB 3N91A 1PLBA 3ORJA 3KM1A 3FTGA 4PJCB 1K8IA 3QC6X 2NY1B 2A9MH 1AGCA 1F58L 1MCWM 2J25A 4X6BA 3QEGH 3AS2A 3KPQB 2FLBT 12E8H 4MMYB 2VL5A 1KTLB 5JXED 4PW9A 3TCLA 1M05A 2BOLA 1WTGT 4HLZG 2IH1A 5ICXB 4Y88A 4QO1A 3HE6A 4F33B 5HGHB 1DBMH 1EA9C 2X89A 1Q0XH 2VLKD 4LOFA 5FO2A 4OD1H 4OFPA 4NYLA 4G7YL 2FBJH 5DVMA 4PJHB 4MFHA 2ZP8A 3C8DA 3IDMB 2BNQD 2HFGL 1ZXQA 3OMAB 3VWKD 1B6UA 3LRSA 1TO5A 2WLKA 1CDGA 5K9KA 2C7FA 3BP7B 4ZI8A 3W5NA 2WO2B 1YQVL 1P1ZA 1WD9A 3BE1H 3DHUA 1E42A 1KJ2L 1JCVA 4GXVL 5CN1A 1JWUB 4NQCA 1ZJBA 1MKFA 2Y7LA 3LIZH 4XP6H 5CEZL 1NSNH 2NCEA 1NUGA 1FF5A 4S0SD 2XLLA 2MFNA 4FQ1H 4P2OB 4AIZA 1JJUA 3VXOB 2IAMC 1UM4H 2X6MA 3D39D 3ILEA 3QNZB 4LLMB 4ELMB 4OF0A 4BE5A 4JFWA 5C0AA 4EIUA 3S97C 5FX3A 3T0EE 2GQHA 3GMLB 1WJWA 5IQNA 3O6FB 5IZ7A 1MI5D 1RURH 5E9DD 4FI7A 4M48H 3FU6A 4KK5D 1S8DB 2EYRA 3RIFF 1TVHA 2IOOA 1DO6A 3HW7A 1OTUD 3MV01 1HEZB 3FO0H 3S35H 5AZEL 3Q1SH 3OWEA 4JANB 3ESMA 4K5NA 2J6EL 2ZT9C 3M7FB 3MYJA 5GS1C 3ZRFC 3VCLB 5DLML 4YK4B 4Y9FA 4XE0A 4RAUB 4N6RA 4LLQA 1RZIA 1YO4A 5TJWK 5DSCA 2P8PB 2WUCH 3L48A 3QUYA 3V0IA 1JPGB 1IGTB 1KYUA 2XKNA 5J9PA 2XWBB 5KOMC 3VSQA 2NOFA 3HHSB 4OFVA 2ICEB 1FNEB 4XGZB 1G43A 2DD8L 3UCQA 1KUMA 1J1PH 2MCPH 4GQRA 4OBRA 3VO0A 4MAUL 4KX7A 3BP5B 3M7OA 5B1KA 5GS0H 5IQ9A 2X6AA 4J28A 5EWIH 1NDMB 2DQJH 1J8HD 3Q6FA 3FBKA 4M4RB 5IQ7L 5INCA 5E7BA 5ICYB 3K72B 2BCKA 3DMMA 5CSZA 3GUTA 1QTPA 3IJ9A 4A04A 3RFZC 1MG3C 5KVFE 2OJEA 2FBRA 2P28B 4V11A 4HCGA 3H7BA 2V9RA 3FO1B 5JPMC 5E8OB 4K8RD 1SDYA 4HJ0D 3ECVA 5F9JB 4NLHA 3RVWC 4L8DB 1VRSA 2VZ3A 4OJAA 1C7TA 1A65A 1IKNA 5IESL 3O2VH 5FHAH 4KKPA 1ES0A 1GYUA 3HNTH 4DKFL 1RJCA 1HEHC 5EF3A 2PN5A 3WKML 1X5MA 3VGHA 4MDJB 3GMOB 1SQMA 2DLHA 2W94A 1Y7VA 1LO4H 4ODUA 4OD2B 3VDBA 5GRUH 2RFXB 3V0JA 1DQLH 3UJJH 3B5TA 1D7DA 1UM5H 1UZ6F 1A14H 4NS0A 3WJMA 5L0QC 4NN5C 1QEWB 5F88B 5GRZA 4RIRB 4IGBD 4L9DA 1NOAA 3F7RA 3SE8H 3LDBC 3VG0L 5TQ2H 2QDWA 1GMEA 3ZDXE 1DZ0A 1NANI 1WC7B 4Y5YB 3CDGB 5K9OB 5B39G 4P23B 3OGDA 1CXLA 2GT9B 5J89A 1JRHH 1MAML 3L7EB 1UD2A 4IJ3C 4HAFA 4KGJA 4R7VA 4WHTB 3SY0A 2FEEI 3BWZA 2BVPA 2IALB 3REVA 4ROCB 1DEDA 2Y0SA 2K45A 5T1DL 1XGYH 4LDEB 4MS8D 3NMEA 2AI0L 5T33H 5KBNC 1NGXB 3P0VH 4GUPB 7PAZA 1MCCA 3X3FL 4PUBH 4NO3B 3ZX1A 4BFJA 3QQXA 5FM4A 3QORA 2Y23A 3QO1B 1GC1H 2WN2A 4G80B 3B6SB 3E6HA 1DJYA 5BMFL 4M3HA 2RMNA 1DQQA 5DHYB 1MCNA 4L1LA 5JYLA 1UT2A 1FBIH 4NQSA 4P5MA 5GGRY 5C07A 4QR7A 2NW2A 3OLGA 2DQTH 5DRNB 3DETD 4JFFE 3UXFA 3S98A 2HG0A 2HRLA 3D4GA 4PJGB 3L2MA 4TLKA 5ANHA 2NUTA 3O4LA 1WFNA 2KERA 3AG4B 1G9NL 3IK2A 3U9PH 2N7BA 4LSUH 4N3UA 1XB8A 4H8WL 4X7DC 3ARRA 1JPSL 1LDSA 1UQSA 3ZGHA 1QVOA 4KXCA 3QWRA 1KC5H 1A21A 2R1WA 3FKUS 4PJAF 4MJ5B 2WV3A 4Y8AA 5DC4B 4HOXA 3AAZA 3O6LH 4ABVA 5ANMA 2VSDA 3D4VA 2J5LB 4PIRF 4QXGL 1E28A 4W9IC 3U83A 4ZODA 2EE0A 3C6LC 4J2QA 4IMKA 5TE6L 3L1OH 4F58H 1RULL 4U1MA 5DUMH 5HGBB 3E38A 1HS6A 4NOFA 1BDYA 4NPYB 4PJ8A 5TDOB 4WY7L 1BM3L 3DK2A 5LBSL 1M3QA 3EO1A 2X4TB 4G8EA 2CCWA 3JZ7A 5IVXA 1FL6A 2ZXDA 3GSWB 3V5DB 5JORB 1FJ1B 3PJNA 2VZUA 4QYAA 2VXVL 1HL8A 2VRKA 2X4QB 3NIDF 1R9FA 3BZEA 3BRDA 2OR8A 3MMEA 3EF4A 4I0CC 1D5MB 4LDOB 3EYQC 2MCG1 1C5BL 3IETB 4QTHB 4MJHA 3SQBA 2H4LX 1DN2A 1BVNT 2OTUA 1F6AB 1HHKA 2E7CA 3MLPA 5KJRH 1LEIB 5EU5B 4BCZA 4ADIA 1NAMH 4N8VB 1O7DC 4KK8C 3K6NA 4ZX4A 1GOHA 3DX6B 4AQ8A 2FJFA 2FWSA 1KIQB 4UTAL 3SDAD 3Q2VA 1FSKC 4R7NA 4ETQB 1WAAE 3A67H 3F5WA 4UQ3A 3BVNA 2FX9H 4Q7DA 2D31A 4WXAA 2D7TL 1R5WB 1SVZA 4N0YL 2CKBA 2FDBP 2AXGA 4Y5VB 2AEOA 3STLB 5EV7A 2A0LD 1DSWA 4FQXD 4KNSA 3S3JA 3MUUA 4HS8L 3TCXA 1ZA3B 2JHJA 5IKCA 1ICTA 1I9RH 1QTYT 5FA4B 2E9JA 1A6AA 4NQDD 1V3KA 4IK6A 4M7LT 2J8HA 4J8RA 2EH7H 2QPEB 1GTNA 4RDBA 4MXWH 5AW2B 1DVZA 6FABL 4AI7A 4QHUA 2FATL 4ZD3L 1BMWA 3FT3B 4HSCX 1T4WA 3DOSA 4RGND 4QHLA 3GLZA 3DSFL 1ETA1 1NFDB 2A7BA 1A6TB 3AITA 3P3YA 4N5ED 4LGSB 1OP5K 4PW3A 1J0ZA 5AVTB 2O5NA 2X6BA 2EEDA 2N0MA 2DBLL 2JFCA 3PQYB 4HWNA 5DD1L 2QZQA 4K71C 4X8GA 1ONQB 4M03A 3A3YB 2V17L 2VM3A 3RGBA 5DK2B 3G7TA 5KG9A 1JXDA 3GB7A 4L8SC 4BK4A 2YQ2A 3L4WA 2YRPA 1NWOA 5E70A 1JMZA 3I02A 2XN1A 4YXLL 4LLWB 3L2LA 3KXFD 5TGBA 1XWVA 2C3XA 3VYNA 1HK6A 1T5WA 2DKMA 4J3UA 2AC0A 2OTWB 5C08E 1RJYA 4FLHA 4HKXA 3ZKXC 2VYRE 2AMUA 3CBKB 4TNWK 4XMPH 3FUHA 5LXVA 4MCZA 1F2XK 4XCEA 3TJHC 4RMVA 3FYIB 3MLUL 2Z91A 4Z18A 4OT1H 2XXGA 1KENH 3U1SH 3D34A 2Q8BL 4PREA 4LKCB 4HT1L 3ZYJA 4I18A 1HFUA 5I5RA 1CXEA 2VMCA 4NNXB 1YQ2A 1U8HA 3WE6B 5DQ9A 3A6CL 2OQJA 3Q13A 4HKJB 4DKTA 4XB3A 1BPVA 1KT2A 4G9FE 5EPCA 1RK7A 5T3XL 1Y0LA 3D25A 3L5WA 4AMXA 4P2QB 3E8UL 2ZNXA 1R0AL 2IPTL 2G9HB 1JV5A 2Y3AA 1FPTL 2DYPA 4ZXBC 1C8PA 1VHPA 3GJFK 1JK8A 3ZSTA 4QLRA 2R4SH 1UWXH 4FXKC 1AD9B 2WSDA 5D96C 2NCMA 3G6AA 1U93B 2AXJA 5I17B 4F9PA 3V8CA 2HT3C 1FYTE 3KNBB 2XNAB 2MPAL 5F96H 1QRND 1G6RH 1MCKA 4FNSA 2NY0D 2ZUWA 1IE4A 4P2RD 1RIHL 4ZPVA 1SFDA 3O11A 4IRJB 1N4XL 4BUQA 5E95B 4NFDA 1F4WL 2WB1A 4YBLC 4MJ4A 4BINA 2F53E 4YZWA 1WO2A 3V6ZB 2I7OA 4ZTPL 3IAPA 2WWMD 1UH3A 3A6OA 3RX8A 4C4BA 3JWDH 2QKSA 2A1WH 3L5XL 3BEVB 1DFBH 2YK1H 3K4DA 3V9EA 5JW4N 4U6VH 5I8OL 2BM3A 1MQKL 3KPMA 4KK6C 1UA7A 4YBHA 1BYPA 5IWLC 1SDDB 3FTUA 3V0WH 3P4MB 5CINH 3ILDA 4ACTA 1MFDH 3K8LA 1M1SA 4UDUB 2JJUA 2L4OA 1FZJB 1LMKA 1EPFA 5H37A 5IROD 2ZTBA 2EAEA 2WKLA 4QRRD 4YHLL 2Z8RA 2CA4A 3C5ZB 4KAQL 4MDIA 5I8EA 1AS8A 2B08A 2EC8A 3TBCA 5EF1A 4WFGE 4OQ1A 5AVRB 1S9XB 4CJ0A 2V7HA 5M95B 2DL2A 5D1ZD 4NRYB 5F7EL 1OAUL 3IDUA 1Q1JH 1GGBH 4PCYA 4X99B 3BIBX 5EFIA 2FYVA 2TRHA 3F05A 2VKXA 1QD0A 1IC7H 3VD1A 4Q14A 1AAJA 2WTRB 4FQQA 2YUVA 4KZCA 4I2XA 5DD6B 5EO0A 1HINH 2BS8A 3E9UA 3OHMB 4H88L 4QXUL 5E8PB 1JN6B 1RUAH 1GYWA 2DLFL 3G5VB 2EZ0C 4JQXA 1CFNA 2VDNL 2D7OA 4W6YB 4HZLA 3RDTC 5K9QI 4TRPH 2O3OA 2MMXA 2CGRL 4MZ3A 5I75C 3B9KA 3QQDB 1JNJA 5EU3A 4HFWA 4FX5A 3APDA 3VFVA 3P3SA 5DJ2A 2G5BA 2CJUL 2H2PC 4KV5F 1AXIB 2EVJA 2LHAA 1NFIA 1KOAA 1YTFA 4PJDA 4OIIL 3WN5A 5IOPB 1JI1A 1FYHB 2EDDA 4NP4L 1HHGB 4PJ9B 5CEZD 2BNRA 2XICA 1NWPA 1THCA 3KCPA 5C09B 5A3ID 4E41D 1NLDH 4FXGC 4OM0H 4U1GC 5GGSA 5I0DA 4QRQB 3D1MC 4HUKB 1HZHL 1CU4H 2WUBH 5HDWA 3INUH 4YS4A 2BSRB 3F12B 3O45A 3TT1L 4JO1H 4KO5A 4GKLA 5F7LB 4JFDD 2AFNA 1RZGA 5C3TA 2C1OA 2FL5A 1LM8V 3MRRA 4PLKC 4PS4H 4PB9L 2VSMB 3FRPA 1KJ3L 3II3A 3QDGA 4UT7H 1IL1B 2GTWA 4POZD 3GT6A 4U1JA 1NCDH 3OKEA 1P5UB 4KDTA 4ZQKB 4KZ0A 3CBJB 4ONGL 2XTJB 4S2SA 3B9AA 5JTWA 3MLRL 4LP4A 1OCWH 2DBJA 3DVNA 4ZX5A 2PO6B 1XGQB 4NI3A 4P2AA 2CCLA 3MRDB 1GYAA 1ZS8B 3PFUA 5ECJE 1OAZL 1N5YL 4JG0L 3VWJA 4AIOA 2PW2A 3SCMC 4KGLA 1VENA 3FB5B 4ZSOB 4TTGA 5FGBC 5IM7B 2OW7A 1QTSA 5FO7B 5ALCH 5F7HA 1KB5L 4M5ZH 4F7PB 5AYTA 1GY1A 1MCBA 2QV4A 3BDXA 5LCVL 3ZDZE 3V6OE 4WFHD 1CICD 2ZCKL 4I13B 4PRAB 3R7RA 2Q7AA 1YDPB 4G8GD 2IH3A 1HN1A 1V8HA 5IOKA 3U4EB 3ZO9A 3RHWK 4JKMA 2AJUL 4M8VA 1CIDA 1OAJA 4YSOA 2YFNA 5IT2H 4XOCA 3IS1X 1BMGA 4NP9A 3V4VL 4GT0A 4D7QA 4ENZA 1FP5A 5I1EH 5CU9A 4X83A 1X3DA 4AZ8A 1T0OA 5BV7C 1EEZA 5I76A 5EOCH 4LSQL 5C07E 1QNBA 2PTUA 4LCWB 2VM4A 3SKNA 3DOHA 4ANWA 4V2BA 1YNTF 3VAEA 4P49A 5HHME 3VI4E 3FSVA 1PG7H 1HKFA 4IIQC 4NNPL 4D0DB 3QFJB 4ADJA 1MW1A 3DPBA 2E7BA 5I9QC 5IYBP 1G7JB 1ET7A 1PKQB 2Q2EB 4F3FB 5L2JA 4R3SB 4JZOA 1SJEA 3VGBA 4ZZKA 3FF8A 1LLAA 3MKKA 3IB4A 2XQYK 3TYFA 1M1XA 1GPOL 4IDJL 2KLRA 4JDTH 4ERSL 4LARH 3QJSB 1ED3B 5JXEA 2EDLA 4S1QH 3TBVB 3IJ8A 3VI3B 3W9DA 3ETTA 4Q89A 3M07A 3U7YL 3BAWA 2NXYC 4F7MA 1O7SA 2K7PA 3G08B 4YHZH 2H2SC 1RP9A 4N1HB 1FL3A 4X6CF 3ZL4H 2APXA 5IR1A 5C9KA 2A9AA 5HPMB 2YBGA 4P5TD 3SKMB 2WIMA 5HYJB 1XD0A 3WTSA 1LO0L 2BNQA 3CFDB 3LN5A 3ABKB 3VWKA 1FFOB 1JHTA 1E0OB 4JKLA 4YC2C 2KPWA 3V6FA 1RZJH 2DQFB 4M7ZB 2LTQC 4PJXF 3FT4A 4M6OH 3HRPA 3NSDA 5CGMA 5ICZB 1FL5B 3PCYA 1CFVL 5IJVA 2NYZA 5DZNA 5G55A 1E5CA 4N85A 3MGTB 1CMOA 2AQSA 5A2IH 3D39A 4HAGA 2LU5A 4U1IB 5GS0D 4BFGA 1KTDB 5C6TL 2IOIA 1KPRB 4RLDA 4MHHI 2FX7L 2GITA 2O26U 3KD4A 1JGUH 1L0YA 5IMMB 3VXRE 1CI3M 4MMZA 2WQ8A 1NGYB 5CP3A 5E9DA 4U33A 1B2YA 3LMJH 3FB6B 1U2CA 3PUUA 5D93C 3K91A 1AP2A 2BP0B 1MCJA 3OHXC 3P3RA 1UYWL 4HKBB 5BVPL 4P48A 3P11H 3WSQH 3BVVA 1NCCH 3QWOB 5D6CA 1DZBA 3GXUB 3LZRA 4RMQA 2LU4A 5AOMA 2EIKB 3SYPA 1TEGA 2GI7A 2VW4A 3F7VA 1RH8A 5TH2A 4TNGA 3BH4A 5DJZB 4QOKE 4QPEA 3T0XA 4KJQD 1OGTB 2DPKA 4FG0A 2OMWB 1MJJA 4DEWA 5D7JD 3QCTH 5I30L 2X7LA 4OFDA 3MZTA 1N0LA 3S2AA 1GGCL 4CVWA 3HNVL 2BO0A 4J7RA 1D7CA 4NHCH 4UAOC 4GO8A 4MSWA 1NANH 2IXQA 5DD0H 3V5HB 4OZIB 4JM2B 4KJPD 1ZANH 5IFAL 3V8OA 5D1XB 2VDLL 2Y1YA 1QFOA 5CZRA 3BZ4B 2F8XC 1J8HA 5HPOA 3EDEA 3OC3C 3PP4L 2XXCB 3NCXA 4NZTH 5GGSY 3DX8A 1WA0X 3FO9A 4YE4L 2OULB 1ETZA 1NZRA 1MDAA 1SMDA 2C26A 1I7RA 1ZWIA 5HVHB 4CSTA 5I0VA 4OI7A 3LRKA 3QRGH 3CN1A 1NH6A 2CBQA 3HHRB 4ZUWA 1G5AA 2H5AX 3SN6N 2JQAA 1IGCL 2FO4A 2MEJB 4Y2DC 3E2HC 4CMMA 3QUZC 2IAND 2EINB 1BQHG 3M6DA 3OQRA 3N41B 4RBPH 2VH5L 2H6PB 1ZT1B 3QCVL 5C3IA 5HBBA 2J88H 2A99A 2QTEA 1ZT7B 4AYFB 3BGFC 4HWZB 2VWEE 4NO0D 4R96B 2YXMA 4WEEA 2COQA 2YPLE 4OCRH 3N43F 2M83A 1UXLA 1TJMA 5CIPA 1RK1A 3EYUL 4FLSA 3I6KB 3MNVB 4TOYH 5JOFB 3S6CA 4NKIL 3GMPA 4BA0A 1CIUA 1XCTB 2ZSWA 4A6YH 4N8CL 1NDTA 4PRNA 1NUFA 4NLAA 1I8MA 4AL8H 3MRMB 5CR1A 3TBTB 2YGOA 5GGTH 3CVHL 3CDZB 2FGTA 2F2HA 3D08A 4GMSL 5I1HH 3FU8A 5D5MB 4MZRA 1RAMA 2VB5A 3NBNA 1M3IA 1K4CB 1MLBA 2YWYA 2OXGB 4LPYA 3RWCA 3IJHB 1OZUA 1CGUA 1T66C 5E2WL 2XVBA 4QTIH 2D03H 2YKKA 1IGMH 3IRZA 1QYGL 3MBEC 3HMXL 4AVHA 4NPKA 2BZ7A 2R4RL 1I8IB 4G8FB 3UTPE 4AOFA 4LIQE 4E0RB 1SVCP 4M6NH 1HU8A 4KXAA 4X7FC 4I3RH 2HFFA 2IAMD 3GTVA 1EEUA 5DXWA 4BK5C 2O6DA 4XBGB 4OLZL 2WANA 4WJ5A 4C59B 3G6JB 3ZDXB 2DWDA 4P3CL 4U0RB 4WW1B 5T3ZD 2WYTA 5D9SB 3P9LA 5F1OB 3CX5J 4NJ9L 5MEQB 3V4PH 5T3XD 1W80A 3MXVL 1MJ7L 2WK2A 4PR5B 3W2DH 3B2DC 4YGVA 1EFXD 3X11B 4R0LC 4YDLB 5GGVL 3MLYH 1BFVH 2VR8A 3FXIC 1OK0A 1JG9A 4WTXA 4FYRA 8PAZA 4OIFA 3QIUB 4YPGA 4APXA 1CXFA 2X4OA 2Y2TA 4HISA 4OTXH 4RMRA 5I6MA 2VN6A 3OJVC 3LD8C 3V0AC 3TE5A 5I0ZA 3CSYA 1OT4A 3S88H 3D30A 4HWBA 4MD5B 3KPSE 4P4KB 4JFFB 4MAZA 1DSFL 1EO5A 5AWNH 3VG9C 2XWTB 1T03H 4QRPB 4PGDB 3GJFB 5D1QD 1AGDB 1QBLL 1MW2A 2GAZA 4WNQB 3RWEB 2NY1C 5DEJA 1OP4A 2VDPH 4TPRL 5EOQH 2AEWA 4GG6A 5SWZE 4JRYE 4LHJB 2YAOA 5KYNA 4UB0H 1MCRA 5C0CD 1XH3A 1FFQA 4YDJA 5SWQB 3L95B 3S8WA 3S37H 3BH8A 4PG2C 1CJYA 1O9WA 3FQTB 3G5WA 3IFOB 4WI6A 2JLPA 4DP8X 1U42A 2O93L 3D9AH 2A9NL 2QADB 3ABZA 3FU7A 1OAXH 2VR7A 3L3DB 4Z8FH 1NKGA 3LS5L 1RK0A 4NGHL 3FRPG 4RAVA 3N1PC 5IHLB 5KSAA 2QKIB 1GHFL 2VR3A 2FHBA 3FMGL 4CDGC 4R7DA 5BV7L 1D5BA 3RVWD 1IEAA 4G1EA 2QR0A 1VFBB 2OL3B 3VNZA 1II4E 1NINA 4P5KB 4BRJA 4PJBE 4AH2B 3VD2A 4NNYA 1Z9OA 2Q9OA 1DBAL 1QX1A 5JO5A 3UABA 4XXDB 4P99A 1ZLVK 5INDB 4IOIB 4MKMA 1UT7A 1QW9A 1KMGA 4P2OC 4YXHH 2CXGA 4EAGA 2WXIA 4HUVB 4LGRB 1Q1PA 4Y5XB 5DJDB 1E9QA 2XQBL 2XWEA 1RZ7L 2DTSA 1I4FB 1DBBH 2IQAB 2ATAA 4NO5B 2QREA 4NQEB 3N40F 3OL2A 1JHLH 1Q94A 4I9WE 5LAXB 4HJUA 4ZFOA 2V2XA 4TLUA 4TPSA 3RSMA 5KSBA 2Z31B 4U1NB 3BFWA 4JFTA 3O6FC 3PWJA 1HCVA 3FQWA 4JREC 1NGPH 3RRQA 5MERA 3J8F7 1I3UA 3KZ8A 3HB3D 1AGFA 4FABL 5KL0A 1KGCE 2D9CA 1LO5A 3NG5A 3VD5A 3K6DA 4TKWA 2B2XH 3BLBA 1FGNH 3WIIL 4TUKL 3O3AA 1QABA 5EBWA 4NKMB 3VFTA 5AD0B 1V7NH 2IGLA 1S7VA 2VDRB 3NJMA 1DJHA 4G6FD 4HFUH 4NCDA 4W4OC 1UWEL 4PW4A 1E2WA 4XVTH 5I1LA 4PBDA 1IC0A 1RL1A 3KXFA 3NCMA 5BW7A 3BIKB 1Z5LB 3OB0H 2KDGA 4MA3A 3QQ3B 4GNKB 2ICEC 5L2KD 1ZEAH 4FFYL 3PE9A 2GJ6B 2LFGA 3QEQE 2VN5A 1ND0A 3LPWA 1ZCRA 2X09A 1RU9H 2NOLA 2EDHA 5IBTH 4Q97A 3QQ4A 3RZCB 1UZGA 1BIIB 4FFTA 5DMJB 1KCSH 4DZBA 1BQLL 4AV4A 3QB7C 1TMCB 1UOWA 3QJXA 4E36A 4NKDA 1MF2H 4LCVA 4BELD 1KDJA 2G60L 3BAEL 3HG1A 1LNUB 3UW2A 1CLZH 3NPSB 3IGFA 4BFNA 2ITCB 3UTSB 4R90H 1UA3A 3C6LD 2Y5EA 2G2PA 4LSPL 1WRFA 2BW4A 4KTGA 2TRYA 5IYCP 3UGEA 4Z76B 4AG4L 3I0WA 3L3JA 3FB8A 3HE7B 5IFHH 1AQDB 5K33A 1Z5HA 3GPSA 3G5YA 3NABL 1OSYA 2Y06H 1G4RA 3PYCA 4B53A 5KVDH 4DESA 3IFNL 3IMVA 4LLYB 2CDGB 3QG6B 1I8KB 1K5WA 1MUJA 3WD5H 3WEMA 1T1ZA 2YAHA 4OZGF 4XMTA 1E4WL 1FNGA 5ESAA 2ADGB 5IJDC 2VLKE 3OAUL 1X5XA 3CFKB 3HBGA 2R69L 5G4OA 4P2RA 3IS0X 1ZLUK 3K2UL 5AOJA 3QUXB 4OQTA 3RWFA 4MLSA 3SD2A 3DROA 3CVDA 4A7VA 5E51A 3I75A 2BNQE 4WV1A 3KRMA 3BH9A 2DLGA 3GSXA 3QJQB 4Y5YC 2QVIA 3WXWL 2IDTA 1HNFA 3CU7A 4P23C 3WS6A 4GQ9L 2OSYA 1WD8A 3CZFA 2A83A 4BSVB 3ENEA 1LK2B 1KBPA 2OMVB 3BESR 1LD9A 4KRLB 1WT5C 4JRXA 5H94A 4QIRA 3OJDB 4I48A 1TYEB 5FKAA 1QW8A 1CT8A 2EKSA 1FN4B 1HI6A 2H41A 4GG8A 4GBXB 3G5ZA 3A4AA 1P7QD 4X0KB 2X4UB 3QA3B 1J12A 2R7EA 5B1CA 5IHUH 5IROA 2ESVE 4MCNA 4H8UA 4X80H 3X13B 2NTFA 4QRRA 4LVEA 3Q6GH 2EXTA 1DJXA 1MI5E 4NDMB 5E9DE 3LKSA 3KW7A 2FIKB 4GKSB 1T04A 4ZYKA 2OSLA 4DAGH 3ZZQA 4OLVH 1FVEB 1BX2A 3VX1A 4EE2A 1OT1A 3TH2T 1OXYA 1SLWA 2HA1A 2AEPL 1UHVA 4Z7UB 2BC4A 1SY6L 2QVFB 4O2EA 1N3NA 2ZKXA 2XSKA 1HNGA 3TVMB 1L0XA 3WFBL 3QFGA 4G6KH 1FNHA 1F8TL 4CU8A 1DVFB 2NSXA 4GINA 2PW1B 3QYMA 2NY7H 3X1EA 1JBJA 3JWOH 5CEXB 2BP3A 1U21A 3BX7C 4D8PA 5JIMA 3FN9A 5MI0C 1WWWX 5GRXG 1L7IL 3MV11 1JK9A 3SOBH 2B59B 1N9PA 1UFGA 3MLXL 3APFA 3BVTA 2XZCH 5JA9A 1UXWB 2Y6TE 2CUMA 2EILB 3VH8B 1XR9B 1MNUL 2MQCA 3KPOB 3TN0B 2VR5A 4LVNB 4MNGE 4BKTC 3GSRB 1P4BL 3C60B 3WEOA 3L3GB 2IEPA 2W9EL 3TFKD 1CDBA 4M02A 3JWNG 3VFNB 3ZN6A 4ZOBA 5AW9B 1CD9B 2WYIA 1S7WB 3WLBB 3TJHD 4LOUC 1ZK9A 4OGXL 3B8YA 3PWVB 4G1MA 5CWSA 5F7YC 3S8GB 1M56B 2HJLB 3ULSB 1OPGL 3RZWA 3C5JA 4LHUD 1BF5A 5I1KH 1RLBA 4UTCA 1E4HA 1H15A 1WZ1H 1FO0A 2VMFA 5FO9B 5JHMA 2ICWB 3QIWD 4JFDA 4LLDB 3HUJA 2AKRA 1I9JL 2YA1A 4BSJA 3DJZA 1VERA 2ZWLT 1GZQB 3QULB 1ILSA 1K4DB 3JWNE 4GRMA 4JR9H 4LLUA 5BUPA 4FQIL 1CD1A 2UWEB 3IT8D 2EHBD 1SXCA 1S7UB 2J55A 3AY4C 4E9RA 2L3BA 1R6VA 4P8QA 2W0FA 3FRUA 4UQ9A 5KYXA 4JPQA 3WS3A 3P02A 3IXAA 5DZAA 2WSKA 1RIUH 1F11A 1TZOA 2O6EA 2X0VA 5JMVD 5F3HA 3K6FA 2HT3D 5F93C 4BQ8A 4MQ7A 1SOKA 2WGNB 1TCMA 4L4VD 2MCAA 4RCAA 2AAVA 3NA9L 4OU3A 5B1AB 5C0IA 1GTFA 4B9IA 1F5WA 3DJRA 1N59B 1R47A 5HVGB 3VRJA 2F74B 2JTDA 3UBXB 1CICA 4K9JA 1D9KD 2VZVA 4G8GA 4YLCA 5HYFA 1OARH 2XOTA 2RGSA 4UT9H 2ADJB 3L1GA 3TNMA 4GMTH 1OM3H 3ARVA 3MRGA 1KCLA 5IB4A 4KDVA 4EN2A 3QJFB 5T5NF 3ZE0F 1IIKA 2WQAA 5KW9L 3I74A 2Q86A 4FERA 1N3AA 3OGOE 5CMAB 4L4TD 3D3VE 3ULXA 4XCYB 2I27N 4UTBH 1DR9A 4QEGA 4YAQA 3SJVA 5BS0D 2F5BL 4HXAL 1EXUA 4KK6D 4KZDL 2W65B 1XTMA 4BZ1H 4BXSV 4CN1A 4J3VA 3QPQC 4JFEA 4EN3B 1QR4A 1M9WA 2QQLL 5D70H 5DUBA 4DPRA 3GTNA 2HWZH 2YD7A 3LRHA 3LIZA 1NL0H 2FEDD 2WLLA 3VXSD 5HJBA 5K93A 3RB5A 1MRCL 2B16A 2GVYA 2YXWA 1MEXL 4HC1H 4UILH 3QHZL 4Q2ZB 1P4IL 3VXNA 4A7GF 3OR6A 4F7TA 1ROCA 3QPXL 3K2IA 5DQDH 3VFMB 4GRLC 4D9QD 3IDYB 3HLKA 4EIBA 4F7CA 3G6DH 2YRBA 5ISZD 1YQRA 4O4YL 2WCPA 4AQEA 1IFHH 1ETJA 3L4YA 5FDWB 3KS0H 1XF3B 3NK4A 4EEEA 1TEFA 1BP3B 4YR6A 3VACA 2JJTC 4LSSH 4QD2E 5JUEL 4P5TA 3GXPA 4N8PA 3GKWL 2EZ0D 1A7RL 3RDTD 2Y7MA 4LNRB 4XNQB 1ET5A 2APWA 3VI4B 2HUEA 4QYOA 4RX4A 5ENWB 1TZHA 2CM6A 1X7SA 1JAEA 3BZFB 4K3EL 3X3GH 3AU1A 2X1QA 1MPAH 4LE8A 1JNNL 5F0MB 2XN9B 5FYKL 4AENA 3HI1A 3GMMA 3F2LA 3F0ZA 1UB5A 2G75A 3NCBB 1SOQA 3OGCB 5DTFA 3CVTA 2XIBA 4NHUB 1KCUH 2A4EA 4ODWA 5F7NC 1UB6A 2X4NA 1OALA 4JLRB 2ENPA 2Q7NA 1J0HA 3R06A 2YGNA 2XA3A 3KYNB 3RGVB 2QSTA 3DSNA 4OCWH 1TR7A 3A23A 3ESNA 1QEXA 1KEMH 4XI5C 4ZAKC 5C2BL 5EBLB 3BKYH 3OMNB 4LBEA 1K35A 1AS7A 2YA3A 1RPKA 2X9WA 3T65B 1H5BA 2TSBA 2B20A 4MYWB 1FQ9C 4YUEL 3BKCH 1SOSA 1B90A 4F91B 6PCYA 2GEQA 1ACYL 4TSBH 4Q8BA 2WBXA 3V55A 5GRVL 2A77H 3V4UL 1AKJD 4NQDE 5EIQA 3T3PB 2IO5A 5CZXD 2XHNA 1G0XA 1VFUA 3HPJA 3NFNB 4H25B 3BISA 3KLAB 3NJXA 3SDXB 3TBYB 2D0GA 4PJIF 3MCKB 3WNOA 2JJWA 5DJ6A 4RGNE 3C8HA 4O51B 2OM5A 4Q74A 3SCMD 1UUNA 5DEGB 5IVZA 3U2SB 2H3XC 3H9SD 3CN3A 1HAUA 4UINH 1ZVSA 5F97E 3EOAB 3GRWL 3V5KB 5IG7B 1QN7A 1DLHA 4DGWC 3D05A 1DE4B 2IWFA 5D2LA 1IGYA 3CFJB 3GC3A 2BJML 1N70A 4PP1C 5LO7A 4NC1E 4JAMB 2X3AA 1UEMA 2JK5A 1P7KB 3MODH 1Q9KA 4NI6A 1CK0H 5IMKA 2J3SA 3QUMA 2JKIS 1CL7H 3I50L 3MRHB 3IFLH 1F45A 3B7SA 3SGJA 3TXAA 4IEFB 4KVCL 4O2CB 4W4NA 5DS2A 4YSAA 2BVOB 2H1XA 4F93B 4QOKB 2AK1H 4PS8A 4TNEA 5A16A 1PSKH 3WIAA 1H8OA 3ILPA 1F3JB 1Z66A 2OJZL 4W70A 4FNPA 2VSCA 2DYSB 4LPWA 5B38G 1QSFD 1MCPL 2ZJSL 3VXUA 3IVKB 5EU6D 3LPGA 4X5WB 1BVNP 1GJUA 2W60A 4S11A 1KLGA 2JKNA 4BK8A 2X9YA 4Y2NA 4A2EA 2J73A 3MR9B 4LEXL 4PRPA 5ESQB 5E4EB 3K80A 4M1GH 4NO0A 3B83A 2YD8A 3RL1A 4YDVB 1MWAH 2Y7QA 2VDMH 3P2BA 4IU2A 4OB5L 2PR4L 1NGZB 1MCIA 3BYTA 4L05A 1BG1A 1INQA 4LAJH 4MXVF 2WOYA 2HZSA 2ARJA 2ENQA 2ZICA 2FH8A 2WINA 1JZ7A 3CJJA 3IU4H 3CLEH 3TNNB 1GS8A 4JL1A 1Q38A 4ES9A 3ULVH 2QLVA 1JGEA 3PWUB 1S7XA 1P5UC 2YPVH 4OCYH 4FKKA 2FYYB 4P4RA 1EXHA 2WXLA 2XTJC 4MAYA 4ZO7A 1DBML 1QRNE 3RL2B 2WKOF 2GIMA 5E5UB 4CVZB 2PO6C 4WI7A 4LOVA 1I8AA 5IK3B 4IBLT 5J1SC 2BIPA 5CJQH 1I53A 4NFBA 1YMHB 2HVBA 2YD4A 4V1DB 4C4UA 4FQCH 1YEJH 4Y1AB 1I3GH 3GHEH 4E5XA 4NUGH 3VRLE 3BE1L 3PWPD 5I1DB 4HF5H 2LOEA 3R0NA 2IAMA 3VJ6B 5CSBA 5MEOA 1NC2D 3FUNA 5TE4L 1QA9A 4HX1B 3K4AA 3RWIB 1YECH 4MJID 3ULUD 1MJ8H 1TETH 1UZ8A 2C3GA 2XT1B 2NOEA 4PV8B 2BIOA 3EO0B 4I1PA 3MOAH 2VXUH 3VFRB 1NAMA 2QQQA 3DV4A 4UMSA 4WO4A 3DNKA 1KB3A 1UM4L 3EO9H 3MLTB 2OMZB 3WNJA 4QRUA 1ZDQA 1S3KL 3NJKA 5BQ7A 2EDEA 4JFXB 2QHLA 1UT1A 2DQUL 35C8H 3DBSA 3QZNA 2EEBA 4FN0A 4Y19D 4B9ZA 3MRFA 2W8CA 5JOPD 1R46A 1RURL 1K72A 1SM3H 4IBSA 1F4XH 4M48L 3UP1A 5HDQL 1EGJH 4OCMC 4LRNL 4ZW3A 3OAYH 3VXTB 1C1EH 3ARXA 1D2OA 5IMLA 1EUVA 1XGUB 3NFPB 3F6IA 4R9HA 3ULVF 3ASWA 43CAB 1L3NA 4M61B 3N1MC 2ODHA 3MRNB 3IDXL 2NTSP 3ABGA 3VGGA 4RQQA 1HHHA 4KRPB 4X5XB 5D1QA 5JW4Q 3HS9A 5D71H 3EXLA 2CLZB 2ADIA 3BUPA 3FQYA 2OOYA 3QH3A 5IGXH 1VGKB 4LL1A 5C0CA 1IILE 3MV9E 5J8OA 3OSTA 1GSMA 1JVLA 1P53A 2XETA 3P4NA 3VE0B 3MV7B 2ATPB 4J3BA 5DT1H 5D7KD 1MQ8A 4XB7A 5E5LA 4ZZFA 4P57A 5DWPA 1DJZA 4OLEA 3SZ6A 4ZQTA 4U6HB 1OSZB 1TU2B 3RFZA 2CRZA 1NLBH 4B95C 4HKZA 2QSCL 1AJ7H 2WLIB 4P0DA 4A55A 5EDXA 1N64L 3U30C 4Z3EA 5JPMA 1OAYL 1XF2A 5KANG 3R8BB 4JFPA 4X6FA 5KYWB 2CA3A 4Y4HC 1OB0A 3S5LA 4WUKL 5CEZE 3FONA 3PG2A 4GAGL 1X6NA 4M7ZC 4YHNB 4DGVH 2IJ0C 2DIEA 1KZYA 3QUZD 4OZHE 4OFIA 1GIGH 4XC1H 3W0WE 4E41E 1PZ2A 4Y9EA 3ES6A 5D6DC 1WTLA 4PYGA 5DLLA 4LL4A 1KGIA 1DCEA 3DRTA 4PG9A 1KCVL 3T0BA 2VABB 1EAPB 3O2VL 4JHZA 2R39A 4U1LA 3QXDB 2CJ3A 1PAZA 4FC3E 1EZVY 5H2BA 3DPUA 2NLJA 4EZKA 1OPOA 4HA1A 3HNTL 3IU3A 1Q0EA 5C0DB 3C5XA 1CLYH 5E1AB 2DEYX 5TDPB 1EO8H 1CG9A 3MJ7A 1PD0A 4U4IA 1VCAA 15C8H 4QXTA 4NAJA 5GRUL 4H44C 2WMPA 4P46C 1DQLL 4X6DA 2P5WD 2OMUB 3S3CB 1UM5L 3Q48A 3QDMD 4K3DH 1WQVT 2XWZA 1G7PB 2R2BA 4PWIA 2I5YH 3ZPDA 2DKDA 5IF0A 4NQVB 3TTYA 5DZJA 5E6YA 3T4YB 1PGRB 4GI9A 4HPOH 4KUCD 5TQ2L 4JPWL 1T66D 1HL4A 3JUYA 1NCBH 2JIXD 4C55A 2VUOA 3HAEH 3VD4A 4DVBB 1FWXA 1E6OL 1S9WA 3ZDYF 5HVFB 5D2NB 4EXKA 3MBED 3VQMA 4WFHE 3WG7B 2VE6A 3CK0H 1HYSC 2DZEA 1TBAB 2HG5A 3LNFA 4NSKB 3WIFB 4O2FB 2Y6SC 2X70B 4Z7OF 1TQSA 3WEBA 1ITCA 1KWKA 2EDNA 4XNYH 2W92A 1AY1L 4HHWA 4JVUA 3EUDA 3UTZB 1V7MH 4ZFFB 1KXVC 3ZBMA 3CTTA 3BMVA 3FO2B 1RJZB 3NVQA 3AWGA 4K5OA 3WMQA 4K4KA 4I0PB 2F8IA 3QHTC 4PJ7E 2Z64C 2M2DA 2CIIB 1YJDH 1OF2B 1LWJA 3ZL1A 1A6VH 5HVHC 4HYTB 3I6GA 4LSUL 1SN5A 2PCFA 3Q3GB 4KQ4H 3SBPA 4J23A 1QO3A 3E6FA 1FG2B 3WENA 3GM0A 3F8UB 3OPUA 5I0WA 1WZAA 2DQGH 3LY6A 1WK0A 3MV8A 3O6LL 3WUWA 4FADA 2YD3A 3T8XB 2R0ZH 1LP9A 3CSBA 5DRXB 3KWWB 5DYFA 3UGXA 3L1OL 5J6GB 3MLVH 2ZF9A 4HMCA 4KY1L 3C2AL 4S1DD 4EAJA 3EAKA 5B4MC 2FJGA 3GM8A 1X5GA 4RA3A 2OBGA 5DZ9A 3RIKA 1QFUL 7FABL 5GZOC 3LQAH 3NH7H 4UQBA 1XL4A 1ZPUA 3JQOB 3R4DA 3CAFA 5I66A 3DOIA 1A5FL 1SYSB 4WDIA 3RUGE 2B4CC 2PWHA 2WM0A 4ZMYA 5IB2B 4BFBD 2Y07L 5A6MA 3LXBA 3HPLA 4TLSA 1UJ3A 1A4CA 2R29H 3CVIH 3FCGA 3ZY7A 3I0XA 3AZUA 3X14A 2NNAB 4PY5A 3V7AE 2BS9A 3RX5A 1N0XH 1RIVL 3BUYB 3LKRA 5EPMB 2OA9A 4KTEL 5CHNA 1IAKB 2CJSA 2RALA 1NH2A 3SQRA 1G9EA 3M1BB 5E5MB 4MNQB 3LXUX 2AV7A 3FUMA 2BW5A 4PJEA 4N24A 4FFVC 1ML0A 2YAMA 1I82A 2BRRH 1B6DA 1NM4A 8CGTA 1U8QA 3MXWL 2G2NA 4L3AA 2HKHL 4PSRA 4ZOAA 1L5GB 1OTSC 3WIHL 4P2OD 5FKPA 2Y5TA 4PY8J 2NDGA 3LZFH 2DLEA 4ORGA 5FYJD 4JJOA 4R2GC 3HI5L 1I9RL 5GGQH 3RNQB 4WF7A 1XF4B 2J8UB 1TPXB 1BQ5A 3O6FD 4MYPA 5DDHB 4LCUA 2EH7L 3RWHB 4URKA 4HUXB 5I1CL 1DL7L 4WWNA 1IC5L 1RKRA 2Y7OA 3P2DA 2EH8L 3BCDA 4YDLC 4W9DC 5DJ8B 2Q76A 1AR1B 5DR5H 4H26B 3OLEA 4ZUVA 3QIUC 5DVPA 1YEIH 5JNYA 4MD0B 1H0DB 3L7FB 4YN3A 3NACH 2YIHA 3KW8A 3I3EA 4JZJA 2MQ3A 2ESVB 3MJWA 4DN3L 1KDIA 4LXFA 1T80A 5ILTL 4DP6X 4Z7QF 2OSXA 2GTQA 4P4KC 1A47A 1FFRA 3OKMB 4IBUA 5J7CC 3L3OA 5EC1A 4X6CA 3PGCA 3TBSB 3WKPA 3NRPA 4ZOCA 4NQXA 3W39B 2AHIA 3IGLA 2OZNA 2AZUA 2A6DB 4YQXL 4TMPA 3ISRA 4G5ZL 4LHUA 5ERWA 4LESA 4IRZH 1MRFH 2ED9A 4HBCL 1L9NA 1BBJA 2VXTH 3U1SL 3DO7B 4EUPG 3QIWA 1BAFL 4Z7VE 2QADC 4KOCA 1T5KA 3P73A 3PV6A 4JCMA 1K2YX 2IANE 3ARZA 2BDNL 2AF2A 1RUMH 2QKIC 4AJ0A 1EVUA 5A2KH 3VMPA 3AU0A 1CYXA 3FQUA 1EAJA 3ET9F 1UTDA 2E9WA 1NJ9A 4PB0H 4H2CA 3CXDH 3KLHD 3TJEH 3VRIA 4PPTA 3GTTA 4J3SA 1NBVH 2HKAA 3NIGF 3QGVA 4NRZA 5E6ZA 3LQZA 1PFOA 5C70A 2XN0A 2B5IB 4XPAL 5I5IA 5DC0A 1HH9B 2PF6A 2E8YA 1M53A 5DJXA 5E23A 4Y5XC 2J72A 3NRFA 5AW6B 5KBMA 3MJGX 4IBQA 4E5XG 3FC8A 5LB1A 1FFTB 2X28A 1B2WH 2MQGA 2KLTA 1N8ZA 1ZA6A 1ERNA 4FG2A 4HPYH 1L7TL 3PAUA 4JO3H 5EC2B 1D9KA 4AYFA 1G6RL 4RGOH 1R19A 3MRIA 1IZKA 5GGUB 4WUUB 1F1AA 2NQDA 5IW6B 1A4JB 4OLXL 2ZCZA 4PI0A 2IADB 3SYQA 1JGVL 4K3JH 3FQNB 5T1MA 3TPUA 1A6WH 5BS0A 3KYOB 3ISYA 5EOTB 4NKOA 3DO4A 3ATEA 4PTUB 4N0FA 1A4KB 3P77B 2X87A 4FZ8L 1R24B 2JCCB 4UM8A 4ZO6A 4CC0A 5EORL 1LEKB 1W8NA 1DFBL 3BO8B 3VXSA 4U6VL 3WLWC 4KMTL 5LBGA 5AAMC 5T3ZE 5AYQA 5AVWB 5HJGA 1A7PH 2AABL 2YGVA 3RZCC 2EE6A 4GW1A 4RRPA 4XXCA 4M3JA 3BLPX 5T3XE 1K6QH 2B77A 3EHBB 4OW6A 4B5ZA 2ZYIA 2BY3A 2WN3A 4ONFH 2YH5A 4FULA 5KVFH 1OW0C 1QLEL 3EOBA 3S36X 2A9CA 2H8PA 1N2RB 1T3FA 3D3VB 3NPSC 5AUMA 2QQKH 4FTVB 1ADQH 4Z7WE 1JUFA 3D6GA 1FFNB 2OMTA 4U2YA 4DUXA 2PYEB 1AYOA 1J05B 3HE7C 5AB0A 4N25A 3RDTA 1MG2C 2X10A 5EA0L 3WUZA 4EDXA 3CFTA 4F37F 2XTSA 5DRWA 2R2HB 4U1SA 4PJFF 4TQPA 1I1AA 5E8NA 1OP5H 4AL8C 3GMRA 3S5LG 3HLAA 4NAMA 5DHDA 1RUAL 3VA6A 1E4KC 4YSQA 1QUNB 3KVPA 2YD2A 2I7SA 3OV6A 3LH2H 3L3KB 4OZFB 4TRPL 5FYLL 1JGLH 2R2CA 3BUBA 3IFPA 4ZFZA 4WIQA 4Q9QL 4Z7NE 1EHNA 2YXFA 2PPDA 1YUKB 3WKYA 1UCBH 4JY4A 4BGDA 2WBJB 3FOLB 1Y6KR 5AW5B 4KKCC 1SF5A 5A2JH 1KYFA 3WTXA 3MREB 4OM0L 1A7QL 5GSVB 1ZHLA 2YKLH 2ZPKL 4Y89A 5JW4M 4DP0X 3CN0A 4L9LA 5I5MA 3PIQA 4PRDB 2V3FA 1IBDA 4XZUA 1PLAA 1FH5H 1YY8B 5JW5B 3MLWL 1JPTL 2IV9A 4JO1L 4N2EA 3REWA 2HVKA 2Z93A 1W0VA 2ICWJ 1AKJA 5AAWA 3MCLH 4PS4L 3SDYH 4GBXC 4MD4B 1KPUB 5LNDA 4UQ2A 1N6QH 2AV1B 4H1LG 1DBKL 1J5HA 4IS6B 3RY6A 1S9VB 5I6XB 2CGZA 1P7BA 1X5KA 1GH7A 3H3KA 1TQVA 2FWOA 3ARBA 3FN3A 3H9SA 4YEEA 2NR6A 1KIPB 5F9WB 1BBDL 2D8KA 2FZ3A 2F58H 3UJTH 4PY7A 3V0EA 2B4CL 3ZE2E 5F1IB 1OLZA 3NFSH 4QY8B 1W8EA 4DPAX 3VFPB 2BVQA 2DAVA 2APSA 3TVMC 1KIRB 4H2AA 1SJHB 2G9KA 4YHKH 1V3MA 3I6LD 3T6QC 2PWFA 5ALCL 5GGTA 4M5ZL 3THMH 5AYUH 3PQYD 4OLYL 1MVYA 3CC5B 1IO4C 2DMCA 2NZ9C 4NUMA 5E1GA 3QI9B 5L2KE 1AE6H 3TYGL 4HIXH 4KKLC 1A66A 1KF9B 1QSFA 3HA0A 2NY3D 1ESOA 1XGTA 3TN0C 4AIEA 5IT2L 4LVNC 1SBSH 3CCHA 2R8SL 3WUWG 1T0NA 5F7BA 5KVMC 3ABMB 2JCWA 1ET8A 4XN2A 4ANXA 5I1EL 1KGYE 1PJWA 3HFMH 2K4WA 3DX3A 1R4XA 3OR7B 4QF1A 1BCIA 4CU7A 5BXFB 4G6AD 4N2LA 1PG7L 5F9CA 5CFHA 2C9PA 4JG1L 3GMQA 3U2IA 2IG2H 3AREB 3IN0A 1OWWA 3OM3B 1X7QA 1W6WA 3FQXA 3BZ5A 2EYTB 4Q6KA 2APVA 2CO3A 4P2QD 4XNMB 3R8QA 1FFPB 1LP9E 5CLWA 4JDTL 1UG9A 4AM0A 2C3WA 3HKZA 5DMIL 1AD0A 2HFEA 1TSRA 3RPJA 1DLFL 4JKPH 4UV4H 4WEUD 2BFVH 2ODIA 2EVHA 1KGUA 3T8VA 3ZL4L 4ZDHA 1RM1A 4TUJA 4X9YA 3LEYH 1PY0A 1R5VA 2PP8A 2NZ1A 4MASA 3QISA 2HRHA 4GKNA 5DUPH 3SHSA 3T2OA 1I1YA 1A3RL 2VUKA 1A02N 3PRZA 3CSFA 1MN4A 3IDJB 4O02H 4YNYB 3ZRSA 3PWPA 3SBWC 5CBAB 3CFBB 3FK3A 4ICXA 5CILH 5EZOH 1O7DE 2P45B 4IRJD 4M6OL 4HU2A 1Z9SB 4XRCA 3V10A 4HJGA 4MJIA 1QI5A 1TITA 2GHZA 3L9RA 2R0WH 4JN2A 2DDQH 2WZPD 2O72A 4WFED 4TQEL 3N42F 2OTPA 3MOQA 4I4WA 3P3UA 2GC7C 5GS2H 3BD3A 4PJEE 5AZ2H 2CUAA 5EUOA 4Y19A 2CALA 1HTYA 4J3OC 3UPCA 1H8SA 3L3HB 5GIRA 4EN3C 1WS7A 4OFQA 2EUVA 3IPBA 3SY6A 4OY9A 3LEVH 2HLFD 5GISH 1IEBA 5EB9A 5F7DB 3P11L 3KPRE 2HPTA 1WAAF 5ADOL 1JPFA 3O9WC 5EF0A 4FYQA 2WXNA 4MB4A 1HHJA 3ARFC 4AQOA 25C8H 3C5ZD 1BECA 5C9JA 1U8KB 4E9SA 3JV6B 1H9VA 1A7NH 3GLAA 1JZIA 2FLMA 4KJYA 4PU2A 3VGFA 1IM3B 3U36B 4Y2OA 1A8JH 3QCTL 3IDYC 4YMPA 2GKIA 3FT2A 5H4ZA 2WQWA 2Z9TA 5SX4I 3VSUA 2KHAA 5GSRB 1YC7A 2BX5A 2J1ZA 2P24B 2PLTA 4LHUG 3T3MF 4AYDC 4PP1D 3GBMH 1QR1A 1M3HA 3AQDA 1KLUB 2AJXH 1ZANL 3LV3B 4CNIA 1F4HA 4AGOA 1EWHA 5C0FA 1XAKA 2VDRL 4JPIB 2I32A 4F2FA 1M71A 2BWIA 2L7UA 5HHQA 4XXWA 2JB5L 3SDDB 3RY5A 4AUJA 4W9LC 3LEXA 4KFMA 2R0KL 3CHQA 4D3CL 3L4TA 1SMOA 2A6JB 2AXFA 4R5VA 4X5PA 5FUZH 1TJHL 5ID1B 2BCMA 2E6JA 4LCYA 4PJ9D 4PVMA 5I1AA 1FI8C 5FB8B 3KH3A 1S7TA 1CXIA 1E8WA 1YEKH 3G5XA 5C09D 5KSUB 1WDAA 3OG4B 5EU7C 1BM7A 3O3BB 3FH7A 4LF3B 1WYJA 5ITFA 1ZV2A 3IDGB 3T6XA 1AMYA 1WFUA 4M9PA 4Q6IB 4CJ1A 2N1TE 2DI7A 3TZVB 2FO1A 4Q9RH 1AFVH 1F4YL 3IJSA 3VGEA 2P5WA 1E4XL 4K5PA 3QDMA 3EF7A 1BZ9A 3CFQA 3PY9A 4TOYL 5DJAA 2DJUA 3ZTEA 4U4BA 4OZHB 4Z77A 2ZQKA 2ZSVA 4JDVA 2XTJD 5E1HB 4A6YL 4JO4H 1PCXA 4WI4A 3BPCA 4Z0BH 4AL8L 2I9TA 5EDSA 1DUYB 3EDKA 4L4VE 2PO6D 5HGGS 1KXTB 3QR2A 3FUEA 1PJ9A 2KC0A 4C8XA 2XG4A 5J1AB 4ZNCD 1JZ6A 3T2NL 5TE7L 2WP3O 2UY7B 5EIVA 1K8DA 3PDOB 4KKAC 3V0VA 4KKBD 4ISVA 3VFWA 1IKOP 1U8CB 2PCPA 3SE3C 1UH2A 2D03L 1XR8A 3TASA 5ITBL 3L5HA 3EKCA 4CC4A 4RRPG 4WGKA 4GIOA 1G9HA 3BHBB 4N1CA 4JFYA 1U8LA 2Z7UA 4L4TE 9PCYA 2DEWX 5IV2A 3H2PA 3LH9A 1YYMH 4H0GA 4M6NL 2H0JA 1QLFA 5DD5L 5DHMC 2E27L 4ABUA 4I3RL 3JV4A 2XWJB 5TPWL 4P9ML 3MRQA 4LQFH 1D6EB 3EH5B 3VXSE 3SE4C 2P47B 3AT0A 1BZ7B 1QMUA 5KVGL 4FQJH 4GUQA 1S78C 2AK4D 2BSED 3X12B 3V4PL 3BQUB 3PPEA 4H20H 4LCWD 4PGCA 5F89B 4WO0A 1E9PB 1VADB 5I0YA 1P7HL 4N6QA 3RWJB 1USQA 3ATAA 3QFJD 1RJLB 5DS8A 3RTQC 4D9QE 4JO2H 5ISZE 5HHNB 1OHZA 4OTXL 3U46A 2YMXL 4HUCA 3FB7A 4Z3TA 3ARDB 2WIIA 2RAMA 4UOW1 3B9VA 1B4JL 1OGAB 1YEDB 3HOGA 3I9GH 1SZNA 2HJFB 2C3VB 4LCCB 3BW9B 3UTTA 3CSTA 4GSDL 5KZCB 5ICXA 3UIZA 3A24A 5HGHA 1T1YA 4PG2A 2CH8A 1A6PA 1XIWA 1U30A 3EJZC 2WD0A 4UB0L 3RI5F 5LNGA 4JCLA 4DW2H 5LGKA 3BZDA 3IDMA 2ATKB 3MJ6A 5HYJD 3LNEA 1G7IA 3S37L 2DJ4A 2H32H 1I7TA 2WNKA 4TV3A 1L9QA 4EOWL 1MFUA 1GVIA 3BP7A 3DRQB 3D9AL 4PS7A 4C83B 4PEEA 2C1PA 4YBQD 1OAXL 5C1MB 4Z8FL 1FZOB 1YPZB 4IOFC 1MHHB 2VC2H 4NJAH 1L3WA 2R0LL 2WTOA 1WBYB 2VRAA 1NBYA 4FI8A 4M43L 3RUGB 4PV9B 3TEWA 3TEYA 5KS9E 1CGXA 1FZMB 4LPCA 3VXOA 4LLMA 1RZPA 2WBKA 4X98B 4ELMA 5C6PB 1G7MB 4ODBD 5E2TL 1FDLH 5L8LB 4HQQH 4CILA 3JV5A 4IHOA 4YXHL 3O6FA 4GKZB 2LV4A 1S7SB 5MENB 4QNPE 1KNOA 1DBBL 1JGDB 3M17A 4FNLH 4XBPA 1VOLB 1E43A 4PRBB 1TJGL 1EHLH 3IGAB 4UNUA 3ATFA 3FFDB 1W8OA 1LDPH 3JBG7 4Z3JA 1NGPL 1MOEA 2NYYC 3TV3H 4ZFQA 1EZVX 4X7SL 2Y2YA 3ETBF 1BVKA 2ZWSA 4RAUA 3SOTA 1ZRUA 1BZQK 1J0IA 1U36A 3CH1B 2GJPA 5DFVC 5SX5H 5DFTA 1LVEA 2P8PA 4HGWA 4PGEB 2E9BA 2PWDA 2XWBA 4X2UA 4BH8A 1H3UA 1IGFL 4ENED 4GQPH 5GJSL 4NQUA 4FFZA 1FNEA 4ELKB 3NIFE 4KRPC 4RFNC 3FTGB 4PGZA 1HKLL 3QUHA 1AGCB 3QXVA 2EC9T 4JM2D 3UOAB 2VL5B 3OC5A 3TCLB 5C7XH 5D1XD 3K46A 4POYA 2IV8A 1NDMA 5LGJA 1I8LA 1DVTA 1BD2E 2LABA 3FQ4A 3MFFB 4UT9A 4FYSA 2CIKA 2YUZA 4Y4FB 5ICYA 3E80A 5CCJA 3K72A 4K55A 5IBTL 3ARWA 4NYLB 4M1CC 5J57B 3UADA 1QSFE 4OLWH 3ZDZF 5EU6E 2BVYA 3S34H 1W72H 2VO8A 3FO1A 5E8OA 3IJ7A 4UYQA 1WQAA 2EKJA 4UTBA 3LRSB 1F90H 3MNMA 4HVBA 4LVOC 4JFZH 2XTLA 1BPLB 1EQWA 3RA7H 3PL6A 4EBQH 3EXJA 3GF8A 3EADA 2WBWB 4YXKH 1P1ZB 4BZ1A 4XVOA 2DQHH 4R26H 1CLZL 2B0SH 2X44D 5FAAA 4R90L 1JXGA 1YEFL 4NQCB 2XCMC 4WHDA 2FHCA 3VB9A 3VM5A 2H45A 1VEPA 4GEJA 3N2JA 3GMOA 1L9RA 3IRCA 1ETB1 1XMEB 3N44B 4AIZB 3VTMA 2JJSC 1KTKE 2Y06L 4PRHB 5B4MD 5KVDL 1F97A 4BFKA 5GZOD 4J4PD 4EDWH 3V6BR 2WWKT 3ILQC 5C0AB 4LU5H 3NA5A 3FN0H 1KEGH 5CLZA 1SXZA 2P48B 3JT2A 1QEWA 1DP0A 2CKBH 1IGIH 3W11C 5E08H 2WQXA 4I1NB 1CPUA 3MPCA 3HZ3A 2EYRB 3BKJH 3DX2A 4OI8A 5C0RH 3KPTA 1R3KA 2OS7A 1WC7A 1WS8A 3CDGA 4B96A 3L7EA 3G3LA 4JHWH 1GZHA 2AJYH 3Q8CA 1NGXA 3OTTA 1CR9L 1QN4A 1WT5A 4N6RB 4RGMB 2R1YA 2KZ1B 4NO3A 5DSCB 1H3XA 4ODXB 5J9PB 5D2NC 3QO1A 2A74A 4DGIH 4FFVD 2R15A 2JELH 5FW8A 1Z9LA 4WCYH 4MJIE 5DHYA 3VQLA 3V4LA 2AXHA 3QJHB 5KSVB 3CFCH 4X7CC 5IQ9B 3PAZA 4CN4A 4ALAH 3Q6FB 5INCB 5EUOE 5CSZB 3GUTB 4WTWA 1RUKL 4UT6A 5A6LA 1KFAH 3LVEA 5JOPE 4BQ6A 2WLNA 2OJEB 2LAEA 1S2EA 2GYSA 3H7BB 5SV3A 4PCTA 4UQDA 2OR9L 2XWDA 3UFIA 4OLVL 5E6ID 2N4IA 2W95A 1DJSA 5HGBA 1HE8A 3GS0A 2UXGA 3QIUD 3P0YH 2X40A 1KTCA 3TT3H 1CDCA 3MLSL 3KEDA 1CE6B 3C6SB 3QG7H 1ES0B 2PCXA 4HCRH 2FNWA 4KROB 3GLDA 3TA3A 1M6OA 4M7JL 4N90D 1LE9B 3EG9B 2X4TA 5T8IA 2DMHA 2F8VA 3T2QA 1WBZB 2DQCL 4JFFD 3KGRA 4P4KD 1N26A 1YEWA 4ODUB 3GSWA 2OP4H 4QRPD 3V5DA 5JORA 5D7KE 4KNUA 2MOVA 4W9EC 3RVUC 1OOWA 2IWEA 2X4QA 2Y2WA 2X1WL 4KI5C 4NT6B 5HVWA 3U1QA 3S2CA 3IETA 2WHVA 4B27A 2P3YA 2GG1A 3FDWA 2J4WH 2E7DA 1KBVA 3TJPA 3WFDH 4CDHA 5IVNA 1MFAH 4IQHA 4Z7WB 3TEXA 1F6AA 3WNLA 2I24N 3RVVC 3UJIH 4EPSA 1LEIA 1PZ3A 5EU5A 4YFLI 2DI8A 1QNZL 1XV8A 2QADD 3SY0B 3DX6A 3REVB 1QNAA 4MCMA 3AGWA 5B8CA 3RJDA 1KIQA 4L3EA 1NCUA 1BZ8A 3H56A 1V05A 4FA6A 1GOFA 4XX5A 4ETQA 2A9BA 2ZAHA 4AUYA 2HX9A 2XXMB 3NJLA 3AY4A 1AHKA 5KVEE 1GYCA 5ACMA 4M5TA 3DTDA 3VFGL 3QHFH 2FT6A 3E9TA 1KXQA 4Y5VA 5HDBB 3QORB 1HJCA 5IJKC 5PAZA 4JHBA 2G3XA 4LIQH 3WJJC 1DQQB 4M8QB 1ZA3A 5DO2C 2RCSH 2EIBA 4Z7NB 5KYUB 4NQSB 4P5MB 4B5EA 3D12B 1T7WA 5JQHC 3TEUA 5DVNA 2YZ1A 1GZPB 5F7AA 1VTLE 3ZYZA 2NUTB 1MWAA 1RIUL 1X5IA 3O4LB 4H40A 4JPVH 1SXBA 4UNVA 3QDME 1UOKA 4NQED 1UQSB 1NBQA 1QVOB 2Z31D 4Z6AT 1KBGH 1TPXC 5HHOE 2R1WB 3O41B 5TF1L 4OGAC 5HSHA 4DPBX 3O6ML 1XSKA 3AAZB 1A6TA 4FZEH 5ANMB 1D6VH 4AVIA 1RUPL 2P26A 2XC8A 3HHMA 2AEQL 4DTGH 3N50A 1CYGA 1ZKAA 2QGEA 1AR1C 3PQYA 4GRWE 2IH9A 4PGBA 3ZE1B 4JFHD 3N6YA 3KLSA 2QPDB 3E8VA 1ONQA 2C9VA 5E0QA 3ARQA 5L9DH 5DK2A 2DKAA 3BWAA 3AMLA 4UV7L 1YNKL 4JJHA 3TCTA 3EH2A 4LLWA 3EO1B 5I19H 1ZE3H 2V7NA 1QKZL 5IVXB 1FL6B 1C5CH 2DWSA 2OTWA 4K94H 4P9HH 2EUZA 1T1XB 1WA2X 2GJ6D 3JTBA 3ZE2B 1NGQH 3WLWD 4HIIB 2OXHA 1DANT 5EIIG 3BZEB 1IKFL 2FT7A 3H6AA 4IJ3B 2ARWA 3MMEB 1JTPA 2H0FA 3RZCD 4B0AA 4LKCA 4Y4KA 1FCGA 2WQRA 1KYDA 3B2UC 2VDNB 1A6UL 5JXAH 2JKTM 2TAAA 1NL0L 4JO5A 4NNXA 4QCIA 4CGUB 2F1EA 1LEGB 3WE6A 5GZND 5I1IL 2CWRA 3N0AA 4HKJA 4ZOEA 4HC1L 3KAAA 4UILL 5BZDA 1TNMA 5DWUL 1MFBH 4KMLB 5FW6A 2E59A 4FLOA 5F1KC 3UTSD 2FJFB 5DURB 1ZIAA 3M88A 1KCRH 4YHMH 1N10A 3LZNA 4R7NB 3FCTB 2YAFA 3FU5A 1J1XH 3F5WB 2D31B 3AFLA 2VW6A 1EGJA 2AXGB 1JSYA 3DX1A 4IJTA 2JB6B 1E2ZA 4PJCE 1GGTA 3GWJA 4U7KA 1OTTD 1AD9A 2JKWA 3UAJC 4X9FA 5C92A 1Y18B 4DF9A 2B5IC 2CDFA 3IJEB 3KYKH 4YL9A 3RB7A 5SX4H 4B9FA 1A6AB 2PXYA 2Y36L 3KNBA 3SKJL 1P2CB 3CZSA 3DX9B 1LXMA 3VXMA 1RZFL 1JYXA 1PZ5B 1YEHL 2YAEA 2AQNA 4MJ2A 3STZA 4ZTEA 5D1ZI 3DOSB 2V6HA 2VLLB 3QUXD 4G9FD 4GY4A 3GS4A 4PJHE 3GXNA 4QHLB 4XC3H 4IRJA 5I5JA 3U4BL 3ZT5A 3D52A 3CV5A 1QWUA 2WXOA 3J27A 1EXGA 4KKCD 4CKVX 1KCUL 4AQAA 1YMMA 3O3UN 4H0IA 5AKVA 4L2LA 2WZPA 3V6ZA 2ZXAA 5I6LA 1T2QH 2A4CA 4B6ZA 3KG5A 4NXKA 1B0IA 4OCWL 3RURA 1ASOA 2PTVA 5KG9