1KYUA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
total genus 69
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyuA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyuA02
4ROEB 1QTPA 1NVPA 2IV8A 1JFIC 1KYFA 1VTOA 1NH2A 1RM1A 1W80A 1QN6A 5CN1A 4ROCB 1QN9A 1KYUA 5IYBP 1TGHA 3MNMA 1YTBA 1VOKA 1QN3A 2D0CA 3H1ZA 1GYUA 1KY7A 1P4UA 5IYCP 1QNCA 2IV9A 1AISA 1PZDA 1QN5A 1TBPA 1QN4A 1MP9A 1QNBA 1NGMA 1KYDA 2D0BA 1QNEA 1GYVA 1PCZA 3VN5A 4PY5A 1E42A 1OM9A 1QN8A 4B0AA 1R4XA 2YMTA 1QNAA 2D0AA 1B9KA 3ZY7A 3ZHFA 2G30A 3OC3C 2DWYA 1KY6A 3HS9A 3ASMA 2DWXA 4RODB 1C9BB 1QTSA 2Z8UA 3OCIA 1NA8A 1IU1A 1CDWA 1GYWA 2E9GA 4BCXA 1VOLB 1YTFA 5IYDP 3EIKA 4WZSD 2MJ7A 2VJ0A 5CN2A 2A7BA 1QN7A 1TBAB 1VTLE 1D3UA 3HS8A
chains in the Genus database with same CATH superfamily
4NB7A 3HG1A 4Q58C 3KHOA 3STBA 5I1CH 2AJYH 3I9AA 3KR3L 2AXHA 3DV4A 3O41B 5EOTA 4DOHB 5IBTH 2Q10A 3WN5B 3GXTA 3NA5A 5BZZA 3FTWA 4Z7AA 4WFFD 1V8HA 1KB9K 5EDSA 3LAFA 4KH9A 3JV5A 3REWA 4Z3FA 4MJHA 5FIEA 1HIML 4BIKA 5AWNH 2ZPKL 4L8SA 1QVOB 5ITFB 2FGWH 2KBGA 3OLPA 2X6BA 1NCTA 3GO1L 1PY9A 2FLBT 1JUFB 4WK2B 1UB6B 2E7DA 1JVKA 1J8HD 3NSXA 3HZKB 1UXLA 2DRUA 1D5IH 3BUDA 5IW6A 4GSXA 2TRYA 4OGYH 3UTTD 4OTXH 5CGTA 4Q74A 4R5VA 3UX9B 2BVOB 4KUZL 3H3KA 1OAKL 3ZDZE 5CM1A 2YBRA 3LKPB 5CD3B 1U8HB 4W6XB 3ARDB 3UG4A 3JWDH 1AS6A 2PW2B 2J73A 2BK8A 2VW6A 1FN4B 2EO1A 2EXSA 4LVOB 3EH2A 3PWJB 1YEHL 5AENA 3TZVA 3BUBA 4ZFGH 2X4QA 4PI0A 1XH3B 3APMA 1KCRH 3X12A 4JKMA 4HJGB 4ONOA 1FH2A 3LIUA 1ZT7B 3FUNA 4YC2C 2CR3A 4BUGA 1WAPA 5D1XC 4QOKB 1YQRA 1RIHH 3HE7B 1OKEA 1RMFL 3SKNB 5IFAL 2BRQA 1T22B 4PHZA 4ZSOE 3GUFA 1RUMH 1OM3L 4H8UA 1V7NH 2CDEA 4Z7OE 2MHAA 1JTPA 2DI7A 3BH8A 4JPQA 4LQ1A 4BM7A 1QQDA 3H3BC 3GB7A 5IB3A 4HPOL 3UXFA 1JZ4A 1BCIA 4WEBH 2AXGA 1SMAA 5I82A 4JDVB 4DEWA 4RAVB 4CW1B 4Y2OB 3O6ML 5J9PA 1OAYH 3B6SA 4DGIL 1KB5B 2G5BA 1NBZB 2CRMA 4K4KA 1IM9A 5F1KC 3RDJA 3AABA 2BINA 4HK0B 3ECQA 2BVQA 3BI9X 3NGBC 1D5XB 1HHGB 4TKWA 1LWRA 2LE9A 2ZXWB 2PPAA 4XAKD 4BZ1L 1N39A 1SDDA 4JUSA 5DYOB 2A7BA 4XMXA 4C47A 2J1YA 2EDFA 3ULUF 3GXNA 1Q72L 2DW5A 1RXLA 1P5GX 3BPCA 5D70L 2WY3B 5HHMB 4JFPA 4GAAA 3OR6A 1FRGH 1UH3A 5I9QC 5C0CE 1JF1A 4YE0A 1VADA 2A77H 5D71L 1KPUA 1EEYB 3OMAB 2B4CC 3QZLA 5GQBA 1FBIH 4KZEL 5E2TH 4PCSA 3BAXA 1LO4H 1E2WA 5HDLA 2V3EA 4FDWA 1AO7A 3TZVC 4I9WD 2AJZB 4LCCA 4ZPTB 5ICXB 4EKJA 3CHSA 1GZPA 2BIMA 4HYTB 3SE8L 3FN3A 3LKOB 3VD7A 2XWXA 1DVQA 1SBBA 1QRNB 1N4XH 2F1EA 1P6FA 5GHWH 4HZ1A 2QGBA 3Q5YA 2JOIA 3IXAB 3WN5C 3IFOA 5LGHH 3WJMA 1MWOA 1WGVA 5JIKA 4YR6A 3CBKB 2JJSC 4Z5RA 4H8WL 1UT1A 2PR4L 1N3NA 4W9FC 3UTPE 3P3TA 2X6MA 1EX0A 1Y18B 5IHBA 3ARDD 2E3VA 4KWUA 4RZCB 2Y8LA 4AC2A 1ZHLA 5EZOH 4Y4HC 2AEPL 2AZUA 4MJJA 3TBVA 3QZOA 3ENCA 3V5HA 1JSYA 2WCPA 3OB0H 4UILH 2R1WA 2GBUA 2BSRA 3AG4B 1RVFH 4QF1B 4KVNH 5HSHA 4OZHB 3HTLX 5I0YA 1UWGH 1HH6A 3OSTA 5BS0A 2CBMA 2EDOA 3CQQA 3L9RB 3DBXB 4AQOA 1JV5A 3ATAA 2KZKA 3N1PC 4F8TA 3AXIA 3FSZA 1KB9J 4EN2A 2F58H 2BHZA 3O4OB 1KXQA 3C60D 1QAWA 4NM4L 5E2WL 5D5MB 1XZ0A 3D12B 1XWVA 3MAWA 2ZKXA 4PJ5D 1ZDQA 2VYRE 4BKLA 3A3YB 3L1GA 1UZ6F 2COQA 3NSJA 4LVOC 4TN9A 1PSKL 3WNJA 3L16A 4YXKH 3GXFA 2Y06L 3ROLB 4KKPA 3OGCB 3DGGA 1DBKL 4GLRH 4WY7L 2PCFB 1SJMA 3N6YA 1TVBB 4PRHE 1S9KC 2FX7H 3K6DA 4TSAL 1INDL 2HTKD 4AIZA 3HE7C 5K1VA 2VXTL 2OTWB 3UAAA 3BWZA 2OW6A 3MLZL 4B9YA 1U8MB 2YXMA 1RULL 4RMRA 1CN4A 3QCVH 4WW2B 2ZXQA 3EGDB 3BP4A 4QYOA 2YMXH 4M6NH 1FFTB 4PRIA 3QEQA 4AL8L 1CICD 4RMUA 4KKBD 4PJFB 4TLTA 3P0YH 5CIPH 1VTLE 4R83A 2P8LA 3PHOA 4XB8A 5ECGA 1LJMA 4D9QD 2WGXA 3UZQB 5IVZA 3QQ9C 3C2SA 3WGVB 4X7FC 1QSEE 3NJJA 5IMMA 4IOFD 2VN5A 1MNUH 3NGBB 4X98B 5FUZH 3FO2A 3OQRA 1RIUL 3CBJB 3ES6A 3DURA 1OP9A 3HHMA 5J1TC 3RDTA 4CGTA 3L5XL 2VSDA 3LS5L 4I13B 4QRSB 3JTTB 1PKOA 1J5IA 2BIHA 1QPPA 2MQCA 4I4WA 4P48A 4IS6A 4IBWA 4GPVA 5KSAB 1G5GA 4N0UB 1F4XL 4WF7A 3WL9A 3K91A 2CGZA 2YD8A 3IJ7A 1AY1L 4WDIB 4MLIA 2ZYRA 4YPGB 1HE8A 3QPQC 4QOKD 2JQZA 4NFCA 4PQXA 2W65A 3AWFA 2F74A 3WFCH 3FUFA 1OF2B 2Q8BL 2YAOA 4FNTA 4GKLA 4L1HA 5KVDL 4S1DC 3CFCL 2O3OA 2WWKT 2DIAA 1CBVH 3V7AE 3IPEA 1OVZA 4R7NA 2F54B 3WMSA 3A4DA 5A16B 1CFQB 1TUOA 1EZVY 1VEOA 4M29A 4X4XA 5BPPA 5C0BD 5JN5A 4ZUWB 4Y9CA 4YSEA 4PRHA 1NCCH 3CFMA 4CNIA 4HUVA 5IB1A 3FS9A 3ZSTA 4NZJA 1BXUA 4PGCA 4UT6A 3QUKB 3EG9B 2JHJA 1ZVYA 3FFDA 2UZYA 1MRDH 1USQA 2XKUA 3QRBA 2HT3C 4HKJB 4OJCA 5CJBA 1PG7W 2A6IA 3I75A 1FL5B 1WBZB 3KJ4C 5IBUB 3ULVD 2OMTA 2RIKA 3B6SB 3T4AB 5EU4B 1Z32X 4KJYB 2Y8QA 2APVA 3OAWA 5H37G 2M8XA 4MASA 4AIXA 2Z8UA 2NX5B 1K3IA 2YH5A 3DROB 3EFFA 2NY6B 4OLWL 2PMZA 3O4OC 4O2CA 4HUNB 4NIYE 4G1EA 5KBPA 2NDGA 1ZMYA 3LKQB 3MUUA 2VDLB 4GRLA 1CIDA 4JPIB 4UINL 1NC2D 4JKPL 4PTUA 3P69A 1RUPH 4JK0D 2D73A 3AWGA 1XGRB 2XVBA 1AI1H 3A21A 4XN2A 2CDGB 2ZX6A 5E0QA 3KWVA 5I18H 2GIYA 4JO3H 4UQ3A 1NAMA 1JZIA 3VH8B 2VN3A 2FEEL 4N8VG 3DO4A 4WO4B 4HKXA 2FSEA 2P48B 4QCIB 2IPUG 3QEUB 3ZX1A 3EFDH 4LOFA 4BSVA 1TCRB 3UPRB 3I0WA 4X9HA 2CSPA 1EDYA 4JBSA 3GMQA 2ZSVB 3GMOB 5CWSA 2WLIA 5F9OH 5C8JB 3MLRL 1JDYA 2Y1YA 4Q14A 4RNRA 2BS8A 4UANA 2VDQH 5IYBP 1DQKA 2CKNA 4TTGA 2EXTA 4OZFB 1LMIA 5JOEA 5EPMB 4AQ8A 4GUQA 4ZMWA 4YQXL 3NIFB 4PJIA 3VTMA 3FRPA 1V3JA 4HLJA 1VGKB 2JI2A 4WK0B 4IRSD 2JHNA 1F02I 1J1XL 3EADA 4LASH 1EUTA 3G6JB 1WQVT 2KUTA 5AZEH 3T8MA 2X1PA 5TQ2H 3UJJL 4UU9A 3WBDA 2PWWA 2V5RA 2J43A 4U0QB 4KBPA 1L5GA 4NRYA 1BMWA 4GO6B 3L4CA 3QWQB 1OTUC 4HUWB 3ARXA 4Z7QF 1KGXA 2IF7A 1I1AC 2DB8A 2CHNA 3UTSD 4ZUVB 1F90H 1HU8A 2JJVA 3A67L 3CVIH 1GGIL 3DIFB 1J9CT 4MJID 2ZKHH 1ZA6B 2AJVL 3O2WH 4JPKL 2OJZL 2CZNA 1RUAL 5ELIA 1QR1A 1Z5LB 4Z7WB 2GCYB 5ICYA 3ELAT 3UOAB 3H8NA 4KRNA 4LBEB 3D06A 4BA0A 1KIPB 4TRPH 1YC7A 3K8MA 3GSXA 1FE8L 1XF1A 4Y4FA 5GS0D 3RL1A 3F12B 4JFSA 1O7DC 4LP8A 5BUGA 3MRLB 3REVB 2H32H 4MMZB 1TITA 4MS8C 4F5CE 2YKLL 4GAGH 3RGVA 4ETQA 3N04A 3V10A 1E4XH 2JCCE 4X9FA 1UKQA 1UZ6E 2XWTB 4NAJA 3UBGA 2VRKA 2BY2A 3DUSA 4ELMA 3D0AA 2C7UA 2JB5H 4JFPB 1EZVX 2DLTA 3VFOA 4XCCH 2NT0A 4S1DD 5D1XA 3MV9E 2JV6A 5HY9A 3QWOA 4DUVA 3M1BB 3WYRA 4X5LA 1TTCA 1P5VB 2VDOB 3BZFA 5L4JA 4LEOB 3GI9L 5HHNA 2A83B 3JV4A 1U8KB 4N8CH 1UC6A 4L3CA 3O81A 1MAKA 1UYWH 3ZHLA 5J1SC 2AJUL 3FCTB 1TFPA 1KTKE 1UURA 1Z66A 2WCGA 5HGAB 4R7DB 3WY2A 4KTEL 1V3MA 5DK3A 1MQKH 3NBNA 5J13B 3KLSA 3WJMB 1ESOA 3IGFA 1H8SA 4FZEL 1T4WA 1UT9A 3ARVA 5DRNB 4OLYL 1GJUA 5A3ID 3CSPA 3CLEL 2K8MA 5CEZL 2R83A 1L6XA 2YHGA 1JDCA 4N22A 5KUKA 3UEZA 4XBGB 4XHJD 3JV0A 1GIGL 2WKLA 5GGVH 5IEHB 2VMDA 4NO3A 2HKHL 4G8EB 3GTVA 3AG3B 2YGNA 5I1EH 4YGAB 2J55A 3OF6A 3V4LA 1MREL 5GSRA 3B4NA 4BFNA 4XNXL 1BQ5A 2HN7A 4EI6A 5AN4A 5HYFA 4N0RA 2Z4QB 5K59E 2PP8A 1D2OA 2WVVB 3ISWA 4XBEL 2FYYA 4KKLD 4XBMA 5F72S 2AFNA 3IYLW 5EU6B 1VIWA 2ZWNA 4KI1A 4MLSA 2DEYX 1U33A 4EDXB 4RFNB 5FWRA 5C08B 1Z3GH 2FATL 1WDAA 1MH5A 2WHVA 4ELME 5HVGB 4B9CA 1D6VL 4NHCL 1CFNA 5IB5A 1M5Q1 1FI8C 3Q5TA 4PLKC 2Q3XA 4K8RH 5I1GH 1J05A 2HX7A 1MCQA 1YEFH 3D1MC 1WIPA 2YD5A 3NJIA 1QLEB 1KT2B 4NLHA 4X4YA 2GSMB 4BBWA 1KC5L 1XSOA 4PLJD 4ZMPA 1AR1D 5JW4R 5FLVA 1E28B 2I27N 5CSBA 4RDQF 3C04A 4OM1H 2FNBA 2A1WL 2R23B 1JXKA 4NWTH 2JPIA 2IH1B 2OFQA 3FUJA 5EBMB 2LTQC 4WO0A 4PJAA 5IQ7L 4GT7A 3RUGA 1AKJA 2VDMB 4JPSA 1B6DA 1VZGA 5CFAA 1DANT 4W1TA 2DTSA 1DSWA 2GTZB 1HHHB 1RHHA 1OGAE 1UM4H 4RA3A 5D7JC 2PTTA 1WF5A 5E95B 3UERA 4HKXB 4ODXB 1FFOA 2J4WL 4ZJ9A 4B9GA 1A66A 5FKPB 4X8JB 1UA7A 1REIA 4L29A 4PSRA 4B9PA 1ZTXH 3GBDA 1I8IA 1OHZA 2DJUA 3GKWL 4XXWC 2E4FA 4UTAH 4MFHA 4NQCD 3KEDA 3EF7A 4POUB 3LOWA 2VDMH 4PJDA 2WV3A 5A2CA 3H0TB 3V4PB 4I4WB 5KAQG 3NCMA 1E6JH 2HP4A 3LVEA 2Z31B 3TNNA 4CDGC 3MCYA 3TO2A 3CZKA 1CLYH 3OBAA 4XP5L 2VXUH 3TEXA 5EEUA 1CDIA 4NNYB 4WKXA 2IQ9H 4BCYA 2J8HA 3EO0B 4JY5H 4ZOBA 3MFGB 3VSVA 3TEYA 4OZHE 3BCDA 2XWRA 4FX5A 2NNXA 2ROYA 4MJ6A 5H94A 5HHQB 1CC3A 3I50L 4Z3GA 4IK6A 1RPQA 2IQ9L 4DIXA 3UJIL 4DZBB 3RWCB 4PY7B 1RK0B 4JPVL 2EJ1A 5K9KA 3A47A 2CR0A 3KDMB 3LEYH 4XP5H 2OL3B 4H25A 1V7ML 3W0WD 4ONHA 5I1LA 1B2YA 2OBGA 4X42A 4G6KL 2AITA 2P9RA 2BH0A 4JHAH 5I30L 1JRHH 3KXFA 4WWPA 5JHDE 1MCJA 1UZ8B 4HA1A 4S1RL 3UH8A 1FFNA 2YLKA 4TVPE 5FWQA 3IDIA 2LFGA 5BMFL 3DO3A 1FG9C 4OFYA 3IS0X 2QHLA 3SDDD 1SRDA 1R5VA 2BHFA 3QQ3B 3QNYA 4PB9H 5GZOD 4IRJA 4UIKH 5E6ID 3NG5A 1BOYA 1KELL 4KNSA 2FUTA 1JE6A 3CVHB 4N5EC 1A6WL 2HKPA 1V54B 5DRZB 5C0RH 2B39A 4N2OA 2XKSA 4G82A 3VXUA 3PABA 4M5SA 3ZDXE 1I7ZB 1T5WB 4XE0A 3VG0H 4RFNC 1TTUA 5FYJH 1I1YB 1WFOA 3LDBC 3G6AA 4HALA 4X7CC 3SGEH 3QDGB 43CAB 1NBYA 2FWOB 2VISA 4J12A 1ONQA 1EUUA 1ZHBA 2EEDA 4QXGL 4NGHH 5FGCE 4PJHE 4AG4L 1NAMB 2WAHA 5D5ME 5C6PB 1L9QA 5F1IB 5C6TL 4XBPA 3DO7A 1OSPH 4KPHH 4HCRA 4TUKH 2XN2A 4BV1A 4F2FA 2IXQB 1FA4A 2FEEI 4Y5VC 1G4MA 5D4QA 4C8XA 3OLIA 2CHZA 5BZDB 3EO9L 4S0HA 3B56A 4H0HB 3KEHA 2P8PA 3TYGL 5I1JL 2E7HA 2ZAHA 3U36A 1IARB 5IYDP 1O0VA 3ECBB 1UD8A 5IBUG 3PREA 3EIKA 3RWGA 5IT2L 1XSKA 3Q3GA 3CQFA 5D72H 2XIIA 3QZMA 3GRWH 2WLZA 3EJYD 2Q86B 3PV7A 1A1NA 2OTUA 2ATKB 3HNVH 4XMUA 3ARYA 3L5HA 1MCBA 3NDYE 5D1QD 1A0QH 4F9PA 4P3CH 9CGTA 3AREB 2H8PB 4E5XG 4UAHA 4GQPH 4WUUA 4RX4A 2G3NA 1BFVH 3H55A 4JHWL 2K4WA 4FXTA 5GGUB 1HNGA 1M3IA 3OGCA 4PUBH 5JLZB 1JPFA 2PPFA 2W0KA 5T5FL 1INQA 1XGYH 2HTLC 2QSTA 2ZXCA 4MQXD 1B0WA 1OAUL 5DSCA 2IADB 3U4BL 3US0A 1J0HA 3IAGC 3KPSA 4EAIA 5ETUB 1IGTA 5BMPA 2HT2D 1U2HA 3VD9A 3IJ9A 3V6FA 4AQAA 3DX7A 2A73A 3P4NB 3MV9B 2R0WH 5FA3A 2IALB 4J6RL 3VG9B 2QGDA 1AE6H 4KI5C 3AQXA 3EYSH 2CO6B 2JK5B 1CFSA 4P46D 2P5ED 3L54A 3PLYA 4PJFA 4BSWB 2IAMD 3GSXB 2O5YL 4DK6A 3MC0A 3ZZQA 3QUXD 1NBZA 2WNGA 4JRYA 1J5CA 2DQHH 4AL8C 5L88H 3PAVA 5B7FA 3U6RB 3QRFM 4JRXA 1G94A 3MLVH 4MB1A 3APNA 1CT8B 1CJYA 1JWSB 1UA3A 2VJXA 4U05A 3W57A 3CWUA 5BS0B 3FF8A 3QR1A 5IROC 3ECVA 1PX8A 3KHQA 3BQVA 1AKPA 3DPTA 4ZMOA 1X4ZA 3WEBA 4AXWA 5I0DA 2MRYA 1A7NH 1LD9A 3OHMB 3N9GH 5CZXC 1PPIA 3HG1B 5KVEE 2OTPA 1OAKH 2X9YA 5GRZA 2V2XA 2PTTB 1DUZB 3X13B 3VJ6B 2FB4L 2D0AA 4JY4A 1ANUA 1GH7A 4FFVC 2YGQA 4FLRA 5DHYB 2GK0B 4LVNC 3BIKB 4FOMA 4KQ4L 2BNRD 1F3RB 1VGEL 3BMVA 3GLEA 1EFXB 1EH9A 3ARFC 3OXSB 2VRQA 4FN0A 4HLEA 3SPJA 5FW7A 1ZS2A 3GTNA 2ZPKH 1KCRL 4DPRA 1UWEH 4TS6A 1BJ1J 3A67H 3CVIL 1U8JA 4FG4A 3VSUA 3TVMA 5EU6E 3ZRCC 4YBQC 1OPOA 1PLGH 2JE8A 3LDBB 4Y9FA 1WFJA 2X6UA 4OY9A 4TL5A 4AENA 4H7VA 4S1QL 1EXHA 1PEWA 1RUQL 3BLPX 2ZP9A 2P8MA 3OSKA 1YJDC 3QS2A 3G5XA 4A7VA 4XPBH 2H1XA 5F9WB 5SWSB 3I3BA 5AW6B 2XN9A 4RZCA 1S7VA 4CVXB 4GAFB 1DVXA 2AEIT 1BVKA 4HCGA 4MDIA 4Y5VB 4EUPG 2NLJB 4YL4A 2WQUA 3BOVA 1PMYA 1NGYB 1RK1A 4GSQA 3M86A 1L4IA 4GP4B 4ZS7L 3K46A 3LVTA 3MRGA 1K5NB 4YHNB 1BZ7A 2XWJA 1LXTA 3K2UL 1NWOA 4FQCL 2B14A 5F8QC 3S7GA 4FFYA 2G75B 1JZDC 3FUHA 3SN6N 4Z7WE 4NC1E 2GEQA 2VLRE 3TO4B 3AREC 3GMLA 4M1DL 4RMWA 1AD9B 4CVZA 4I2XA 4RAHA 4UQ2B 1TTRA 3B2XA 3OKKA 4G8GE 5T1LA 4B9IA 3JZYA 1U0QA 2E7CA 1J12A 5AAWC 3MBXL 2NOYA 4NS0A 4DQAA 1BZ8A 2X4TA 5LG6A 3V79C 1CDUA 4AYID 1SOKA 2QTVA 2VB5A 1DL7H 3PXLA 1F2QA 2KC0A 4PJBA 3F8UB 2W60A 2QT6A 1YO4A 5T3ZL 3ZE0F 2N7BA 3LZPA 2JJTC 1VFBA 1BX2A 3I85A 3IJHB 4FNSA 4RISL 1A4BA 4AIZB 5HHVL 4TXVB 1UD2A 1BFOA 3O6FC 5DTFA 3UTTA 1RUPL 4MSWB 3UROR 5D7LE 4C56A 3TBSA 5CP7A 1ZLUK 4K7PH 3KPMB 3NIDB 5T1LD 1U3HB 1YEIL 3FTVA 4JZNB 2I60L 3VG9C 1P9MA 2IANE 2DKAA 4Y0GA 2XZCH 1K6QH 3TIEA 4H13C 8FABB 4WLCA 2F53E 3H9HB 5ISZD 5C9KA 2FQFA 4L1TA 4U3XA 5FM5M 3W3BA 3ALPA 3EXLA 5DJAA 3ZXAC 4HKJA 2N0KA 4XVSH 2VSKB 4XVUD 1T80A 4DP7X 1KULA 3CH1A 5GGTH 1IKFH 4FQXD 4MJ2A 2HG5B 1OB1B 1SEBA 2VZOA 4JM2A 3WY1A 1FNSL 3BAJA 2FLMA 1NBVL 4CDHA 1OIOA 4PVLA 1BDYA 2G30A 5JOFB 1Q0YL 1Q38A 3ETSA 4HDIA 5IMLB 4GFTB 1UH2A 4UV4H 1UB6A 3EBAA 2HSIA 1OY3B 2PYED 4FFWD 3VRLF 1XB8A 2NT1A 3GMRB 1T3FB 1B90A 3QQ9D 3VXRE 4D8PA 2VDRH 2IAND 1P4LA 4NUMA 3WXVH 1PVSA 4ICWA 4XO3A 1CDWA 1OAXH 4M62L 1VF5C 4QDGA 4ZK8A 4XPFL 4Q9RH 4UMSA 3ARGD 4ENZA 3AW5A 1KPVB 4LPXA 3HE7D 3MCG1 1OF2A 5KSVA 1FGNH 1DQLL 3HI1B 4ETYA 4H88H 4D3CL 3FUEA 1S9VA 4KXZI 4N2HA 2IOOA 1AJ7H 1KTCA 2BS71 2GJZB 3ZZLA 4FJZA 4Q56A 2ZUTA 5TE6L 2QADD 3IJEB 3VXNA 1NUGA 1DBBH 1ACYL 3DPBA 4HS3B 4U1SA 2OPCA 4HIJB 3O6LL 4JANB 2VDPH 3ABLB 3J7HA 1AQKH 4I87A 2D31B 1WZMA 2PCYA 3PDOB 4JLRB 3STLB 1CFSB 2MNWA 5E4AA 5LGJB 4P4RB 5FV1L 2WQSA 3RB5A 2CGRH 5IF0A 2NWVA 1FL5A 1WBZA 1IGJA 3GSVA 4JQXC 2H32A 2VMCA 2OMUA 3OB0K 3U4EA 2X6VA 5HJDA 5F89B 4TUJA 4OAWB 4YDLB 1JYNA 4XXDB 3QIBD 4UV7L 3PABB 1EJFA 1HKLL 3BPLC 1TVDA 3L5WA 4HXAL 3D25B 3WU1A 4MZIA 2E9WA 1U4EA 1Q9LB 2W9EL 4IK7A 4PGJA 3MYZA 5CEYB 4G8AC 1PAMA 2A74A 3MROB 5F97E 3CNKA 1WLHA 4ACTA 3T3PF 2OTWA 1XR8B 1SHMA 4Z95H 3OJ2C 4AQZA 5DT1H 3WDIA 4P06A 5HDBF 2A9ML 5LBSA 3LH9A 2Z8WC 2D0BA 2NY0D 4M7JH 2CD0A 4G6KH 5AVRB 5IVXF 5B3NA 2DH2A 3ULVL 2RR3A 5CGYD 1ZHLB 3CSTA 1BQHG 2V8QA 3TN0A 3RP1A 3VWJD 5C09B 4E5XB 2P8PB 2HXAA 4PRNA 1EHXA 1TCRA 3UPRA 3CMOL 3TS8A 3MJ8A 1KLUB 1H6UA 5DT1L 4ES8A 4F7PA 1H8OA 4M8VA 2WANA 2C3GA 4LIQH 4EI6B 3VXMB 3B7RL 2CPUA 4DPAX 4IIQC 3LN4B 2Y69B 1ETA1 3WXWH 1HEJC 3QDAA 4JCLA 1II4E 3B9KA 1DQDL 5JIPA 1UXWA 3IRZA 2EXWD 3KPNA 4P04A 2X4NB 3ULSA 1R3LA 3ASMA 1ZE3C 4ZX3A 3CZGA 3HB3D 2XWBA 1CLOL 2DWDB 2A4ZA 4FXGC 2BSTA 5D1ZB 4M8UA 1TPXB 2H2PC 5E1QA 2ESVD 3T8VA 4DN4H 4IOSA 3MLSL 1X5KA 3MUY1 1I8LA 3GBLA 1G7QA 5ABDE 5JZ7D 2HJLA 4DTGH 5I8OH 3EO1B 1SLWA 4A63A 1HX0A 4WHCA 1JZ3A 3QNXB 2GI0A 4G6AC 1MSPA 1FL3B 1JGEB 2CAKA 2OYMA 4TUUA 4PJHF 2ITCB 5C07B 4ESKA 5IG7B 5I17B 1RIVL 3CSBA 3CFCH 5E9DA 5AL8A 1EEZB 4GXVL 3FO9A 5DHMC 3LH2H 3BGFB 5FYKE 4JO2L 1YPZE 4NZTL 2EIEA 2I9LB 4WSJA 2F8OA 5B1AB 3VG0L 4P46B 3IMSA 4UQ2A 3NH7H 5AZ2L 1KCWA 5AFAA 3QUML 4ELDA 2EADA 5KJRH 1KY7A 2XXCB 3VVWA 2FZ3A 3A5VA 5E00B 1IC1A 2ZOKB 1PBYA 2FIKB 4N28A 4WWNA 1ZLSL 1KPUB 4E9LA 1EHLL 4YAQB 4Z3JA 5AAPA 3KW7A 4HQQL 1XCTA 3EBGA 4YO0B 4KZEH 4QUOA 2Y6SC 1BYNA 5JXEA 2R59A 2A77L 4MNQB 3GMNA 1BFOB 3A4FA 1ZIBA 5DTFB 3ZRSA 1OE3A 1WTGT 4ZMZA 2CO7A 3ES6B 4Q11A 4A7UA 1CLYL 4Z8FL 3L9RA 4PWJA 5D7IF 5FGCB 3BUIA 3HZYB 4B50A 1I8AA 1TETH 4IDLA 4BZ1H 4D9LH 2QSCL 1ZWIA 3TNNB 2V2XB 1S3RA 2A2QT 2XACC 1R17A 4Z8FH 2XG5A 4HIIB 2VH5H 3SE3C 1TF4A 4J7RA 5KSAA 1IQDA 2OYLA 3UJIH 3F7PC 1U3NA 1C1EL 4HWZB 4YDLC 3ISRA 3S5LB 1HQ4A 4NC2B 3MRIA 4FULA 4LMQE 3WY4A 5CEZE 1ADQL 1IAKA 1YNTF 4OJYA 5EWIL 1GGCL 1JHKH 5EBLA 3TWCH 5DRXA 3DYPA 2AQQA 5F96H 5JOFA 1L0XA 4QY8A 2J20A 4NN5C 3S4SB 4DFIA 2XVGA 4GSDH 3VH8G 1JHLH 1YUHB 5E6RB 4YHPB 2EAEA 5K9QI 1FNGB 5DD3H 3VFVA 2UVEA 4HWEH 4YLCA 1P0SE 1EHAA 3N85H 5E8EA 5AOLA 4DGYH 4ICXA 2NTSP 4ABQA 3E6HB 5DZPA 4BH8B 1VFAA 4YZWA 3IT8D 4QLRA 5L2KA 3G6JF 5C2UB 2XG4A 4TVPH 4TNGA 2A6IB 3I75B 5LHDA 2FR4B 5JHBA 3QR0A 5ANMA 2WUBH 1PYWA 3FFCD 5J0BA 1XGQB 4K3EH 2ENSA 3GDCA 2YEZB 1SYSA 1BZQK 2VTFA 3C09B 1YMMB 1MUJA 3O0RH 5IJVB 1N59B 1J0JA 1OWWA 5D6CB 5TE4L 1IGCH 1PLAA 5F6IB 3MBEC 4JM4L 4UU9B 1L9NA 2HRPH 5DQJB 5DFTA 3EW3B 3FT3A 5ISZE 4JLRA 1HL5A 1TPXC 2CUIA 2JKIS 4BGLA 1ZXKA 3HC0A 4H0LC 3PS6A 3FAWA 3IFNH 1BYOA 5TGBB 3U2IA 2DF3A 2I69A 4G42B 4Z7NE 4HH9A 3W0WE 3L13A 4H1LH 2IH9A 4Z7VE 2AHIA 5BW7C 1JXDA 2O4EA 3CN4A 3LQZA 4H26A 5BS0E 3IJHA 4PRBA 5IOPB 4XTRD 3SE4C 5HYQB 2NX5D 4P99A 1DIZA 3SBQA 2ZYIA 3HC4H 5E8NA 3SJVB 2YKLH 2R5XA 4IJ3B 2BP0A 4FI6A 5FYKL 3GXIA 4R7NB 1JCVA 3ZJAA 4I1PA 5FYJE 1DQJB 4IW4C 1AGEB 2DYPB 3F04A 3R06B 3DROA 3EFFB 5KZCD 5F3HB 1TXKA 1FQ9C 1NDTA 2BOBA 5KANG 4YHOH 1SVBA 4LLDB 3EAKA 3GJFH 4A7SA 5C0AD 1T0MB 4ACPA 4YDJB 4ANVA 4P2QD 2QPSA 1QZNA 4K5NA 4U6TA 5ADOL 3GZPA 5ID0A 3EIFA 5L4MA 1W9XA 4LOUC 3NZ8A 4GSRA 4HMEA 4M3JA 2R39A 3FFDB 3K2MC 2FWSA 3CK0L 1TZIB 2VLLA 4OJFH 4JR9L 3N5AA 1A7PL 1SEBB 1IGFL 2X5PA 2FJGB 2XY1A 3D69A 2WSPA 3GI8L 1UFGA 2VAJA 1E8YA 4PCKA 1U8KA 3C5XA 3BESR 4RMBA 4QXUH 1SJVA 4W70A 3I02B 3H0TA 4MHHI 3KNBB 2XJLA 4ELMF 4JMNA 3L4UA 4WTWA 3HMWL 5L8JB 3HZMB 4HHAA 1YJDL 1HHJA 1YN6B 3MBEA 1SJEA 3KRMA 3BPNB 1UWYA 1IAOB 1Z1WA 3WO4C 4AW7A 5E6IC 3TTSA 2ESVA 1L3WA 3E7JA 3RBSA 1TZAA 4QXUL 5FFGA 3QDJD 1D7BA 1PIGA 1MCSA 2FJUB 2UX7A 3ARPA 5IFAH 5KBLA 4ODUA 3OAYK 1M05B 1RK7A 2GJ6B 3WY3A 4LRIA 2N59A 2A9NL 4G7VL 5BW7A 3QFDB 1BLNB 4NN5B 4K3JH 1CR9H 2MQ3A 3RL1B 1FC1A 4O9HH 1KDJA 1LK3L 4LAQL 1OTTC 1TJIH 2XPZA 3ESPA 4UF7C 1OV8A 1XH3A 1UADC 1T7YA 3KH4A 1EA9C 4DPCX 3JWNG 1M57B 2Y1ZA 4OT1H 4WGWB 1OK0A 1QWHA 4JE4B 1WAAF 4RZKA 1YYML 4WHYH 5I18L 5EZLB 4UZUA 2E5EA 4EN3D 3VW3L 1BD2D 1WTLA 1LD9B 4XP4H 1IE4A 2KYIA 3MVSA 4XN5A 5IF0B 4YBLC 5IM7B 1Q0YH 1IJNA 2JFCA 1R3HA 3FB6A 4HHWA 4KY1H 4HKBB 1NIDA 5KANI 4NUGL 4J4PC 2X1WL 3FTGB 5GPRA 2G3ZA 2K45A 1GC1L 3C09C 3BWUC 5KW9H 3GMNB 3K1DA 1WA0X 2HVKB 4JFYA 2H4EA 2WXHA 4KROB 1HYSD 4N68A 3CDCA 5DSCB 4JJHA 1G7MA 4R7DA 1KJ2A 3VXTB 2CUAA 4WFFE 3U30B 5G55A 4PJ7A 2BW5A 5FEBA 4WJG3 4APQB 5EIIG 5TPWL 4OZHF 3W56A 3LCYA 4N2LA 1VERA 4MHHG 2A9DA 1VEPA 1N68A 1B4TA 1YECL 1NCUA 3SQBB 5BRZE 1JNHB 1CL7L 5JHMA 1MFVA 1KJVA 3RSMA 1G9ML 1VCBC 2WXQA 3E1ZA 1QN3A 3MCKA 2IPTH 3V5KB 3I6KB 4Q8BA 1F3DJ 1BHGA 3D2UD 4YQXH 3QDHA 2WBKA 2R56L 2ZD0A 2WN3A 2AQRA 3PRZA 3U2SA 3DKHA 4BINA 4D0DB 2VZVA 3K8LA 3VD2A 2R2BA 3F5WA 1B0GB 3L4WA 4HWBL 4Y7OC 3VFVB 2BIIA 5KVEH 3DTXA 5DZJA 4AXWB 2H0PA 4XN8A 4UAOC 1GKEA 4YEEA 3NIDE 3H9SE 2YSSA 1AD9A 5HHOA 1QNEA 1I7TA 3BSHA 3WOVA 3SKMB 3GO1H 1GA2A 2P5EA 3K4DA 1FFRA 3KPRA 2WO4A 4Y2DD 5C7XL 2EDEA 3DXAD 1RLWA 2XA8L 5EBWA 1OM9A 4XC1H 3W2DH 5D7IE 3F3HA 1U93B 3NJKA 3Q8BA 3VRJA 3V0WH 3FF7A 3FCTA 5FOBA 1DHKA 4MJ6B 5AVSB 3FN0L 3NEXA 1VKLA 3ASNB 3QXUA 6FABL 5E99L 4LQFL 1D5XA 4GQ9L 4W9IC 1IFHL 2APSA 2ZXBA 3D52A 4PGBA 2CUHA 2EINB 3WO4B 4WVRA 1U3YA 2PO6C 2BNQB 2X1OA 2XA8H 4XZ4A 3C5ZA 5E6IB 3UTSE 3SD2A 4Q9CA 5KWYC 4OI7A 2Z92A 4MZRA 2AQTA 4PIBA 4PGZA 3PL6D 3MREA 4FNLL 3SDCA 3RJOA 1GYWA 3WLWD 2XXGA 1CBVL 1F3JA 4G8IB 1FFNB 4LL9A 1A8ZA 2QADC 2AI0H 3HI5L 4ZD3H 4WWKC 2W95A 2VDKH 3KYMA 4FQCH 2HMIC 2YD9A 5DJ2B 1DBMH 1RK1B 2Q8AL 3NJVA 3SPCA 2JKLA 4IRJB 4U6YB 3UW2A 2R2EA 3EYVA 1HILA 4XCYB 1TZGL 4PJ5B 4E0RA 1FWXA 1TVBA 5T1JA 1KFAL 3O0LA 3PJSA 5BRZD 3BFQG 3SDCD 2P24B 4JO5A 4YBLB 2YOAA 4N2NA 2VR4A 3ZTNH 5CR8A 1P7KA 4JJ5A 5CILH 5IJKA 4YSPA 3MA7B 5EBMA 3RA7L 1UJTA 5T5NG 3DMMC 1HESA 2R2CA 2XN9D 4FTVB 1GGTA 2FL5B 4FXKA 1S9XB 3QI9D 1BPVA 1RZJH 5C09E 2RFXA 4M61B 2ZSWB 4HEMA 1URLA 4FLOA 1QFWH 4I18A 1SFDA 4CVWA 1HNYA 3QUZD 4R2GC 4DQOH 1AGDA 2P49B 1KB5L 4R7VA 3PYCA 1MWAA 2R1WB 3I6LD 2GSIB 3PIQA 3ABZA 3FO2B 2DY2A 5J7CC 3FXIC 1KCSL 5CSGA 2BERA 4X4MA 4ZZKA 4ABUA 3QJOA 4YPJA 4GIPD 4JFEE 5ALCL 5DVOA 5GS2H 2X4OA 5JIDA 4ZQKA 1PX3A 2JF1A 3BYYA 3NDZE 2HLAA 2NNFA 5AUMA 5T3XE 2QKSA 4OFQA 3T04D 2Z31A 4BWWA 2BHUA 3QUZA 3QORB 1CD1A 3MGOB 2MH4A 4OJEH 5EF1A 4NQXB 1ZKAA 2OTUB 1I3VA 2ATKA 3FQWB 3P11H 1AMYA 1B4JH 4LNVA 2FR4A 1PDKB 3TA3A 1UXMA 3CLEH 3TZVD 4ZX4A 5IMOA 1SY6L 4BQCA 2F54E 1WP6A 4GEIA 1TO4A 1UZGA 3LPOA 4WIQA 3GMMB 3X1FA 4JHWH 4L4VA 4B0MM 2CO4A 2C9XA 3MUZ1 1JZ6A 1BZ7B 3TT1H 4JY6A 5JHAA 4WTZG 3CZFA 4N2IA 5DF0A 4UAOB 3BYTA 1NDMB 2F1BA 1ZVSB 2NQ3A 4HHGA 3KM2A 4APXB 4ZAKA 3MROA 3VA6A 1WJWA 5T1KA 1A1MB 1SN0A 3KWWA 4QRUB 1JK8A 4O51B 2RGSA 1OE2A 2A73B 4L1BA 4WEMB 4PBDA 1Q9UA 1JGUH 3FDWA 3R7RA 3ILEA 3RZWA 2AVGA 3H9SA 5BXFA 2BSDA 3MV8E 1EAPA 3RPIA 3T2PA 2IIJA 4D94A 2Q7AA 2UUDH 3JV6B 4G9FE 3FONA 4HXBL 2HJKB 5CCHE 5IMMB 1P2CA 2E7BA 3NIFE 4HIQA 4DZ8A 4H8HA 5ADPL 4LSRH 3DJ9A 3DURB 3G6JE 1QBLH 5FDYA 1JN6A 4HP5A 2PO6B 1Q90A 2E74C 4NO2B 1PEZA 3CXFA 5DLMH 4F8OA 5ECJE 2OK0H 1DN0B 2NYYD 2A5UA 2G60H 1ITCA 4I8OA 2FKFA 3G6AB 4Z7QB 4I2XE 4X4ME 1QRND 2OZ4A 1K6QL 5EH1A 5HYJB 3C2AL 3CC1A 1L7IH 1UOWA 4H88L 3RZCC 4D3CH 2B1HL 5D1ZI 5GGUA 4P9MH 4XXDA 5EPCA 4WXAA 4TQ8A 2P43B 4MXVE 5SWQB 4N1CA 4KJQC 2XTJC 3DOSB 3VI4F 1CGUA 5EUOF 3QPKA 2ZUVA 1BMGA 4YNYB 4OD1H 5FO7A 4G59C 3S3SA 4L5FH 4TSCH 4O4YL 1QNZH 2DQDH 3QDJB 2DMKA 3CN0A 5FA3B 3DGCR 1WT5C 5AYTA 2ZXAA 4YL9A 4CU8A 4N3TA 4TNWF 3QXWA 2HJFA 2GJ6A 2QVIA 4R2GB 4AQ1C 1ZS8A 4JAMB 4AGPA 5I1HH 5DUPH 2N7AA 1JZFA 3CFQA 4OCXH 5EIIB 4BFJA 4RMQA 1UH4A 4FNQA 3O4LA 4HMDA 4HS6A 5E1GA 2JSFA 3QXAB 1A4JB 1ED3B 1KYOJ 4ILDA 2ORBH 4KO6A 3RG1C 5HHPA 2XDHA 1QLEL 4KK8C 1NCWH 2DKSA 4KJYA 4ZPVA 3DHPA 5DRZA 1A6WH 2EYRA 5E6UB 1OM3H 3UGEA 3T09A 1ACZA 3DPBB 1KB5H 3HUJB 3OWEA 3BVXA 1KELH 2NUPB 2WUCL 4PY5A 6CGTA 3IWUA 3FQRB 2XZCL 2D8KA 2ZCLL 3LS4H 1GL4B 4NENA 4XXCC 5I75C 3EH1A 4YHOL 3VNZA 1J86A 1L0YA 4AYSA 3O3AB 3D3VE 3VI4B 3GMPA 4NP4H 4BK4A 3N89A 3O4LD 4MVBC 5HGDB 4L4TB 1CL7I 1SXBA 4ZTPL 2L04A 3QUHA 4QRRD 3SCMA 3TO4A 3UG5A 4ZFQA 4NKQB 1XGRA 4DCQA 1BVOA 3O3DB 2WPGA 2YD3A 4DN3L 1IBBA 1U8LB 4XN4A 3RVVD 2RB8A 3PHAA 3KPQA 3PV6A 4M4RA 1N19A 5DJ2A 3CVHL 2XHNA 4U1NA 5DJXA 3QO0A 3BSZA 5EORL 1FL3A 2FSEB 2DQJL 3NSFA 3MXWH 3NIDF 5E0FA 1G9HA 2CKBL 2B15A 5TF0A 2TRHA 4GW1A 1V7NL 1RUKH 5AEAA 4JFZH 4UT9H 2E76C 1MCOL 4ENEC 4R26H 3SKOA 4BFFA 1JXGA 2IBBA 3QUXB 2A1WH 5A43C 1BZOA 1RKRA 4OB5L 2EDJA 1LO0L 3MV7B 4DKDC 1WAEA 3QIBB 3US1A 3TCTA 2XBTA 4NYLA 1BF2A 1CG9B 3MJ9L 1BECA 4IIQA 4JFUA 1MLCB 2ZG2A 3EJJX 3NYKA 1LO2H 2WWOA 3S3PA 3QAZC 3QQDB 2BP8A 3SDAB 5F93C 4DP9X 4TNFA 4A7TA 4FFZL 4ADJA 1A9BA 3T2NL 3KPSE 4O2EA 1IC5H 4WFGD 5AOIA 1NM4A 4HUUA 1XZWA 1TT6A 2LV4A 1RAMA 4M8QA 1ZTXL 3CTTA 3L2MA 5AYQA 2J21A 4TL4A 2KERA 4LLVA 5I1CL 2FEDD 3NT0A 3PHSA 2BOLA 1N3CA 4PWKA 5DK2A 4HWEL 3HN3A 4YN3A 2HPTA 1ZDSA 3V6FB 1MQ8A 5DMJB 5F1NA 2X3AA 2NY4C 3I6GB 4Y89A 4ZDHA 1HYSC 3JTSA 2NY5L 5L0QB 1INEH 5I6LA 4Q7DA 1PCMX 5GRWA 3NH7L 1WE5A 3EUUA 3OKLB 3D8MA 2IGFH 2YRZA 1MF2H 5CUSL 2ZUXA 4G8EA 5CXPA 3L7EB 3VWKB 1E6OL 4LKXA 5D6DC 1RZ7L 4XMPH 3VGGA 2EDLA 5T3ZD 2DEWX 4WI5A 2DM3A 1DE4B 3T0EB 4QPEA 2Y5TB 1IEBB 4OLUH 2HLEB 4AQ1B 2BMKB 4GKOA 1S5HA 3V0FA 1MG2C 2JNZA 3K6SB 4J27A 2AK1L 1DQMH 4X5WB 1FH5H 4TNWK 2NLJA 2O5XH 4X7TB 4N0YH 1P5UC 4KK5C 4BA8A 3FAXA 2W07B 5EC1B 5SX4I 4DETA 1JGDB 5GRUH 1YLBB 2W60B 3BUQA 4I89A 3THML 5I2IB 2X44D 3VXSD 3H7LA 4QHPA 5BVJA 1UD3A 2DTML 3MA9L 2OULB 2G60L 3FHQA 4PEEA 1NCDL 5HDBB 1UL7A 1W72H 1EEQA 1KGCD 2GKIA 4C56D 1HN1A 1JNJA 1VFOA 4TULL 4NGHL 1E4XL 4PJXF 2DLEA 3AS1A 4O2FB 1HQ4B 1AKJB 2GITB 3E8UL 4ZMQA 1KNOB 5FUOL 5L2KD 4ECNA 1N0LB 3T3MF 1IJ9A 4FZ8H 3GSUB 3F58L 3L4ZA 3IPBA 4IMLB 3CH1B 4NO3B 3FU3A 3D18B 3BN9D 3W9EB 2DDQL 3MPCA 4PS4H 1PQZB 5BZWA 3Q8AA 2R15A 5CIPA 2VQ1B 5K9JH 4WI9A 1B3JA 2H4LX 4IBVA 1P1VA 2YMXL 3L08A 1JV2B 1E5AA 1UEYA 4QOKE 5CEXA 2DQUL 3QUXC 5GRUL 3FULA 3VRIB 3LXAA 3V4UL 3GI9H 3QIBC 1DBJH 5DZNA 2I32A 3GRBA 2DKDA 4EAEA 1KXVC 4MZ3A 5DQ9A 1DQQA 4NRZA 2VDLL 1G6RH 2D0HA 2GJ6D 5I5RA 1FNAA 4P2RD 2PR4H 3EBIA 1CLZL 4ZXBB 3T1FA 2WNWA 3TBYA 1NUDA 3JTBA 5ESAA 2HT4C 3KCPA 4PJHB 2CH8A 3H3PL 3HMWH 4KHXL 3WIFA 5JHDA 3DX8A 3SJVD 2X3CA 4HGMA 4K23H 5SWSE 5AKSA 4EPSA 1KFAH 3AY4C 1KBKA 5FUOH 5BVPH 1YEGH 4G7YH 1KCVH 3FQRA 4WUUD 4D9QE 5IJCC 3I50H 4ALAC 1LE5A 2VLKD 1KB3A 1QW9A 2NY4B 2VO5A 4HIEB 4Y19D 5E9DB 3FTYA 2FBOJ 3BKQX 1VFMA 3FH5A 5CEYA 2O61A 1FHGA 1TQBC 4QHKI 3HE6A 1PFOA 4ODTH 4PP1C 1J7VR 4AEHL 1JI1A 1I53A 1ZCRA 2F7QA 3OSVA 3ZHNA 2IWFA 3AS2A 3FO1B 5F3BB 2N1TE 4NEHB 2VE6B 2W1NA 5HYQA 2WKGA 2ZOKA 2NXZB 1I8KA 4PSPA 3P0GB 4X50A 4KKCC 2O30A 3U4EB 4Z0BL 3VGEA 4HAGA 2BVQB 5D7IB 2PO6A 1D7DA 3MRQA 3VX0A 1NEPA 3AGVA 4RISH 2HAZA 3GKWH 4FJYA 2N0MA 5E1HB 3H2WA 4R4NC 3RL2B 3T0EC 3FQNB 3WEOA 3CVTA 1T0MA 2PETA 1QEXA 3QDJE 1A3LL 1YJDH 3JQOB 4NWUH 4WAFA 5A2KH 4RA0C 4R4FL 1G1OA 4ODWA 4PLKD 3TO2B 4B6ZA 1J5OH 2NRDA 5JNYB 3C8HA 3MOAH 4GRMB 3S88H 1CU4L 1P5UB 1QFUH 3EOBB 3SKMA 1NIFA 3PDDA 5FF6A 5H2BA 1WWWX 3RNKA 3MV01 1TQWA 2IGFL 3DPUA 5F1IA 3VFUB 1KMGA 3MJ7A 3GRWA 4WCYH 1S9VB 5GGRY 1S2EA 1RSYA 1U95A 4JO4L 5IGXH 3VXOB 4BFOA 2YD0A 2OMXA 4OJFL 3LKOA 1SOSA 2PR9A 2IEPA 3CLWA 1O75A 3H2PA 4P57B 2X4SB 1ICTA 2CXGA 3ZYIA 3D5OF 1EAJA 1BQHB 1IT9H 3TFKD 3WTVA 2A6JA 5I16A 4KJWC 2WJ5A 1E8WA 4H8PA 3ARGB 1WBXA 3KPRE 1JTOA 2B8OT 1P84J 4R2GD 2PPEA 1JNHA 3EOAB 5F88B 3FUIA 3MREB 5KBMA 4DGYL 2ICWB 2UXGA 2GEEA 4ERSH 1P69B 1ZLEA 3CSYA 1BQRA 3JWNE 4HJ1A 5B22A 2DLGA 5H8DA 3IJ8A 3R1GH 1YRKA 4NDMA 1I8MB 1R5VB 3QQ3A 1KGIA 2AXFA 3KPPA 4U7SA 1Y0LA 3OKEA 2V2TB 4HCRH 4IOSD 5DLLA 3QG7H 3AXHA 1MRFL 1XO8A 3GBNH 3LB6D 3OKDB 2IDFA 1A6VL 5BS0D 5DU7A 3NQIA 2DEXX 4MA3A 3FC8A 5D2NB 4BK8A 5IB2B 4J3WA 3VXMA 3W9DA 4JFWA 5ITBL 1TQCB 2XXMB 4WWOA 4JM4H 3H56A 4NLAA 2DI9A 1DVZA 3IU4H 4ZXBC 3MV9A 2UZIL 3FQXA 1NLDH 4K7PX 1P4IL 4UZGA 4F20A 2BNQD 3SKJH 3WN5A 4R7LA 3SGJA 2EVFA 1NCNA 4P2OA 4XP4L 3BIAX 4B5EA 3H4HA 3VXPA 5HGGS 4ZNCD 2NXZD 3GSNH 4LT7A 1MWAL 2XV0A 5D1XE 4KHTL 1AD0B 4NQED 5IBLD 5GRJH 4D7RA 1PD1A 4Y4HA 3SPVB 3VXSA 4AL8H 2QQNH 2OR9H 4M03A 4TF4A 1TQBB 4NHUB 3LV3B 1T1WB 1KCUH 2QVTA 4M1CD 4DVRL 2AJ3B 1KWGA 3NPSB 2WW8A 3RAJH 4HS8H 4MAZA 4N8PA 4U6VL 1T1ZB 3HHSA 4DGVL 1RJCA 3O6KH 4NSKB 2EUXA 3KBHE 5AW5B 2W9LA 2VXSH 3BVNB 2NDFA 2NXZC 4G9DA 1OP5K 1MREH 4H1LG 3MRKA 5F7LB 1JHKL 4N0CC 4L8CB 3FHEA 3CHPA 2C3VB 3SQOH 4YO0A 4J23A 4L8BA 4EI5B 2PYEA 3LEXA 5I5MA 3EZJB 3CVSA 3APDA 4KFZC 4OIIH 2DBJA 2FD6H 1HWHB 1A2YA 3ZE0B 1N59A 4NP4L 3KNBA 2JI1A 1I31A 1ZA3B 1NGWB 4U6HA 3O9WC 1HQRB 4BRJA 1LK2A 1WSST 1P9MC 3VXME 3GZOA 2DIEA 2H0EA 4NQSB 5LGYA 4I18B 3QJXA 2QR0B 3V52L 5DS8A 2YC1B 2VZ1A 1VTOA 1CF8H 1QN6A 1BAFL 2NX5E 1KCVL 2ADFH 2ICEB 2BHYA 3DJTA 4PGBB 3GK8H 4Q2ZB 3ARGC 3BT2H 3IBEA 4FYTA 4PD4K 2QL1A 3RJDA 2D0CA 4EJ1C 2VERA 3C5SA 3HBGA 4LO9A 4OZFG 3SOBL 3EYUL 3VCLB 5KSBA 2I07A 3ENEA 3EAYA 4WFHE 3QI9B 1T83A 5LBSL 3BVUA 3FQWA 2Y7SA 3HC0B 1C5CH 4LSPL 3K71A 1RY7B 4JHVA 5EO0A 4MNQD 1FO0B 1GZQA 2F58L 5I24A 1UWXK 4JM2F 4BKTC 3FB7B 5D7KE 3BKMH 2O6DA 2ZOOA 3T8XB 4L3EE 4X6DA 1W15A 2F53A 2X4QB 4I0PC 2V9TA 5EUKA 5D2NC 4HXAH 3BEVA 1J8SA 3V0DA 3CXHK 1Z0NA 2VKXA 2UUDK 4IRJD 5B4MD 3OHXA 3WLWC 1BXXA 3TYFA 3CGTA 4GRLB 3UTTB 3V8OA 1DQDH 2Z8SA 4BSJA 2Z6FA 4L0YA 3HMXA 1MVYA 4HOXA 4UYPA 1YQMA 2K78A 2SEBA 1JK8B 4HLZH 2FX8H 4O51A 2BVOA 4PJFF 3QDJA 1U92A 3QHFL 1KNOA 4RIRA 4G6MH 3TE5A 2ZSWA 4AY0A 1GY1A 3Q6GH 1D5ZB 4JFOB 3NK3A 3T0DA 1NOFA 2V5MA 2ED8A 3QZWA 3REWB 2DWXA 1ACYH 1F6AB 1ZT4B 4QRTA 1A6TB 1BQLL 1QVOA 5AVQB 2OSXA 2ZWKA 3ET9F 2AQ3A 3IDYB 4J3TA 4LLUA 1SLXA 3QJHA 4GW5B 2XTLA 4ES9A 5EEYA 1J9RA 4X5QA 1YMMA 4LKCB 5IJVA 1MIMH 2ICES 3P73B 1AKJD 4XNMA 1GGCH 2XY2A 3DETD 4N8UA 2BWIA 1MG3C 1RMFH 3ARGA 1DQLH 3OLDA 5HYSA 1SZNA 4ZOCA 2QKIC 2HL8A 1M3JA 3QUZB 4X7SL 1DVUA 1FH5L 1T7VA 2EZ0C 3ARDA 1XF4A 3T1FB 2E4TA 3OR6B 2C1OA 3LNIA 1MCEA 3VMNA 3FH7A 4EI5C 1FZKA 2BC4B 2YFNA 3T3PB 1FLRL 4AKOA 5IUCA 5F7UA 4DP4X 1IAII 2NOLA 3PWJA 1DR9A 1XGUA 4HGKC 4KK6D 1HOEA 2IDCA 2WO3B 4JO3L 3TU6A 4YXHH 5J6HA 3DMMD 4ZMAT 2AJSL 1IILE 1ZOXA 3DK0A 1NLDL 4HV8B 2K6ZA 4C54A 3O9WB 2E8ZA 3AITA 5CILL 2BOBB 2XVKA 2YPVH 5I8EA 4KUCD 1BOGA 1FF5A 1T22A 5H37H 1E30A 1EDHA 3B8SA 4HS3A 3MNMA 2X1XR 5I26A 1XF5A 4I3SL 2CO2A 2CG9X 1U58B 1JMXA 2LQRA 4L48A 4P59H 4NZ8A 5DD1L 5CBAA 3DXAA 4GI8A 1CG9A 4L1DA 4YDKH 4GG6B 5HYJD 5HPMB 4GNKB 2WLMA 2IDTA 1C5DB 5I1IH 1QI4A 1UA6L 3C8DA 1DBML 4MXQC 1Z2KA 4KO9A 4M7LT 1KCUL 2VDKL 1IL1A 3L4XA 5KS9A 1CCZA 5HI5C 2CK2A 3D85D 3MSPA 4ZG1A 5I1DB 2BWQA 4LNRA 4C55A 2MPAH 4ZPTA 5I6NA 3ABKB 2CNZA 4OV5B 2EDWA 1NCCL 4U1LB 3BGMA 1RJYA 2D7NA 3UEQA 5F70A 3P2BA 2R9HC 1T1ZA 3HHSB 1GCYA 1P6AB 1DVYA 3DJZA 3PAYA 3QEQD 3UYPB 2FATH 3H42L 5HGDA 1QKZH 3SCMB 5FDWB 3ZR5A 4OCYL 3AACA 4YMPA 3F7VA 3KL5A 1WUZA 3O3DA 5DD5L 3PQYE 1T03L 1BVLA 3MV7D 5SV3A 1DVFB 3FT2B 3QJSB 4I0PB 5MHSD 1I9RL 4R26L 4PWIA 3NJNA 1IC4L 1MHHB 3VRJB 3S5ZA 3S8WA 2CHXA 1KEGH 3L7FB 4GRLC 4LPCA 4OLXH 3ARBD 4FNUA 5BOPA 1KJ2B 1OCZB 4H2CA 4MNQE 4HAKA 2WINA 4CGUB 3COOA 1DP0A 4MAYC 4YX2H 1IM3A 2O5ZL 3WHE1 4F7CA 1F4YL 2OYPA 1AIFB 5DFVD 4MA1C 2J2ZA 4ONGL 4N5UA 1IEBA 4QRRA 2ICWA 3PNWB 5CS7A 1KUMA 1A9EA 1MY7A 1PCXA 2PWEA 5CCJA 5FUCC 3HFML 3NIFF 4QO1A 1F56A 4LCWD 4L0ZA 4DNLA 1NEUA 2QPUA 1HSBB 2UZYB 5EZJB 2DLFL 3KLKA 1NEZA 2V7HB 4BFGA 2MOVA 2NNAA 4AMXA 3UZQA 5JORB 1FFQA 1A4KB 2EDXA 4YWGL 1J0YA 4PGDB 5B39A 5GSRB 4M48H 5KBKA 3DX4A 3GTTA 1UB5B 3IJSA 3RFZA 5IQOA 1YA5A 2V2WB 3DHMA 4W9JC 4L4VB 3LD8C 4LAQH 4I1RA 2NSQA 3QPXL 3MLXL 1S7TB 2QVFB 3QUZC 2ZX5A 1NGXA 4HOWA 3C5SB 3VM7A 5LXVA 3QIWC 2P46B 1TTFA 5EZOL 4MYWB 2VR7A 3FQXB 3PWVA 3KYNB 3MMEB 4PREA 1U6AH 2CO3A 3ESNA 3PP4H 2NZIA 3EDJA 1J5OL 2OX5B 4NUJA 1W0VB 4R4ND 3T0ED 1G6RB 2WQVA 2C8NA 3IWVA 3RDTD 2RFXB 2KDYA 2TSBA 4YPGA 1IRAY 4A2FA 3Q9QA 1HEHC 2IWGA 2W65B 4XCFL 3FPXA 1BIHA 2CDFB 2YOCA 2YS4A 2Y7OA 5JW4Q 1AGDB 1K5WA 3TPUB 2NY3D 2VQ1A 1UATA 3C5JA 2MIZA 4I0KA 2Q2EB 1NC2A 1GZHC 1FE8H 2BX5A 4PJ5A 3DOHA 4KMTL 1U8MA 2QEJA 4BZ2L 1HZKA 3A6OA 4PJDE 1DSFL 5E9DE 1BW8A 3GD1C 4AQ1A 4Q9RL 1I9JH 1DQQB 3QB7C 1M71A 1HWGB 3EDEA 3CFJB 4PBVC 4NKIH 4AWJC 5ADOH 5IHLB 5K9JL 1PG7L 2IOMA 4OFPA 4EE2A 4G7VH 1VFUA 2HJLB 5IP4A 4OQ1A 1FVCA 2D0FA 2O6PA 2R9HD 1F13A 3AUVA 2Q7NA 4V2BA 5E2VH 1YMMD 1QW8A 2IBZY 4UQAA 2HT4D 3PG2A 1E5UI 1MWAB 3SPGA 2D3NA 2OMYB 4UDUB 3FO9B 3D6GA 2DJ4A 1KJ2L 3VU2A 4U4IA 4O4YH 4XP1L 2XNAB 5DD0H 1CXIA 3Q6FB 4LGSB 2X7LB 4Q6IC 4FQ2L 2J44A 2HZSA 4GP8B 3HR5A 1NA8A 2Y6SD 3NMEA 3QUMA 4Z23A 4PTUB 3SSGA 4RQQB 4XX5A 1AYRA 5CGYC 3KGTA 4GKZA 5KSUA 1NANH 3LY6A 5AUMB 4FXKB 2BNRA 2ZKHL 1VRSA 1N8ZA 2KDGA 1UOVA 1NCIA 1EUVA 2FIKA 1H0DA 1NSNH 2XFXB 4BH8A 4HS8L 4BZYA 1G7JB 1FNEB 2W9DH 3L9YA 4N8CL 3Q2CA 3VTTA 1FN4A 4YUEH 1YEIH 1XR9B 5JTWA 2Z7YA 3EJYC 5DZLA 3HUJF 2DQGH 4D2NA 2NZ9D 5CU9A 1FIEA 1I1FA 5I23A 1NFIA 4XMLL 1MFCH 2GB2A 1HILB 3LX9A 4XCYA 3WHE0 4AYFA 2VN7A 1SYSB 1RQ5A 3BGAA 4MA1B 5JO5B 5KSBB 3BH9B 2AAVA 5J1AA 5I6XC 1TTGA 3D34A 5ERWB 1ZHNB 4ELMB 4HEME 3O45A 4KJQD 1AGFA 1EZSA 2EEFA 4JMXA 3SKNA 1KJMB 4YFDB 1NFDB 1S9XA 4OI9A 3IKCA 1KPRA 1S7QA 3I0XA 4HJJH 1JFQL 3W37A 2DMHA 3CU1A 5B3SB 5BV7B 2MTAA 5GJTL 3BKJL 3NUKA 3EDKA 4HC1A 3CDGA 3L1FA 5D1QA 3S3CB 4JR9H 5A6IA 3VM5A 3QO0B 2V3FA 3BAEH 1F3DH 3QIWB 4P3CL 1LTXA 3PL6C 1I1CA 3B2MA 4GBXC 4RWHA 1JWUB 5CLTA 5D2NE 3D3VA 1I85C 4AM0B 3IDGA 5D1QE 3W11D 2K6WA 2MMXA 4LGPB 1TEYA 5CGMA 5J5EA 3G5YB 1WRFA 4LAJH 3IVKA 5E4EB 1AZRA 1SYVA 3QRLA 4WV1B 5EUOE 5KYYA 3MV7A 4HUCA 4S1RH 2IXQA 5D2LF 4Z7WA 5ICYB 3VI3A 4W68A 4P23C 1XEDA 3EJCA 5F7AA 5FX3A 2F1AA 1SJHB 3BVVA 1ZJAA 2VXQL 4K94L 4CUCA 1NFDF 1NGPL 1YEJH 4TVPL 4FFZH 4RAVA 2BNRE 4IBZA 1RZ7H 1MW0A 2E6JA 3D69B 2A6KA 3LQMA 4XRCA 5JZ7C 3E2HB 2YEZA 4FE9A 4IBTA 3KW8A 4FF9A 5AW9B 1G1KA 2UZIH 2HKAA 4LCYB 4EBQH 1VA9A 3SB3A 4NNXB 2J6EH 3G7TA 5TDOB 1T6AA 3ZE2E 3ECUA 2NW3A 1BAGA 4OQTH 3HE7A 1BFSA 2DMBA 2EQDA 3VYPA 3D0VB 3N40F 2TAAA 2CBTA 3EFDL 1E4XI 2RCSH 3R19A 1P5VA 3GB7B 1J48A 4EDWL 4TUOA 4E41E 2HA1A 3FU9A 3T0XA 3BWSA 4JKKA 1IMHC 5D2LB 3RX8A 1YTFA 3QEGH 1VACB 1FZOB 2H26A 5ABAA 4KKNA 4PJBF 3NN8A 1QFHA 1G9NC 4OZ4A 4X6CB 4EKXA 1HCZA 3LV3A 5T3XL 2HZMA 2BOCA 3RU8L 4FXKC 5E5MB 1JV5B 2R4SL 1ASOA 2DLHA 3B7YA 4HJSA 3QUXA 3PU7A 3S98A 2HLFC 3VI4A 3P3RA 3T0EA 4HF5H 3K80A 1C08B 4NYLB 2BMKA 4J3OH 3PUCA 4ODTL 1TTBA 1EEYA 3HC2A 1PZCA 2A83A 4OFIA 4AZUA 1MPGA 3QXAA 2VQUA 4KTYA 4S11A 5KVEL 4L8DA 1A9BB 3LIZA 4G5ZL 1MCOH 4QHUB 4FFWC 5FCSH 3V0AC 3TJHC 2H45A 3LKRA 4FKKA 4OCWL 1BV8A 1X5AA 5D93B 4ANWA 5I6XB 4HF5L 4OFKA 2HH0H 5LAPA 4OCYH 2XCMC 4LGRB 3KGRA 4RAUB 1UXSB 5JHLL 1MELA 1TJGH 3WV0A 4AVKA 1N64L 1NH6A 1SXNA 3GMPB 2L7JA 5DJYB 4Z5RB 3C75A 3I6GA 5D96B 5DD6B 3X17A 1W8EA 4XMKL 5C0GA 3M1BA 2I9TA 4G6ML 1ZE3H 5AVXB 3BE1H 4N1EA 3FSVA 32C2B 4ZFZB 4EVNA 2Y2WA 4L05A 5C2BH 1FVCB 1LEGB 4X8CA 3UAJD 1EJOH 3FN9A 4OZIA 1PLCA 2VR5A 4XPTH 2OYKA 5CJXC 3INUL 3Q01A 4GBXB 2VDRB 2H3NA 2OP4H 4WSKA 4NJ9L 1P6WA 2Y2YA 4FKEA 4HUXA 2OL3A 4GINA 3RWFB 3H4FA 4AGNA 3TASA 4XNBA 3M8OH 4JB9L 3TV3H 5E4EC 1GS6X 3GYRA 1UQSA 5ID1A 2AEOA 1OE1A 3JTTA 3STZB 1OSPL 2R1XA 3BN3B 1C5CL 4KOBA 4PWFA 3WNIA 1BVKB 4Y5VA 4P23B 3KZ8A 1DO5A 1KZQA 5GISH 4DKTA 4N9GA 1RIVH 3D39D 2WLLA 1NCAL 2NNAB 4M5ZH 4NZRL 5J12C 2XTJD 4YGVB 4OD2B 1TOXA 4TPRH 1YEFL 3WL9B 4FTDA 1KXTB 3MRDA 1XR9A 4K23L 4NKOA 5CKGA 2HMID 4ZFFB 4FZEH 1AG0A 4CKVX 3OKDA 4KC3B 4WI6A 2HCZX 3RIAK 4ZMYA 5ICUA 4G70B 3MLSH 3TVMD 1GRWA 3OMIB 5C0RL 1JJUA 4GW1B 4WTXA 3WS3A 1LK3H 1I1AD 2AJUH 4PJDB 2ADGB 1MVFA 3B2DC 3KCWA 3VXUB 3BZEB 5ERWA 4FQXC 1MEXL 3WEXA 3C08L 4MJ4A 4YZFE 1F58H 2F18A 3B83A 4N90E 1PLBA 4UNIA 1BBJB 2DYPD 5PAZA 3G6DL 4O02H 1ONQB 3RZCA 5FYJU 4OIAA 3Q06A 2EH8L 3P9LA 3FMGL 4ANXA 4KDVA 5DO2D 3HG0A 2XWDA 5FA4B 1WZAA 2NY3B 1ZT4A 4QRTB 4TQEH 1Q1JH 1CXKA 2VWEE 3DVFA 1THCA 5C0EA 4OIIL 4AC4A 3DTDA 3Q2NA 4PB0L 3OR7B 1BWWA 3TBBA 1W80A 1O6VA 3TEUA 2VRAA 3RDTB 3ZKSD 2F7PA 3VFNB 4KK8D 1F2XK 2CLRB 4K71B 4M56A 2HTLD 3W5MA 4R84A 5MEPB 1X7QA 4KKBC 4R96A 4TV3A 2RHEA 5FO9A 4HD5A 3RWEA 3WFHB 5JIQA 1XSZA 3KWTA 2VAAA 3W38A 3OZ9H 3MNWA 1FYHB 1NGQH 3D87B 2EEXA 1Q94B 1UUSA 3IDIB 2NY5H 3QUGA 4JG0H 3ZHKA 1U8QA 1HKLH 2OSYA 1A25A 2AQ1A 3N1GC 3DJSA 2WYIA 4Y5YB 1SFHA 4WDIA 4OR1A 1OT4A 1LMKA 2WTPA 3RNKB 1E6JL 2YXFA 3T8XA 2AK4A 3GSUA 4OIFA 4OBSA 2OQJB 5FHBL 3ZGIA 5T33L 4KK9D 2VN4A 3QIUC 3QJZA 1KCLA 2QVKA 3ML9A 1AO7E 1FGVL 5K9KB 1SLUA 2NX5A 3V4PA 4UNVA 3Q6FA 1ZSDA 4K15A 4KO5A 1CFQA 3DDFA 3K72A 2O93L 1XBDA 4U6XB 4XCFH 2GJPA 1DE4A 2BCKA 1USZA 4X5PA 3GMQB 2A6JB 1YYLH 3RY5A 5EO9A 1A3RL 5H4ZA 1DZ0A 5F9DC 3OPZL 5HJGA 3TEZA 2XWZA 4YFLF 4GAJL 1JPGA 3EG9A 4TLUA 3QUKA 2Y0SA 3QYCA 3W0WA 5HDQH 2D0GA 2EDDA 4HFWA 2V9RA 4K2UL 2VR8A 3B9KD 1FYTB 2HRPL 3KYMB 3L3OB 4MJIA 1OCRB 4MAYA 4MXWH 1BIIA 2YRBA 1L6PA 5LDUA 1U2CA 3L3DA 2YPLE 1OAZH 3LNDA 2CJUH 4U1HB 3O2WL 4F2MB 2VLRB 4FEIA 2PP9A 1A6ZB 4YHMH 3OCIA 2JKXA 1EHNA 3ZTJG 1QHOA 4V33A 1SGKA 4RRPG 1S7XB 2XBDA 4GMSL 2CJSA 3CZEA 3S2CA 4MXVF 4W9DC 2ZT9C 1VPOH 5DQ9B 3BUYA 3S6CA 3RHWF 5J12B 5CZKA 3B2PA 1H15B 1FAIL 2PCPA 1IBGH 2JJUA 6FABH 4KDWA 2AJYL 4KUZH 4WUUB 3SNSA 4EXPX 3GSQA 3X13A 3BFOA 4UYQA 2OXHB 1OP5H 4OTXL 2BDNL 2WC7A 2EYTA 4NX0A 4CU7A 1M7DB 4RX4D 3BLKA 3W9EA 2L8AA 3U6XA 5D6DA 3V7AG 2X12A 2PW1A 4MNGE 5DJZB 3WO3B 1I7ZA 5AWNL 4L4VE 5HHMD 1R5IA 3CDZA 3RGVB 4ETQB 4CJ0A 4DGVH 4EI5D 4AGLA 2O61B 1IM3B 4OD3L 4H20H 5C8JA 2WBJB 4N0CD 2NZ9C 3LPPA 2W92A 2DQFA 4HUMB 5D7JA 4PTTB 1T03H 4AUYA 1FL6A 2NY1D 3X11A 3IETA 4E41B 4XP9L 5AW4B 5DVPA 4TYUA 1J0KA 4TSBH 5D9SB 3LZFL 1RZ8A 4OLYH 3BKCH 5A2JH 1GTNA 4K8RL 1A4KA 2XV6B 3U7WH 2GJRA 5E94B 3IFPA 5EB9A 5F7KC 2E9BA 5DS2A 4M93C 5JDSA 4ANKA 4K3HA 2Z1PA 4G9FA 2Q8BH 4FQPA 4GXFA 4AKQA 1L5GB 4XMWA 4Z3EA 2R0KH 1DO6A 2DM4A 3RTQD 4AUUA 4M8RA 3MV9D 4LCWE 2CNYA 3GJEA 4JRYD 3WCYA 5IESH 2AMGA 5LN8A 1ZLSH 2HRLA 1E4JA 1QSFB 1DQVA 4RGNC 5E7FA 5F7DA 5IEKA 5JOPD 3RURA 7TAAA 1C16B 4CC1A 1KXTA 3GBNL 3BH8B 4YDNA 3EJTA 1Y18A 1SY6A 1A7RH 5AAMA 4AMKH 3QH3B 4PI2A 3RPIB 1KXQE 5ESVB 3PGCA 3GXDA 1GOFA 5E08L 3OXSA 3TBCA 2XKNA 2IADA 1NCJA 1MJUH 3KPSB 1W6WA 4JKWA 5BVPL 3EHBD 2VITA 3ULVE 2VH5L 1B9KA 2BOCB 2J8UE 3L48A 3ZHFA 3S9DB 4KRPB 1PZ3A 1Z9NA 3AMLA 4WNSA 2BZ7A 4NN7B 1AZUA 2AQNA 5BQ7B 5HP5A 3EUDA 1IU1A 4Z76A 1BEXA 4PHXA 1CD9B 2R7EB 1EBAA 1NIEA 3P9LB 2NQCA 1YEEL 3QWOB 2F19H 5HY9B 4J8RB 1H5BB 3HNVL 3ZW3A 3KLHD 4NERA 5EZJA 3BJ91 3RVWD 4LIQE 4ONFH 3VXQB 4NKMA 4XOEA 1AP2A 4HH8A 1ND0A 4QT5A 1ZY9A 4Z7VA 3NQKA 4XMTA 1K5NA 3EYSL 4Y2NA 5ICXA 4RAUA 1PVHA 3FZUD 4GAJH 5KW9L 5C09D 1A2YB 2YPKB 1KBPA 5GRYA 3RTLA 2ZFDB 3VGHA 2E46A 4BYHA 3MNWB 4GT0A 4JO2H 2GAZB 3KLHC 1X9RA 4N85A 4APQD 5H35A 2F5BH 5IVXB 1U8QB 2QZ5A 4NUJB 4Q52A 2ROXA 3N42B 3RHWK 5GS0C 2BNRB 5GXBB 1QRKA 5BOJA 3BD5A 5AW3B 3WFBH 2OV0A 4C7PA 5F6HJ 3OPUA 4FQIL 2KI6A 4J28A 1AGCB 1RZFL 2O5YH 1VFBB 1D6EB 1BEYL 1F42A 2MEJB 4S1SH 4EN3C 2Y1VA 3RGVC 4BD4A 3PNRB 4Z7UB 3BRFA 1U8NB 2WBJC 1T1WA 3MLYL 4A7GF 4Z7NF 4WENB 5J1AB 1KXHA 4UM8B 3F58H 2QMJA 1OGPA 2ZJSL 3ZOAA 4PRPE 4JQIH 2X28A 5F1NB 4IU2A 3ZE1F 5IHUL 4N1HB 3W0WB 1EO8H 4KZDL 4AITA 4Y8DC 1A02N 5LGJA 1DVTA 3CVCA 3PMGA 2GABA 1MH5B 2KQMA 1L6ZA 1VKXB 3OJVC 2AMUA 4JFDD 4PRHD 3MNVA 2W0PA 4XNUH 3AT9A 5EUOA 3HCVA 5FW8A 3R7QA 4TUJB 2VL4A 1D5BB 4F7EB 3AT8A 4M5ZL 1CGYA 4MCMA 1BM3L 4U2YA 4ZW5A 3IE9A 5KVFE 3CPUA 4GG8A 4KNQA 1S7XA 4FYQA 2YMTA 3T6QC 3DC0A 1YEDA 4BKSC 3BD3A 1U4FA 5KVFL 3B7TA 4S2SB 4HV8A 3GSOB 4HWBA 4XMZA 5JW3H 3OQ3B 3R4RA 2YPLB 3IDJB 1T0OA 4FGMA 1I8LC 5E2JA 1S7UB 1OSZA 4HX1B 3H9SD 1NM9A 5GSVA 3MACH 5CSZA 5E6ZA 2PCXA 2Y5TA 2H2SD 2E9JA 3JWOC 2QLYA 1FDLL 1N8ZB 1QTSA 4B97A 4UZSA 5EEVA 4DKFH 4Z1PA 1UGKA 1Q72H 1Z0MA 2Q1EA 3SYQA 2G9KA 5FYLH 2PYEB 3DTUB 3GSRB 4LCIH 3FB7A 3FYEB 3LZOA 1KTBA 5B8CB 3FTXA 5A2BA 3V0VA 1HHIB 1KN2H 5HDBE 4MSWA 5L7XL 3ARTA 4KRPC 4O58H 4GJTB 4N20A 4G6FD 2VLMD 3TCLB 3FO0L 2WVVA 5JA9A 2UX6A 5B1CA 1QYGL 3QNZA 2EACA 2X88A 5GGTL 3T71A 3CIAA 2UYLA 1A7RL 2KL6A 2PP7A 3TV3L 3WUWG 1C8QA 1H5BC 4JG5A 4WJ5B 4P2RA 3L9EA 1YNTB 1OW0A 4KJWD 5DK0A 3KGUA 5IB5B 1X4XA 3T4YA 3HZVB 1C5BL 2KMWA 2QR0A 1PZUB 3FZUC 4PS8A 3RVUD 5HGHB 2MZ8A 4B95C 3MRBA 1QD0A 3EO1A 2W81C 5TDNA 2R0KL 1J10A 2ZONA 4F33B 3LIZL 5DMKA 2IANA 3S97C 4OF0A 1OQOA 4KNTA 4AOFA 1MXDA 3HAEA 1RK0A 4PY7A 1CBJA 1HXYB 1ORQA 1JWUA 5EA0H 3GSWA 1XB6A 3K81A 2JIXB 4L9LC 5LAXA 2Z93A 1CDYA 4CC4A 2IPTL 3APCA 3SO3C 3ZDYE 4D9LL 1UACL 3DI2B 3MNDA 4F3FB 3CFNA 2VZTA 3NSCA 1QLRA 3M45A 4QRPA 2FGZA 3FKUS 3DA0A 4JM2D 4P4KC 2JCCF 1ORSB 2AV7B 3LXBA 3MO1B 3A23A 5E08H 3C60A 3S2AA 4FLHA 2VLRA 4Y9GA 4HFUH 2VC2H 4OCRL 3S48A 3DWTA 5JLZA 1NQBA 3BSZL 4P9HH 4Y2DA 3GIZL 3PPEA 4FNPA 4XNMB 5JIIA 1RLBA 5FLUA 1I3RB 4JZJC 5BVJB 1Q9OA 3D9AH 3I9GL 3GRGA 1QFWM 4U6VH 5EO1A 1F4WH 3OJDB 2Y5EA 1F41A 1T4KA 3MR9A 5B38B 1NZRA 1HK6A 4PLJC 1IB5A 1KIRA 1R4XA 3V4VB 1U41A 2FSDA 3GIVA 3QG6B 2HG0A 2DWDA 2VSCA 3MFFA 4MA7H 4TTDC 2VWEC 4ZW3A 3WKNA 4P5RA 5EOCJ 3QP3A 1N0LA 3UGUA 1G6RA 1TMCB 2A0LD 3IGAA 3Q5OA 2ID5A 4OD1L 1V55B 1HS6A 3W81A 4POYA 1GPOH 3TBTA 4QGTA 4Q6IA 1A8JH 1P4IH 5E5UB 3Q48A 5FHAH 4LVEA 1HZHH 2E7MA 4HPYH 4BZ2A 2IAMA 3QJFA 1KFQA 4GH7B 4I3GA 2MCPH 5AAWA 3WKPA 2JLPA 1RJYB 4Y16C 1H3UA 4YBHA 5DO2C 4ZW8A 5FW6A 1XIWC 4OGAD 3RNQA 3QCUH 1G7HA 2IGLA 3WNNA 3A4EA 2R0LL 3E6HA 3UTTE 3DETC 2NYKA 2D3LA 1F1AA 4J3XA 2XICA 1X5JA 2DQDL 1UCBL 5B8CC 5LQBL 2CDEB 2VXQA 3PY9A 2E7LC 4L5FL 4OFVA 2BPBA 5MEOA 1R9FA 5CHNB 2XQBH 4BHUA 4ZO6A 3NESA 1EO7A 1S9YB 1WEJL 2DH3A 1CT8A 1E5YA 1OOAA 4BQ6A 1FP5A 1WISA 1IM9D 3GI8H 4XVUC 1KYAA 3QDME 5LCVH 2ADIA 4GS7C 4X99B 4Z7UE 3CK0H 1MI5E 1CD0A 1IT9L 2ZF9A 3B7SA 3MRPB 4Y4FD 5GS0H 5LGKA 1ZHBB 5LJYH 1D5MB 2XRAL 3ARRA 2OZNA 4O00A 4KTEH 2ZAIA 2KLSA 2DIJA 4NZUL 1ZA6A 3EYFA 4RGOH 5C07D 3E80A 3WSQH 2E27H 2F6AA 3FU7B 1I8KB 1RERA 3HRZA 5FPIA 2W9DL 2QV4A 3CN2A 4JRYB 2C1PA 4PRAB 5DUPL 1ZLWK 4BFRA 5KSBF 1XGTA 2YN3A 4X6FB 1N12A 3QXDB 5DUMH 1AO7B 5KVDE 3GZKA 3R0NA 3H7BA 2C9UA 4MA3B 3RL2A 1J8KA 4X8GA 1JPSL 3V5DA 1KXVA 2LW3A 2X6CA 1S7UA 1LWYA 5SWZB 2WXLA 4FFTA 2Y3AA 2CIIA 4JJOA 1HJCA 4B27A 1WFIA 1MAJA 3AREA 2VDQL 5FO8B 3D4VA 2YJQA 5D1XB 2YAEA 2KKQA 1R3KB 4A37A 4MZ2A 2V92A 1HSBA 4F1ZA 4H2AA 2F7OA 5JPMB 5ALCH 3RX7A 2WSDA 2K1MA 2W59A 2R2EB 3EYVB 2ARJA 3IMTA 3OKOA 1FYTE 3Q05A 3D7PA 4OH2A 1FG2A 2DJMA 3U0WL 1CMOA 1QMUA 5E4IA 3L6FA 4RODB 1R5WB 1D9KB 3ZE1E 3RE0A 2VABA 2Q76A 3QO1B 2XN1A 4PV8B 3UP1A 2FIRT 2OCCB 1Z9OA 3GKZA 4GO9A 4PRPB 5JXAH 3UZEA 5IY5B 3DBSA 4TUKL 2YWZA 2I9TB 2E86A 1SJEB 4A66A 2GG1A 2KH2B 32C2A 1MPAL 1ZEAL 3WKMH 2Y7QB 4UQCA 5DMGC 5IJDC 3LYRA 4XVJH 4X6BB 3BKYH 2GHZA 4N87A 3AQYA 5D5MA 5BV7L 1QBML 5JUEH 4W93A 4J3OG 3RY4A 3QEHB 1AS8A 4BKLB 4U0RC 1T0NB 5C0BB 4GRWE 1CICA 5BRPA 2Z0FA 4TRPL 4NCC1 4XWGH 12E8L 1NLBL 3QE5A 2CDFA 3RRQA 4EJYA 2EDNA 4JN2A 3GIZH 4JM2B 5CNHA 4YHZH 1RZPA 3C5JB 4OLZH 5ISZA 4AYFB 1I8IB 3HZKA 1JGUL 1MVUA 4R4BB 4Y16B 3F84A 5DRWA 3UFIA 5ICZB 3QZNA 2HN7B 4J6IA 4HPHA 5IB2A 4JFHE 5JW5B 1QACA 5CO1A 4K3DH 1MHPH 1F58L 4HJEA 2I60H 2RA1A 3GT6A 4A1RA 5BMFH 3QUMB 2AKRB 4QR7A 3BJLA 4GMTL 4UNTA 3UJJH 3M17B 2BY1A 2G4GA 3DPDA 1R3IH 4MNHA 2J1XA 3GMMA 3LQZB 4K3GA 2FJGA 4PJBB 3CN1A 3KXFE 5JA8B 1LQSR 1N9PA 3UYOD 3T77B 3T0AA 2ADGA 5D2LA 4DULA 3IFLL 2CK0H 1WBYA 3DUUA 4Y4HB 3SPVA 2RD0A 4NI3A 1VACA 4DKEH 1ES0A 5E03A 4AV0A 4EN3A 1IE5A 1QN4A 3M46A 3MR9B 4E2OA 3VXUD 1PL3A 2VCOA 2WLJA 5LG1A 2DWSA 4GSDL 3TIEB 5C7XH 2XX0A 3BZ5A 5B1JA 1SQMA 3MA9H 3FU5A 4AT6B 1BD2E 4EI0A 4YDKL 4OUOA 3S96A 3CFDB 4R9HA 3KD4A 3DV6B 2F7RA 1KN4H 1TMQA 2C4FU 1IFRA 2JKJA 4N2FA 4F8NA 2Q0ZX 1M05A 1MRFH 3KPTA 4RWYH 2IFFH 1JK9A 4ELKB 2PYFA 2PUQT 1OB1A 2ZCKL 1JOIA 2B59B 4P49A 1KOAA 5GZOA 1C4GA 1M6OA 3LHAA 3SOTA 4H8QA 4BH7B 1KACB 4OFYD 2EO7A 4G11A 4LCIL 2EE2A 1FHNA 3RVXC 5AYUH 5DJCA 1RUQH 3HIZA 1T7XA 3LZFH 1A4CA 4CVZB 4ZMNA 3QQXA 1T3FA 4KY2A 4D8PB 4PBXA 5KYWB 4Z78A 4YFLI 3QXVA 5D7LB 1NFDA 1N6UA 4NXSA 3FUKA 5C0GB 5T3ZE 2XTSA 5B7EA 1U91B 3EH3B 3KPLA 4GG6F 2Y9RT 1X5ZA 2FLRT 5DR5H 4ZUSB 4IRZA 4PYHA 1F4XH 4AJVA 4EZMA 1BM3H 5DO8A 2OL3L 5IVOA 4PLOB 4WU7B 2Y25A 1CE6B 4PP2A 1D7FA 4F3FA 4AJWA 2MOGA 5EO9B 5I5IA 1BJMA 1IGML 3ZYJA 5K39A 5GS1C 2DL2A 3EHBC 2B1OA 5DS1A 1QTPA 1WS7A 4P2QE 4XPAH 3FO0H 5KYYB 3AAZB 3VXOA 1EO8L 4FQHA 4U0RB 3E9UA 1HI6A 1OK8A 5EU7C 5L7XH 1FN7A 5L9DL 4M3HA 3M1OA 5DEFA 1FO0A 1CD8A 2K3TA 1KYUA 5IWLC 5KSAC 1DBJL 1WFUA 5LCVA 5DWUH 4PJDF 1KG0B 1QBAA 1U42A 1IO4C 4OZHA 4QT5B 4W6YB 1HH6B 1A14H 2CBQA 4PJAE 3SDXA 2BLFA 2LU3A 3ILQC 1Q8MA 1HU0A 2HKFL 5AKVA 4NN6C 1TLKA 1WITA 2AJXH 2YO3A 4X4KA 3DOIA 4HG4J 5E7BA 2VXVH 5DA0B 3U4BH 5B3JE 4LLYB 4HSCX 2WWNA 1R24A 2EDMA 2Z91A 3QXTA 1BVZA 3V5KA 2YK1H 4P5KA 3VO0A 2AEQL 2DL9A 2AXWA 5DVMA 1BFVL 3FFCE 4W4NA 2WBWB 4N0FA 1X5FA 1IIKA 3KJ4B 4PV9A 3CUPA 4ZUUB 5AL0A 5BZDA 3O3BA