1KYUA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
total genus 69
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyuA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyuA02
3ZHFA 1CDWA 1QN8A 3OCIA 1VOLB 1NGMA 1AISA 3ASMA 5CN2A 1QTPA 1TBPA 1NA8A 1VTLE 3VN5A 2YMTA 1QN4A 1QN3A 1KYDA 2A7BA 1B9KA 3EIKA 1C9BB 1QNBA 4RODB 4B0AA 3ZY7A 1RM1A 2D0BA 1KYFA 4PY5A 3H1ZA 3HS9A 4WZSD 1IU1A 3OC3C 1KY7A 5IYBP 1TBAB 3HS8A 1R4XA 1GYWA 2MJ7A 1E42A 1QN7A 2DWXA 1NH2A 1KYUA 1MP9A 1QNCA 1PZDA 1QNAA 4BCXA 1KY6A 2Z8UA 1QNEA 2IV8A 1QN5A 2VJ0A 1NVPA 1TGHA 1YTFA 4ROEB 1D3UA 2D0CA 5IYDP 1QN6A 1VTOA 2DWYA 1VOKA 2G30A 1JFIC 2E9GA 1PCZA 1YTBA 2IV9A 1QTSA 5CN1A 5IYCP 1OM9A 1GYVA 4ROCB 3MNMA 1GYUA 1QN9A 1W80A 2D0AA 1P4UA
chains in the Genus database with same CATH superfamily
2X9YA 1QX1A 1XB3A 3X12A 5ADPH 5KW9L 1KFGA 4J1UA 1P6WA 3EH3B 3P4OA 1V3KA 2H5UA 4AGQA 1TZAA 4GP5B 4P23A 3FQTB 5DDHA 4Q6KA 3OX8A 4PWEA 4A2LA 5MEOB 2B7DT 1ILUA 3CN0A 2BS8A 3N85L 3VRIB 2H1XA 1NEUA 3FRPG 2A6JB 2W07A 2C3VB 1F58H 1KDIA 2AJVL 4TNVF 3BHBA 4WI4A 5EBWA 2OR8A 2NXZB 1N4XL 3OAZH 3HBPA 1YYML 4TNWF 4ACPA 1B0IA 3WTUA 3VFSB 4NKDB 3JWOH 4P9MH 1CD8A 1S7QB 1XEDA 2NTFA 2QMJA 2V2XB 4B0AA 4KTGA 1T21B 4WAFA 4BGDA 4ENZA 4OJCA 1REIA 1X7TA 1T2XA 5FPIA 2Q7YA 1T66D 2DLTA 1M9WA 4GO8A 2C4XA 3MI6A 2PNDA 3U1QA 5AKRA 1BGXL 4XWGL 3N44B 5C97A 3H1ZA 4TQEL 4XHQA 4I7ZC 2Y3AA 3LZQA 1C9SA 3TJPA 5I2IA 3AXIA 2HLFC 1U3HB 3IDXL 4PJIE 5L8LB 3ETSA 4IBYA 4XP4L 2W0LA 4PV8A 2WLIA 4LCWB 3VXTA 3D08A 3GMMA 1JXKA 3O3EB 5DJXA 2BVTA 5DS8B 1ND0A 1NPNA 2DQTH 3OPUA 3CWSA 3Q9PA 5GGTA 3N40P 3IJEB 1JPGA 5EBGA 2VDNL 5DD0L 1VACA 4ZW7A 4GKOA 5DGQA 4W6WB 3P3UA 5AW3B 5DTFB 4LLUB 1E6OH 1WFNA 4M1GL 3WFDL 1QD0A 2JKJA 1CFNB 1MREL 3PMGA 3WBDA 1ETB1 3PAVA 1PY0A 1JK8A 1PKQB 1LO5A 2BVUA 4U7MA 3OWEA 4JN1L 4WFED 3PU7A 4JZNA 1MCIA 3N41F 2OZ4A 1KEGH 4DAGH 1ZDSA 1GSKA 4TVPH 3JWNC 4ZUUA 5C0IA 1II4E 3O6FA 4GT7A 5KZCD 5LCVL 1UTDA 2BSRA 1I1FA 4X6EA 5GRJH 1WT5C 3CZJA 3D52A 3QDJD 4ZO7A 5T1JA 1S9WB 1JWSB 1EXHA 1AZUA 3K81A 5DQ9B 3ZYIA 1MJ8H 2HFFB 2QKIB 1ONQB 3ARSA 3LRMA 3PWJB 4LAJH 1CLCA 3BO8B 5F9OL 4C83B 5KS9A 3FQ2A 1JF1B 1H8SA 1LO2H 3RDTA 4KKAC 5FGBC 1XF5B 1P7QA 3KR3H 1I9JH 3FRPB 1AI1H 4X98A 2FATL 5AZEH 1K6QH 1WIPA 5DMJB 3UG4A 2C3HA 1IFHL 3A22A 5C0NC 1KDJA 4OKDA 3EFDH 4K71C 4F91B 5IQNA 5FYKU 4EN3D 4AJVA 1I1FB 2A6IA 2HFTA 2VLRE 4JM2D 3ARGA 1HAWA 3QSKB 5DXWA 4EI5D 5FOBA 4MAYA 5LLIC 4ISVA 3TBTA 3I3DA 3A6BL 7FABH 5IHUL 4EIGB 1NJ9A 4DJMA 1YJDL 1TZIA 3SDAD 4KI5C 4MWFB 1OSZB 4ZQTA 1X5YA 3ESNA 4MNQA 4X6BA 1RUQH 1A6WL 1WO2A 3GO1H 3HN3A 2OL3H 3LKQB 3VI3B 1NGQH 4UTAH 3SBWA 2AJSH 2B9BA 2CM5A 4LCYB 3P3RA 3QQDA 5F44A 4U7KA 3BH4A 1FE8L 2XN9B 4QRPE 5AVVB 4Z7UE 1T2QH 2EO1A 1DLHA 4U0RB 1H6UA 1OTSD 4WNJA 5E6IB 3FTGA 1HDMB 5I66B 4XGZA 1PG7H 5F1KC 3RI5K 2DMCA 5EO0B 4NHUB 2HJLB 1PG7L 3KYAA 5DD5L 1U3NA 2DICA 4JHWH 2P8PB 5T1MB 1MXGA 4UQAA 3QIBC 2EUXA 3I50H 5KYNA 1EIBA 4ZOCA 4BWTA 2CBPA 3EBIA 5F9AC 3MU3A 1IQWH 4UTBL 2CQVA 1CDIA 2Y36H 3IFPB 3LN4A 4NKDA 4U7SA 5JHLA 4CMMB 4HMDA 4MJ5B 4XXCC 1B0GB 4FD0A 3ES6B 2QREA 2QV2A 3QR1A 4EDWH 1Y1UA 5I28A 4GKNA 3BN9D 2FZ3A 3E1ZA 3SGDH 1L0PA 4RFEA 4G6KL 1TJIH 2J88L 4PREB 3EBHA 2YAEA 5E00A 4DK6A 3MJ6A 4JPVH 1S7RB 4U3XA 3RVWD 5EUOF 2AJYH 4RMUA 3B56A 1TJGH 3C9NB 4IJ3C 1E3XA 2B2XH 2JTYA 4NC0B 4I89A 2K45A 1HE8A 5ACZA 1PZAA 4M61A 5AW1B 4ERSL 4N0UA 1S9YA 4JANB 4F7PA 4M03A 4A39A 4TNEA 1JNJA 2NNAA 3F83A 5I8CB 1FYTB 3FQRB 3UYPB 1I85C 3FU6A 2A9DA 2C4FU 3N1MC 5HHOD 5BZDB 2P8LB 4WKZA 3WY1A 2G75B 4AEHH 2X3AA 2XTJE 4KXAA 3D0LB 3RWCB 3RWIB 1HU8A 2UY7B 1JG9A 4CA4A 1MCKA 3NJJA 4DVBA 3I75A 1T5XB 2BNQB 1QN8A 4XPGH 2YA3A 2EXYD 2G2NA 2XVKA 4FXLA 4F8NA 4ELKB 4FX5A 4K8RC 3QIBB 3BPOB 3NQKA 1B4TA 5H37G 4Z5RA 4GXUM 4PJ8C 1RURL 4KH9A 1DBJL 2YEZB 4GUQA 3LEYH 1NEZA 3KCPB 3G6JB 3SBQA 4X7FC 4I4WB 2XWBB 3DROB 4O02B 5CJ5A 2P1YA 3RWHA 4LCWD 1IGJA 1U8KB 2KQNA 4RA0C 3RY6A 3ILPA 1BXAA 4MJIB 4K5PA 2GFBB 3NBNA 5JW5B 3DUSA 4P9HC 2H2SC 1RUKL 2VITB 3VFUA 3PY9A 1SFDA 2D3JA 4CVUA 4XPFH 1YEEL 1BXUA 3AXHA 2AQPA 2KC0A 4JDZA 3QJSB 1R5VA 1ID2A 3KLAA 4GKSA 3CBKB 5B39G 4HWEH 3FB6A 4G42B 5IB1B 1XGUA 3HZMB 2BVQA 2ENSA 1TETH 1IT9L 1CYWA 5CEYB 4LLWA 3LCYA 1VSCA 4LARL 4WJ5A 1T80A 1EK3A 3K1DA 5E2WL 3EGDB 3S4SG 3DI3B 4OGXL 4XBPB 1FNEA 1A6PA 2AXFB 4HXBH 1P0SE 3EO0B 2WZAA 4OQ1A 1I1CA 2F8IA 3O8XB 1MNUL 5GS2H 3QDGA 1Z32X 4ZFFA 1T4KA 3LDBB 1H3PH 2FL5B 4PWKA 1DQKA 1Q0YL 1PTZA 3CBJB 3D51A 3HC2A 4BEIA 5INDB 2B16A 1FGNH 5EO1A 3OL2A 2F68X 4HIQA 4U1NA 4X5QA 5TH2B 3IDJA 2GFBA 2BNRD 3BIKB 3WNPA 3RWHB 1WA2X 1P7QB 4ZUSA 1IL1A 1ROWA 4KKBD 4DULA 4Y19A 1R24B 1AH1A 1YECH 3MBEC 5DZ9A 3O8XD 3O6MH 5C3TA 3QQ3B 3DC0A 1TGHA 1SBSH 4PVBA 1R47A 4WI5A 1VFAA 1IKFH 2F53D 2CG9X 3PNWA 4DEPB 4CNIA 4HALA 1BZ9A 2Y5TB 5DCCA 4HGWB 5DFVC 3UH8A 5JIDA 5JIIA 4RISL 2FSEA 1MWAA 4MCYA 5K59F 1I9EA 2PABA 2X4OA 4FTVA 3IAQA 3ALXA 4YLCA 3LX9A 3IN2A 1IJNA 4HJHA 4U1IA 4PVNA 3CQFA 5B3JE 1J8HB 4ZUVA 3D48R 2NY7H 4MXQC 4PIBA 3ULUL 2NY7L 2X6AA 4JFFB 5GGSA 5HYJD 5I0WA 1MXDA 2XZQH 1F86A 2XBTA 5DUPL 1J1OH 2VQ4A 1LE5A 5AKVA 3C5JB 1QABA 4TVPE 2X1OA 1GRWA 5J6GB 1F6AB 3GXFA 1H15A 2J6WA 3QT2A 2CNZA 4HUKB 4K9EH 4P3CH 4ODTH 4XPBH 5EU6D 2BZCA 3NT0A 3FCGA 3UO1L 4P2RA 5FWQA 2I26N 2Z34A 2J1YA 4LBEA 2ADIB 3IGLA 4TVUA 1T2JA 2BNQD 4M9OA 1ZGLP 5EN2B 1E9OA 1D7DA 1OGTB 4P2RE 5F89B 3TZVA 4ATWA 1I9RH 4D0BB 5I1CL 4Y5VB 2NSMA 3FPYA 2YPLD 4W9HC 2PWFA 4LEXH 4GRLA 3R4RA 1MRDL 3S4SA 4ZUVB 2XWBA 1MVYA 3U48A 5B4MC 3CQQA 3PL6B 4IRSD 4P9ML 4PJXB 5BRZA 1E9PB 1OGPA 3IFPA 3LN4B 5GZOD 3L1GA 1LILA 4UU9A 3DDFA 5F7AA 3WS6C 1MFUA 1RK0A 4RDQG 4H5SB 2UXVA 4WFFE 4E9XA 1TKWA 2P7TB 3BKYH 3PDOA 4HPYH 1N59B 1EXUA 3LQZB 3FB5A 3VFPA 2BNQA 4G6MH 3HFFA 4WO4C 4FFWC 4EO5A 1RJYB 2N0MA 1BLNA 4IHOA 5DK0B 3D3VA 3FB7A 1S7XB 4LEEA 1I9IH 3CLFH 4NFCA 5I1IL 1MI5A 3HPJB 5EZIH 2YFOA 2QDWA 3BMVA 1B2WL 2X4SB 4OCWL 1IEAB 4WJKB 1DBKH 1QQDA 1WFIA 4G2AA 3OPZH 4WTXA 4NIYE 2PW1A 2VDNH 4WFGE 2WWKO 4W9FC 5DD0H 3X12B 1M42A 2A83A 3F00A 3RE0A 4JY4A 1AY1H 2K78A 2XZCL 3DIDA 4PB0L 1MFAH 2LLGA 4MKMA 1U8QA 4GT0A 5F7MC 1JGVL 3FOLA 2HVJB 1W9XA 3OR7B 4WDIA 5A40E 1MJJB 4HX1B 5C92A 2MPAH 2F74A 2XBZA 2GKIA 1VLXA 2Y1VA 4FTVD 4MS6A 4Z95L 3WLWD 2Y8QA 4KZDH 1J9SA 4FQCL 4XWOD 2ZKHL 2WKOA 2XIIA 4AYMC 3NCFB 4QJ3B 3QRLA 5IYDP 2BIPA 1L9TA 2X40A 4PB9L 3SPIA 3BWAB 3VE0A 3KPLA 1KLFA 4BQ9A 2Y22A 3LZFL 3NPSC 1KYOK 4WUKL 1AGBB 4HFWB 2BSSB 1GIGH 4N87A 1YEJH 3ZE1F 4O5LL 1A9BA 1ASQA 3UPRB 3FO9B 4G80B 4PCYA 3GJFK 1JHTB 3U0PA 4FQ1L 1EAPB 5IGXH 1S7SB 4LF3B 2ZYIA 5T3XD 3KPNA 2YD3A 4YAQA 5E2TH 4QAWA 2VERN 4UQIM 1TEYA 1R3LB 3C8HA 4A2MA 3DK0A 3W1ZA 3MBEA 3Q48A 2ZPKL 3MRJB 4PGJA 3DX4A 3VMNA 5EPMA 4PJDA 4ZT1A 2OW7A 3G6JF 2WC7A 3MRHA 4MD0B 3NIFB 4X9YA 4PCTA 4CMHB 3VXMB 2NX5A 3MRIB 5JNYA 1ZY9A 3KPTA 4MGXA 3QEHB 1PZBA 3I9IA 4H1LA 5F71A 3HI5H 2H2SD 4MBOA 1AS7A 5GIRA 5L2KA 5LHDA 2F8XC 1QWUA 2NX5E 2V9UA 3DSFH 4K4KA 3NGBB 3JWNG 2L3BA 4FC3E 3A6BH 4U6XA 4UM9D 1CYXA 2B4CC 3D06A 5GGRA 2UY7A 1S7VA 4XMWA 3THMH 1EHAA 5D7IF 3DDGA 12E8L 1T7VA 2WUCH 4JO4H 5EO9B 3V0JA 4L8BB 3E2HC 3QIUD 3X2QB 2HFGL 4KXZH 4HPOH 4XNZB 5CR1A 4E5XA 2JQMA 5HHVH 4PJBE 3BKML 1BSIA 3X3FL 3LRLA 1RUQL 2F08A 2VDQH 3QH3A 1H9DA 4A55A 2VWEE 5HJDA 3MO1B 4OFYA 1MZZA 2Y1ZA 3FKUS 4BELD 3NA4A 4EIBA 5TDPA 1D5ZB 3DURA 4YHOH 1IC7H 1KT2A 3Q43A 5AVUB 3UYRH 3VX1A 1P84J 3GMLA 3TJHC 4G5AA 5EBMB 5DVMA 1RAMA 3NZ8B 2Z8RA 2VTFA 3BP7B 3LS5H 2C4FT 3NAAH 3PLYA 3W0WB 4KVCH 4H1LB 5GIRB 4OF0A 1KJMA 5TF1H 5I6KA 2XTSA 3E38A 3O2VL 4LPTA 2NX5B 3B6SB 2C3WA 4OCMC 1MJ7H 5K33A 3HG0A 5DC9B 4WSKA 5TJWK 35C8L 1GKEA 5D1XC 4I8DA 3DV6B 3FT3A 4NUJA 5A43C 3HI6H 5E4EB 2C9SA 2BSTA 1JNLL 4PHZA 1JTOA 3ES6A 5I9QB 5IW1A 4MMZC 2OJZH 2DL9A 1IC0A 2WB7A 5ITBL 1MFEL 1E67A 4WI9A 5D1XA 3A6CL 1YPZE 4YLQT 1DO6A 1WE5A 4QNPF 1DJWA 1S9WA 4W9GC 2HH0H 4JY6A 2W60A 3MRDA 1V8HA 3FTWA 2A9NH 3SYQA 5JOPE 5JIQA 3I0WA 4PRHE 3M8OH 4OI8A 1K2DB 4ZTPL 1MFBH 4G83A 4HU8A 4J3TA 3QYNA 1QSVA 3SGJA 3JTSB 5DD1L 3SQBA 3TNNA 4MA7L 2ZUYA 1BX2A 4XO5A 4ZPTB 3EH5B 3FCTB 3QNZA 5E4OA 4XX1E 3X1NA 4UIMB 5CM1A 4V1DD 4JMXA 3W11D 1SQMA 4LDLB 3VU1A 4TRPH 4YFLI 3SQRA 1JFIC 1QACA 1Y1DA 3IRCA 2CNYA 2X89D 1JPST 3NP3A 2MHAB 4IRJC 3MNDA 4FTVE 4JO1L 5DTFA 4N6RB 5KEZA 5L9DH 3EDEA 3SGEH 2QADC 4JZJA 6FABH 1HOEA 1Q9UA 3BW9B 1JZ7A 5SV3A 3ZMEA 1OAZH 2DBLL 3QG6B 4M7LH 2X4QB 4N9GB 1KXVC 4UQ2A 3C60C 2D4FA 3HB3D 1RI8A 4NPJA 4PI2A 5DT1L 5DU7A 4XXCA 2DYSB 3OJDA 4AE1A 3Q8BA 4G82A 2DKDA 4Y9EA 2GBTA 1A2YA 3EAKA 2UZYA 3K6FA 4DGVH 1VOLB 3VFWA 3T4NA 2EEAA 1YEFL 2H7WA 3VFPB 1R5WB 2OMXA 5CN2A 5E0FA 3EFFB 3P9MB 2HG0A 2L7QA 4CMMA 4GS7B 1RJZA 2JKTM 5J13B 1QSFE 5IBLD 2KMWA 1EEQA 4XMUA 2NZIA 5IEHA 4KQ4L 1UXWB 3H55A 3MACL 4GRWB 1EHKB 4HC1A 3FT4A 4ACTA 5FX3A 1NANI 3OV6A 4KTEL 3NIGF 5FYLL 3VFMB 3II1A 4F9LC 3OMIB 4NDMA 4P4KC 2GABA 2R51A 3Q44A 3NCJH 3X3GH 3Q05A 2HJKB 3EGSB 4U2ZA 2WHVA 5J11C 4NO0D 3DO3A 2I9TB 4BDVA 4P46C 4NJAL 2M26A 3LEYL 3QG6A 3CUPA 2VW7A 1D5XB 5AL8A 1G7LA 5J89A 4P5KB 1EHNA 2VL5B 3C8DA 1QRNE 5FYJE 3L9BA 4HUMB 3OTTA 3RQ3A 3BT0A 3WJLC 4K3DL 3RNQB 4TKWA 1VKXA 2WTRA 2YZ8A 4UT7L 4YHLH 3V52L 3CMGA 3KJ6H 1XGTA 5AW0B 2LVCA 3U4EA 1BMGA 5I71B 3N55A 4HS8L 3BWUC 3LKOB 4YDLC 4JR9H 4FADA 1LO4L 1YC7A 1LO4H 1X5HA 1TVHA 2AXGA 3QJZA 4FKKA 3MFGB 3RGVB 5FOBB 2O5YH 1M53A 2CUIA 4HXBL 2N7BA 4D3CL 2Q10A 4HGWA 2W60B 1QFUL 2OYLA 5KG9A 1OLLA 3TF4A 3M88A 5D5MA 5KYXA 1PLGH 4JG1L 1D5BB 4JO5A 4OLVL 4JFXB 5EEWA 1UM4H 2Z31C 3ESPA 2CKBH 2GCYA 3BPCB 4LOUC 2P5WD 3DI2B 2FECI 4P5TD 4E5XG 1FCCA 4F33A 1U91A 5ERWB 1VOKA 1NAMB 3OKEB 1F42A 5E23A 4RISH 3ECQA 4WGVB 1BFVH 2FH6A 4F33B 3LH8A 3W9EB 1OCWH 1T21A 3MRRA 4OM1H 4W9IC 3WEBA 5K39A 3NSDA 1ZMYA 5JIPA 3ZTJH 3BP6B 1EBMA 5DRXB 1PL3A 1EXGA 3IXTB 4G80A 4LL9A 4NI3A 3U30C 2CH8A 3RB7A 1ZE3C 2B3RA 2BP3A 3FUIA 4FI8A 4CVXB 3M7FB 4FOMA 3WIFA 4QOKD 3G3LA 1U8PB 4N5EC 3FTYA 4OJFL 2A74B 3D0AA 3N2JA 2NUTB 3T0EC 1OF2A 1M3JA 3QO0B 1UD8A 1FZOB 4UOJA 2MEJB 1QNZL 2WBJD 5DJ2A 5G4NA 4O58H 4AZ8A 2BSEA 3ZIMA 4HX1A 5FO7B 4MQSB 5DC2A 4RRPG 1CBJA 2IAAC 3OHXB 3ARED 2CO6A 3BVTA 3E6HB 3N9GH 3D3VE 3GDBA 3RL1B 2KH2B 4LEXL 3G5ZA 5I73C 3EYUL 4GO6B 4JDVB 4F15C 2O6DA 4O2EB 4NLHA 2XVLA 3LZLA 4LSPL 1TSRA 1KXVA 1DFBL 3S34H 4IGBA 1T04B 3H2PA 4A6YH 1B3IA 3GKZA 1MAML 3QWRD 5LBVA 3UTZB 2OXGB 2DMBA 5LNEA 5AALA 2F7PA 1Q1JH 2NXYB 1X7QB 3FJTA 3PWPB 3PP3K 5T8IA 4DNLA 3VFMA 4Z5RB 4XZ4A 3BXNB 4XI5C 4L9DA 5LGHH 4CVZA 4O9HL 1DO5A 4WGKA 4K5LA 4L3AA 3OMAB 3PP4L 4HIPA 4PY7A 4X9GA 1R6VA 2OR9H 4XOEA 3TO2A 5F7DB 5LNDA 1NAKL 5CO1A 2WANA 4CUCA 4OCXL 5KN5B 5E94A 1U8LA 1I8MA 1CPUA 4HZLB 3FH7A 4X8CA 5BPPA 1SLWA 1B2WH 3JWDC 3O3DB 5KVGL 5IM7A 4CC0A 3WNNA 1FVEB 2FWLB 3JYBA 3CCHA 4URTB 1GL4B 3QRFM 1QG3A 4Y5VC 3UJTH 4WIQA 2LTQB 5DS1A 4PN6A 3FS9A 3CSYB 2X89A 3AB0C 3WYRA 4KX8A 2H0EA 5A2LH 4GAYA 4X4MA 3Q6GH 5IJBC 2QLVB 3HAEB 5I71C 4JFDB 4XVJL 3QUYB 4NKOA 4XVOA 1LL1A 1KXHA 4F1SA 3QUKB 3QP3A 4PB9H 4GG6A 2NY2B 5CEXA 1CU4H 2XA3A 4FG6D 4DEUA 2V2WB 3KGUA 4EKXA 1JRHI 4OI9A 3FB8B 2YAOA 5IMOA 4X5RA 2Z91B 4OH2A 2UYLA 3T4YA 3AS3A 4FG6C 2PYFA 3QFJA 4X7TA 1LMKA 4U31A 3H4HA 5K9KB 3QEUB 5ETUB 4XPTL 2GJ6A 5E6SB 5L2KB 4MDJA 2OOXA 1CI3M 4NC1C 4QGYA 2A73A 2VLME 1U2YA 1Z7JA 3G9AB 3RILA 2X44D 5E5LA 1VFAB 3C2AL 5J12C 4FZEL 5D1XB 2WSPA 3O81A 3TH4T 1AR1C 3CFIC 3ZL2A 1AISA 4YHNB 4IU2A 4POUB 4TVSa 5D7SL 1DE4A 1P1ZA 2B1AL 2J56A 5HHXL 3APDA 4N2DA 1UGNA 4MCZB 4KMQA 2AQRA 5F9DC 4Y16D 2FKFA 3CN1A 1SDDB 4LSQH 1E5ZA 2OP4L 1HIMH 1F4XH 3MVSA 3SY0B 4EZLA 4Y8AA 1UA6L 2F7LA 4RODB 1NKOA 3F7RA 2EVHA 1CD9B 2CO7A 3PQYE 1KLUB 2VLKE 5KVMC 3T0DA 3BIAX 5HI3D 1U6AL 2ALWA 3WMPA 5ISZA 4PTUB 4UQ3B 4LKCB 5D1ZC 3A23A 1O5PA 1WAAF 3QJUB 1KXQA 5DRWA 3T6QC 1A02N 1AIZA 3TEXA 2XXCB 4HEME 3CU1A 4WY7L 5IK3B 1BCIA 5GS1B 2ZCLH 2CHNA 4AIOA 3NTCH 5F97E 3T6WA 5I16B 3D07A 3OXSB 3WMQA 5BZXA 1B90A 3P2TA 3AS0A 4KXBA 2RFXB 1TQCB 3E0GA 3PPEA 1QRKA 4FHJA 5ALBH 3KM1A 3TCLA 4GW4B 1XZ0A 4FQCH 3ARXA 2XIBA 2IFGA 1I8UA 5LBSH 3WAJA 3MV8D 5EOQH 2AJSL 4B5EA 5I5MA 3KPRE 1AFVH 4UZGA 3SJVE 6CGTA 1FWXA 2A1WH 2OJ1A 4AV4A 2AV1B 1CFQA 5DJYA 4ZMVA 5KSVB 5LGJB 2GITB 3OKNA 4F37F 2DQIL 4OIBA 1SYSB 5FK9A 3GSUA 5IF0B 4AQEA 3E8VA 4M93B 4XOBA 1E28B 5CP7A 1N59A 3BQVA 3L7FA 4U1JB 3HS0A 1DVFB 4XB7A 4DH2A 1G7HA 3UIZA 5CP3H 5J0BA 2YD6A 4GP4B 4LRNH 4POZC 1DBAH 5EFIA 5DF0A 5A16A 3FUMA 3VD4A 2GSIB 3VD9A 4Z8FH 1TTRA 5D1ZA 4K8RD 3B3IB 4YX2L 1M05A 1T5KA 3U0PB 4UT9L 2BXYA 5JHMA 1UEMA 2G5BB 3N0AA 3SCMC 4OTXL 1SPDA 2AI0L 2IG2H 4WO4A 4QKXB 1RU9H 4JFPB 1UJTA 4YDNA 3UYPA 1JK9A 2Z8SA 1DQQA 4Z0XB 5CLYA 5KBPA 2DIAA 3B7RL 1KGUA 5C0CE 4JANA 3WS6A 2WVUA 4YPGB 2WSDA 2Y6SD 3H3BC 1A1NB 1AMXA 4NJ9H 4X8JB 4Y9FA 3ATDA 1T03L 1JF5A 4PGDA 4W1TA 2JMRA 1A5FL 4ZZKA 1EJ6A 2WXQA 3DOIA 5CEYA 1FGVL 1X4ZA 5AD0B 1XGUB 3HZMA 5KVEH 1P4UA 3ME0B 3E8UH 1TFHA 4LCCB 5SWZB 1KBWA 4GIAA 2ESVB 3TASA 1A7QH 5ABAA 2H32B 4JDTH 3X3FH 4QXUL 1HNGA 2D0FA 1A7NL 2RBLA 4X6CB 3OSVA 2FZ3B 3N5AA 4LCWE 3MSPA 5LXGH 3VI4E 5BO1H 1JGLL 3P9LA 2D9QB 5BO1L 3GDCA 1BVKA 3ZU8A 1B4LA 1RKRA 3QUZA 3ZDXE 1RZPA 3HE6C 4FE9A 4A7GA 3QCUH 1U8LB 1C8QA 1I8MB 3P11H 3M86A 1DEEB 2R7EB 2VQTA 1J10A 2AABL 2Y5QA 4WW1A 5BRZD 4BFJA 3OSTA 3H3KA 2UXFA 4FQLH 1QFWM 4RQQA 4AKQA 1RIVL 2IAMD 2JKWA 4XX1G 4OD3H 3B8YA 3SKUD 3LIZA 1HXMA 4Z78B 2DJMA 4J2QA 1CFVL 4RMBA 4GBXD 2N56A 1JGDA 4POZD 2MOVA 4Z7VB 3WFEL 4NRXB 4UM9A 3GMQB 4UILH 1KY7A 1G84A 3B9DA 1LO3H 3T6ZA 2C9VA 3BGMB 2K3TA 5D96B 2EKJA 2YXFA 5EZPA 4N5ED 4Y5VA 4Y9GA 2DLEA 3ZMNA 5IMKB 2XKNA 2CZNA 5D7KE 4UT7H 3DX6B 2OMBA 3QZPA 1PY4A 5LB1A 3KWWA 1TZOA 3IF1A 3O3UN 4FLSA 4QRQB 5E7FA 3RZCB 3T0XA 3BJ91 4DKAA 4X8GA 2WXOA 1QN7A 5EBLB 3A67L 1TZHA 3F04A 1HESA 3HC3L 4RAHA 5E9DE 3H53A 3FZUD 3FUNA 3WLWC 3G08A 1EVTC 2ZG1A 4IBQA 4YPGA 2BCKA 1AS6A 3OR6B 3SPGA 3DIVA 2D7QA 2FT7A 4U6YA 4U1SA 3L4XA 5IFHH 2E9IA 5K9JL 5EHFA 4YSDA 5GGRY 1QFUH 2OX5B 3MLYH 2EO7A 3FQXA 1H5BC 4WCYL 4P3DA 4M62L 1MCQA 3BE1H 4JZJC 5JW4M 5TE6H 4Z7OB 3CNKA 4U6XB 5H4YA 1A7OH 3MV8E 1EO8L 1QBLL 1RY7B 2EEFA 5DA0B 5FHBL 4XHJD 5CKAA 5I82A 3NH7H 3SYOA 5T1MA 3ENCA 1NGPH 1A1MA 3UG3A 3DTXB 5F7EL 1OZUA 3UZQA 1DLFH 4Q9BA 3RVUD 1Q9KA 4AG4L 3I84A 1VFMA 5BQ7A 5KSVA 4ES9A 1O7SA 5LGJA 4QRPD 4L23A 4JE0A 4E68A 4S10A 5DFAA 1T5WA 4L8DA 1UD3A 3IEAA 1I3GH 1QZNA 1UFUA 3C04A 3QFJB 4X7TB 2CCWA 4Y2NA 3MROB 2EXWD 4KPHL 2YAMA 5JQIB 4Y5YA 2CR6A 1O6SB 3WNOA 2HPOA 1DANT 4XNDA 4K7PY 3ATAA 3KXFB 4FI6A 4XVTL 1AGBA 4HFWA 4LSRL 4R7VA 1KTDA 3MRFA 3P3TA 1WUZA 1NIEA 1UOLA 2PPFA 1G0DA 3AITA 3L1EA 2BWQA 1JGUH 5I8OL 1JYWA 1QYGH 3Q5OA 3T4AB 4WW2A 2J5LB 4JL2A 1XF2B 4PR5B 1E27B 1A6ZB 1U8OB 3ELAT 1FDLH 4CVWA 2HAZA 4ZUTB 4OQTH 2YRPA 4FZ8L 1X5JA 4W9CC 2FR4A 2HVKA 4U1GC 4G1MA 3FU7A 3O3EA 2F54A 5DJXB 1EZVY 4A6YL 5JA9A 3SY0A 2NOBA 2F19L 2B39A 2YPLA 3KNBA 1OSPL 1UT9A 4TQHA 3KYKH 3TA3A 4L9LB 5DVPA 3IAPA 1L5GB 5DRZB 4L5FL 4ODSL 1C12A 2EKSA 4HEMA 4KKCD 2IIJA 4NRXA 3LVTA 3ZDZE 4D8OA 5CJXC 4MNQE 2EXTA 4YK4C 3IPEA 1RUPH 1DVFD 4BZ1H 4D3CH 2BW5A 1X7SA 2VKWA 3FFCE 2XQYK 3EUDA 1E5UI 2B9AA 5EU3A 4LXFA 2B08A 5C0AE 5JPMA 4CILA 3VFRA 1TTAA 3B9KD 1P4LA 3R4DA 4GSDL 5F7UA 4B9ZA 3V5KA 2HN7B 5JW4R 2HG5A 4DWHA 2XN0A 2ADGB 1I7ZB 1UT2A 4PRID 4QCIA 4PV9A 3EJYD 4UNUA 1S78C 4PJ5B 1AKJD 4R3SA 3ZJAA 4HC1L 3AU1B 2XACC 4U3SA 5IMLA 4DKEH 1N12A 1HZHL 4Y4HC 1MDAA 4K71B 5IEKB 3QDMD 2FX8H 2VDKB 3EZJB 2EDDA 2XPZA 4F7EB 4EUPA 1UACH 4C56E 1MFDL 2C5DC 5KSBE 2H45A 4M4RB 2GJZA 1SVZA 2V0AA 3ME0A 2OAAA 1W0YT 2XSKA 3RWDA 4LCVA 2O26U 2XQYA 2OMWB 4BFOA 3IE9A 3WKNA 3OB0H 3CIAA 4Q74A 4DK3A 3T08A 2E7LC 5I0XA 2EDHA 2V5TA 2DS4A 4XPTH 3FBKA 3ZMRA 2HG5B 3QXAA 4OW6A 1KZYA 1U93A 1JD7A 3REVA 1VESA 2FT8A 2V9QA 2D0AA 3QHTC 3VXSA 4C54A 4Y4FD 4OQTA 4JVUA 4TF4A 3DYPA 4AUJA 2XCMC 4I3RH 4XAWL 3VSUA 4NRZA 5DYOB 4QYOA 3FONB 1PJ9A 3BZFB 1N18A 3K2MC 4P2QB 2ZOWA 5T5FA 2A4ZA 4JQVA 2YLKA 3FUFA 1NMBH 1JZJA 2UX6A 4NN5C 5CJ8A 3VVVA 1YN6B 3QDAA 2DQEH 4FYQA 5F6IB 1L9RA 1T20A 2CHDA 2AS5M 3KPRB 1FH5L 5FA4A 1A4KB 1F4XL 1B3JA 1R1CA 4QKTA 3BVNA 4I5BA 1N8ZA 3L45A 2ZP0T 1JFQL 4KJWD 5DDHB 2GW5A 3W9DB 2DQUL 3QCVH 3RGVA 3DSFL 2CGYA 2CRMA 1RULL 4HBCH 5BUGA 1MWOA 2GC4C 4J6RH 3LHPH 1DVTA 3QG7L 4NO5B 4OAWB 4HFUH 4JFDD 1HU0A 4HLJA 2G3XA 1TDQA 2KL6A 1ULVA 5JW4Q 4IJ3B 2G3NA 2AKRA 4K7PX 4JLRB 1OARL 2NY1C 1GYAA 5B1CA 3V4UL 4ABVA 4WJ5B 5EU6E 1OTUD 1TOXA 1UJ3C 2ERJB 2K3HA 4ICWA 4GB9A 4EZJA 3TEZA 5JORA 5IUSA 3MGAA 2AQ2A 4FQQB 5KJRL 3E2HB 3HLAB 1Z9SA 1AJ7L 5HSHA 4OUOA 1DVUA 4JY6B 3GSNA 1I1AA 3VACA 1IIKA 3KBEA 4R4FL 1NBZA 2K4AA 2HUEA 2E47A 3GYRA 3RKDC 1F45A 4IRJB 4K3JH 5CF3A 4DAGL 3ILQC 1CDUA 4I3SH 3WXWL 5IUCA 1T1ZA 3L3HA 1LWRA 3J2PA 4A2FA 4LHUD 5EDXA 1AC6A 3VGGA 3ASWA 3G6JA 4LMQE 1E3FA 2CCLA 3RZWA 5I1HL 4YIQB 4DQAA 1I9JL 4RWYH 5AAWC 3UFIA 4F2MB 1H3TA 3EDJA 2I5YL 3HUJE 3O6FD 1A4AA 4TTDC 5A2BA 1MAJA 2ED8A 3IXAA 2D03H 3WXVH 1UH2A 2AJZB 2ZUQB 1ADQH 2BSCA 1N3CA 4H0GA 1VEMA 5DQJB 3U36A 1MUJB 3IFNH 5DSCB 1QKZH 1BVZA 5CSGA 1T03H 2RA1A 2VMJA 1J9CT 1SY6A 4XN2A 2Y8LA 3AREA 3KD4A 5I23A 1S3KL 4JB9H 3NJNA 3OSMA 4AIEA 5CBAA 5JMRA 1F2QA 4Z7VE 3S35X 2FHBA 2XFXA 1RP8A 4HS3A 4P9HL 4FCAA 2YBGA 3FTXA 3L1OH 4AK2A 3M6DA 1EFXD 3HMWH 3JTTB 4RGNB 2V5SA 3EOBB 3QULA 1VRSA 4UIMA 4WI8A 4IU3B 1IC1A 2RALA 3S5LA 3QCUL 3S96B 3EYFB 2JWYA 4J3OH 5GRVK 3LS5L 1BJ8A 5ID0A 5D4QA 5F1NA 4ONFH 3GIZL 3WO4C 1AO7B 3WTWA 1P5UA 2P47B 2HLAA 3A4FA 1A6AB 4M5ZL 1J0HA 3ZYOA 3N44F 2EVJA 4D7BA 5JMVD 4M5ZH 1ZLUH 4CJ1A 1KBGL 1HILB 1KUMA 1BD2B 3SDCC 2CU9A 3QUXD 3T2NH 3QFDB 3T65A 3B2UC 1I7RA 1IQWL 4UTBH 5D2NB 5EC2A 5C0DA 1C4GA 4XNZC 2V17L 5HVHB 1GJWA 1F3RB 1T4WA 4HLEA 3V0VA 2I85A 1AQDB 1U9KA 5T1LB 1Z1WA 2HJFA 3P1VA 3PJLA 5DRZA 2YPKA 4TOYH 2XWJA 3P77B 3V4VL 2XBDA 1J18A 2X2IA 1TJIL 2HTKD 3QRBA 3WS3A 1ACYH 2BS71 4LLVA 5ECGA 3QRGH 4PJ8A 2R59A 5GGUA 3ARWA 1EZLA 2ADIA 3LZPA 4IU3A 3S5LB 4UT9H 3GJFH 1IZKA 1EFQA 4DGIH 4HIEA 2ZCHL 3FU9A 2MFNA 1PD1A 1KY6A 3GKWH 4G6AD 43C9B 1KXTB 5L7XL 4WW2B 3FT9A 1XF2A 4LOFA 3BD3A 3CSBA 1TQWA 5E2JA 2QGDA 3F6JA 1Y6KR 4TQIA 5CZXC 3TYFA 3L3GA 1MRCL 4GJTB 1JDAA 1P6AB 5C08B 4APQC 4ORGA 4AQZA 4PJAB 2XZZA 2E7CA 2VB5A 1NL0L 3K4AA 3QS3A 1Q0XL 4OLVH 4R3SB 3UJJH 4WCYH 5ESAA 1E40A 1XCQB 2O1AA 3GK8H 3UL4A 2ZWNA 2NY0C 1I7ZA 2WV3A 4QCIB 1ZLWH 4P23D 5E9AA 1URIA 4JRYD 5LGKA 3P4MB 2JH2A 3UMTA 1DCEA 3I2CH 4G1EA 2AK1L 3DVIA 2O5YL 1D5MB 3DMMC 2AK1H 4JS7A 2EYRB 4HIXH 1FL6A 2X1QA 2A3TA 4PY8J 2VDNB 1Q72L 3MV7D 5E2UH 4UT6H 1FORH 2ZAGA 4H88H 2UWEF 1XTLA 5GXBB 2EUWA 2Y7SA 3BP4B 1QFWI 4LU5L 5B3JF 1J9TA 4HCRH 4EOWH 4LU5H 1NDMA 1ZA6A 1BOGB 1BM3L 2AANA 1CGUA 1T1ZB 3NCEB 1FL3A 5CR8A 1BZQK 2J20A 5A2JH 2ZKYA 1B6UA 4PJEF 2EICA 1XGQA 2YUWA 5DZPA 2DD8H 2AQQA 4NCC2 3M1BA 3VFOB 3SKMB 3IGAB 2ARJA 2NY5H 4LE8A 4KTYA 4MAYD 2NY5L 3QR0A 2AVGA 5DUPH 3FUHA 2X70A 4QAMB 1S46A 2R0LL 1G6RL 3C5XA 1PCSA 1QEWB 4M6NH 3IFOB 1U2CA 3BVVA 1UCTA 4KI5F 4X4XA 2R23A 3WIIH 1BG9A 4YHML 2SEBA 3FRUB 5CEXB 4G6AC 2ZSVB 4JG0L 1UVQA 5BOPA 5CD3A 3OGDA 2F19H 1ZIBA 2VRAA 4J3UA 3JWDH 1VFBB 4RSVA 5T1KB 5AL0A 2VN3A 1KG0A 4KKRA 5D72L 5AOLA 3RZCA 4V1DB 4M02A 1AIFB 4QF1B 2JJSC 4PJ9C 4E9VA 3NDYE 4C7PA 3GHPA 4WNQB 3EYVA 4RMWA 5CBEB 5LDSA 2FX7L 4ELMA 3MUY1 2KUTA 2Y69B 4XPAL 2DPKA 4PJ9D 4G59C 4K8RH 3IDYC 3P2BA 2XWRA 2GIYA 2XYBA 3GS0A 4IDJH 5GZNC 5IB2B 3RYMA 1HXMB 4IDJL 4NQVA 4PJDB 2DLFH 5KTEL 3V7MA 2QVIA 3FT2B 4P4KB 4DKFH 2ATKB 3NIDB 3FAXA 1KB3A 2PPEA 1RVFH 3DJTA 3QUMB 1DVXA 2R1XB 3EDKA 4LP4A 5DEGA 2ISDA 1QLEH 2HP4A 2NTFB 3REWB 4MJ4A 3RIFK 4MMZA 4GXFA 1UWGH 3MNWA 4ZMYA 2QELA 1OCOB 4HG4J 2J2ZA 3HRZB 3G5VB 1YEGH 2WQUA 5FXCH 2JKLA 3TA3D 4L8SC 4Z7QF 1BAFH 3OKLB 4JDEB 1S9YB 4F7PB 2VXQH 3VJ6A 3JYCA 2CHXA 3P4OB 3CN4A 3FU5A 1N6UA 1DBBH 3E7JA 3H2QA 1H15B 2Z4QA 1XR9A 1Q94A 3BYYA 3T2LA 1GZPA 3CWTA 1TENA 4F57L 3GWJA 2VDOH 2Z7YA 1LP9A 3HC0B 3MNMA 4LLDB 3T0EE 3MCLH 5IQMA 3BAEL 1WRFA 3EFOB 4QHKJ 1CK0H 3ECVA 3U4BL 2CRZA 3EOTL 3QHZH 3MODL 2LTQC 3UTTB 1NCWH 3EOTH 4XNXH 1RJLB 3BGMA 1YYMH 1MRDH 3S3DB 4B0MM 3STBA 2NY1B 3MRCA 2CDEA 4FQHB 5CSZB 2LGNA 3LJ3A 1MHHA 4I3RL 1Z6JT 3D2UB 3OH9A 1AGFA 3ASMA 4PRNA 3S36X 5M94B 5KSBB 2W65A 1RD6A 3IETB 3SDCD 4AT6B 2BCMA 1H8LA 1I7RB 5D2NA 4O2CB 2ZOKA 3DX7A 5DEFB 5FECB 2H0JA 3SNSA 5K9QG 4J3SA 5BV7C 3RKDD 1BBJB 4G11A 3VX0A 1K6QL 2DW5A 1SHMA 1WFTA 4OGYH 1U8IB 5FK9B 1UB5A 5IF0A 3LH9A 1DZBA 5E9DA 5H35B 2WUBH 3KL5A 1CDBA 4U1KB 1RL1A 2BP5M 2ICEB 2JXMA 1HHJB 4OUUB 3U9PL 1IL1B 1E4XI 3S96A 3U6XA 4NUJB 4UNTA 1HKFA 4JW3A 5ICZB 2MRYA 1RERA 3IGUA 4GKZB 1CICA 3CFKB 2CBMA 3A4AA 5A6IA 3FQXB 1MFAL 5HVFB 3C08L 3BKJL 3GTVA 3QO1B 3HG3A 1OK8A 2A38A 4P5MB 4HFUL 1A6VL 5I16A 4Y1AB 3DWTA 5JXEC 4HIHA 3ARFB 1NJ9B 3IDIB 4D7PA 1WFUA 1NINA 2JI3A 3G08B 4HBQA 3BD5A 3T0VA 5T3ZD 2DKAA 3RVVC 5CJOH 5HY9A 1ZGLA 5CJOL 1QHPA 3COOA 1CXIA 1YEJL 2EDJA 2XTLA 3V6FB 1IM9B 4FLQA 2DM7A 4FS0A 5JOEA 3FRPA 5ICZA 2GG1A 4YDIH 3ENEA 5D1ZB 3WXWH 2CUAA 1NQBA 3PXLA 3Q1SH 4TPSA 3TWYA 1PX8A 1DDHA 3X1BA 3X11A 1Q9LB 4RVBA 4GFXA 3PUUA 1T89C 5HYEA 3KCPA 4KTDL 1GC1H 4XXDB 3WO3B 5I26A 2DWTA 1OKEA 4V33A 5E1QA 1F4WH 4FZEH 3EH2A 5KANG 2AJXL 3CDYA 4ODUA 4Y4KA 4ZX6A 4UNIA 1IX2A 1XV8A 5KVGE 4ANUA 1UYWL 2DL2A 3L4WA 4G8IA 3B2UD 4L05A 1VKLA 3CDZB 4IRSB 4X6EB 2ARJQ 1GYVA 1KC5L 2EXWC 4OZHB 3N43B 5JHLL 2BP8A 4NJ9L 1DQTA 2YD9A 5TFSL 5JTWA 3KPSB 3U2JA 3HPLA 3LKQA 4W9JC 4S1DD 5J9PA 2G75A 4K55A 1L3WA 4QUOA 3N06B 1YYLL 2R2HA 1FSKB 4N2GA 3RIKA 3UTTA 1P9MC 1MCJA 1R3JB 1JXFA 5HJGA 4G5ZL 1A6UL 3MFFA 4CL7A 3HG1E 5ID1B 4QHMA 1SHSA 4MYPA 2VLJD 3EYSL 1QTPA 4N0FB 2CKBB 4LQ1A 3CDCA 1URZA 3GMPA 4MAZA 5D6CB 5F0JB 1P7HL 2Z3FA 3LKRA 4BFIB 3QUZC 2LU5A 2CBTA 1NAMH 1WFJA 3L48A 4HETA 3D39E 4KUCD 3VFNA 2EYTB 4JKWA 1IO4C 1T2QL 3GTNA 2WSKA 4AENB 4BDVB 2QLYA 4Z7UA 3ZL1A 3SKMA 2V9RA 3LQAL 2NY0D 2HJKA 1SXAA 1XGQB 4IM8A 1W8NA 3QDGE 4GAJL 1KJ3L 3MXVL 5ECJE 2OMZB 2J8OA 3BP5A 3NSJA 1FNLA 1VEOA 5E5RB 3S88H 3KPOB 3MCYA 2IGLA 2NPLX 3SZ6A 2AJUH 3SYAA 4HHGA 2F53A 5EZJA 2ETWA 1RJYA 3BISA 3RTQB 3BFWA 3GHBL 3VNZA 1UZ6E 4C56B 3O2VH 2EAEA 5EFIB 5CHNA 4KV5E 4L1SA 2XOTA 1ZV5A 5JO5A 5IVXE 5HDBF 4M4PA 4K3JL 4QHLA 2WLNA 4UV4H 2MKLC 5HGAA 1WEJL 1L9NA 2YKLH 1IBGH 3US0A 3DVGB 2BVYA 2FHFA 3ZUNC 3D39B 4OF3A 2ZCKH 1EAOA 4B96A 3LMJL 3OQRA 4FXKB 1OPGL 3SKJH 3FYIB 4B7IA 4PGBB 4XB3A 1XH1A 3KPQA 5HYJA 3OQ3B 4BH7B 3EBAA 2WP3T 1T0MA 2ZSWB 3EF7A 1CBVL 3DRTB 1CFMA 4FKHA 3TX4A 1FVDA 4ERSH 1EZSA 5DR5L 5IQ9A 4A63A 5IJDC 2H9GA 3M8OL 2QQQA 4LLUA 3TBYA 1KO9A 4R96B 3Q2NA 2JQAA 2YWZA 2X6CA 4F37K 2ZX7A 5D55A 3IKKA 4NNYA 1HSBB 2FO4A 5I6OA 1TQTA 2DQJL 2EH8H 2X4PB 2D7MA 1FV1B 3IS1X 4P2OB 4AM0A 1ET8A 4BZ2L 5AG8A 1F0LA 1T3FA 1M3QA 4IS6B 3MR9A 3SPHA 1JGIA 1MHCA 2PO6A 1HHHA 1KYOJ 1U8PA 4R26L 3RA7L 1LMIA 5MEND 2ZXWB 4LKXA 1EHLH 4CVXA 4YPJA 5GJTL 3OAWA 3VXNB 4J8RA 2DIEA 1BQHB 2R9HC 3VXME 5C8JA 5JUEH 3GB7A 3BYTA 3NFPB 3R06A 3BE1L 5E08H 4S1QH 1J8RA 3TO2B 4YEFA 5F7FA 4JFEB 4PGZA 2YXVA 5C09D 1GPOH 1NCBH 1SY6L 1C12B 2EKSB 3LXUX 3QIBD 4N26A 4NLAA 1RIVH 3FSZA 4MJHA 1AO7A 3ZTJG 2VMFA 3ZE0B 2FECL 5L0QB 4XMVA 3QQ3A 1VENA 2Q3XA 4OFKA 1VF5C 4RESB 4Q9RH 2E0PA 3PS6A 4YXLH 1TETL 1OIOA 5SX4H 3JTBA 1OQOA 2VQUA 3ULSA 2WIIA 2G5RA 3CXHJ 4NB7A 2NR6D 4KX7A 3H85A 1B9KA 2HYMA 1JV5A 1HL9A 3U7WL 1P7KA 5AVWB 4JMNA 1UURA 1GXEA 1J87A 4LSDA 4PR5A 4ZW5A 2P8MB 1AGDB 3CH1B 4NQEB 1KWKA 4Q9CA 3ARDB 4GW1A 3A67H 2J3SA 3UC0L 4CDHA 3OKOB 3S3PA 2BXZA 2DTMH 4GG8B 5AYUL 1T83C 4KH2A 4AYGA 5KYYA 4YSTA 1NGZA 4PP2A 1YQ2A 5BXFA 8CGTA 2HFEB 3DOSA 3RY6C 1XH3A 3U36B 4X9IA 3MRQA 3BEWB 3IE4A 5E1IA 4FFYL 4WV1B 1J1PH 1GYCA 4YGVB 2MTAA 4YZWA 2I32A 2Z9TA 1X9LA 2ZKXA 2VLMD 3BLBA 4LFHD 4M62H 3UX9B 3OLIA 3KH4A 1ZKAA 4O51A 5EPMB 1A7OL 4MCZA 3N04A 5H8DA 3O2DA 3DOHA 5IBLC 2E86A 5L6YL 1PEWA 3IGKA 4ZFZB 3NH7L 3V0GA 1NKRA 2QVKA 2X1XR 3HZKB 2HUHA 2UWEA 4NQCB 1ONQA 2EO9A 4MRBA 3IMWA 1I75A 3F7VA 3B7SA 3OZLA 4JKPH 2V8LA 3FDWA 5DLLA 4Z7OF 5C0RH 4AMXA 4UV7L 4EUPH 1FL6B 1OLZA 3B9EA 1UZ8B 4L4TA 5KSAB 2VR5A 3OZ9H 1IE5A 3QWOB 5T3ZL 5TDOA 2FYYB 5G55A 2EDQA 4UIKL 3WNLA 2K0RA 1P69B 5F1NB 1IGCL 1NGZB 2YMOA 3NACL 4PP2B 3ZO9A 2ZAIA 1MG3C 2WW8A 2HRPH 3IMRA 1F41A 2W94A 3K1KC 5DUML 1H6TA 5AW8B 1DSFH 3D9AH 4ZO6A 1GW0A 4QJ4B 3ULUH 1YNTA 1ZGLM 5C08A 4NQDB 4A2HA 3DXAD 4Z3FA 5MP6H 3EJRA 3HE6B 1CGSH 5DJ6A 2EE2A 3H0TB 4ZUWB 5LBGA 5I1EH 1U8QB 4Q14A 5DZVA 2Z7WA 1SEQH 3SDAB 3V9CA 5GHWL 3MZTA 4XNXL 2GT9A 2H9GB 1YUHB 3LPWA 3MODH 3OBAA 3UTSD 4H1LG 2FBJH 4M6NL 1CZ8H 5KVDH 1BDYA 4AQ1B 1D5XA 2QDVA 1DJHA 2PCPB 2Y23A 5B4MD 3V6ZA 2MJWA 1NGXA 4Y4HB 3UAFA 3APNA 4YDKL 1OCRB 3OKKB 1NDGA 4EN3B 4PGEB 4WV1C 1XZWA 3V5DB 3FUEA 3WS3B 3D69B 5I17B 4YHYC 4RFOL 2C9XA 4WWPA 3ARGC 3N85H 4BGLA 1XEUA 1YQKA 4NHCL 1T20B 5IR1A 1NSNH 2E4FA 5HGAB 4OCYL 1YUKB 2YK1L 4KKBC 1BFOA 4G8GA 1N0LA 3PP4H 3T71A 4LIQL 1CTMA 1IE4A 3B8SA 3DJZA 4KDVA 1O6VA 2J73A 2XY2A 4UUJA 3EJTA 4JN2B 3VRJB 2EH7L 5CEZD 3RX8A 3DV4A 4PD4K 4DZBB 4YMPA 2B1OA 3CFTA 1ZLVH 4QTIH 5EOCJ 2JCCF 4N8PA 3RDTC 4NKIH 1ZT7B 4BWWA 4ZFGL 2F15A 1U95B 1OAXH 4NKIL 3L3HB 5AG9A 4DKFL 3GI9L 4MJJA 4GRLB 2V3EA 2VR8A 1U93B 3E9UA 1WQVT 4WQOA 4ZG1A 3QDJB 3NZSA 2EE6A 2MTPA 2APVA 3MBXL 5JN5A 1QPKA 4IQHA 4QRAA 1CD1A 25C8L 1INDH 1BVLA 2G60L 2I7OA 1NDGB 3CZLA 4GXVH 4YDVA 4EN3A 4Z7OE 1SOKA 3BKMH 5KZCB 4LCCA 4PJGF 4A1RA 3AGVA 4F7CA 1XGZA 1SM3L 1DJXA 3JUZA 1XDTT 4S0TD 3CZEA 4JZJB 1YDPA 5K1VA 5TE4H 2CK2A 3OVUB 5D6CA 1MP9A 2CA4A 4GFTB 5I15L 4XBEH 4UTBA 4MZRA 1PIFA 1YPZF 4HD5A 4OZIE 1FZOA 3WDJA 4IK7A 4UQEA 1E4JA 2H6PB 3MNVA 4KUCF 4XCCH 1OGAA 3TT1H 4J3OD 3FAWA 4WFFD 5LCVH 3D05A 4YO0B 5SWSD 4L37A 1QN6A 1AFVL 1GY1A 3EJUA 3BSGA 5FGCB 4N0YL 1KPRA 4NO0A 2W9DH 1NMAH 3MLSH 4X5XB 5E8NB 5F3FA 2RMNA 3D25A 2O61A 1KGWA 3D50A 1Z9OA 2IPKA 1UCBH 3R0NA 4CADB 4LEBA 4P2OC 1LQBC 1BZOA 2V4LA 2CALA 2BZ7A 2R39A 2ZXEB 4FN0A 3WFHB 5BNXD 1TO4A 2VDPH 1SJHA 1KPUA 1NFDB 3QJHB 2ICCA 4OJEH 2ZXDA 4JG5A 2DI8A 5JDSB 4DT2A 5B7MA 5CWSB 1ZJBA 2DQEL 1GC1L 1MF2L 1RZJC 1FYTE 4RH4A 1H8NA 4AYSA 3B2VH 4YXKH 1WFOA 2R29L 5AZEL 2EIBA 2F7IA 4N0CD 4LPUA 3TO4B 2GAZA 4G6JH 4TN9A 5EEUA 3GSXA 5E7BA 3KWXA 2ZUWA 2PCYA 1T4KB 3PUCA 2W5PA 2X05A 1MFVA 2ERJC 2CDGA 4HAKA 3U0TA 3O45B 5TDPB 3EO9L 4IIQB 3K71B 2AHIA 4MD5B 5ENWB 5A7EA 4U0QB 4X6CF 1A14L 1MFNA 5FYJL 1M1XA 3LYRA 2BPBA 1A5FH 1JTPA 3SDYL 1YNTF 4HJIA 3U7YH 2IWGA 1ZS8A 2R56L 1YN7A 3C08H 4N8VA 4Y7OC 5F7KC 5A2FA 1MCWW 4W4OA 1PZ5A 1TQBB 2PYED 3FOMB 4LLMB 4N9OB 4QDGA 1MOEA 4WWKA 1T1YA 4WUUB 3S3BB 3SE4A 3SO5A 4B9PA 1FFPA 4UMGA 3SJVD 3GUTA 1CICB 2QVMA 3CFKA 3CVHH 1V10A 4XPHH 5IY5B 2J8HA 2IDQA 3VXSE 2OJZL 3LKNB 3TVMC 3O41B 4MD4B 1R5IB 2R1WB 4UAHA 3WNJA 5CN3A 2MCPL 4Z7NB 1AACA 2AABH 5F6IC 4LPWA 4WEUD 1F1AA 5HBBA 1G43A 1N0XH 2DMGA 2QR0B 3LQZA 1S9XA 4M48H 3V0VB 4RQQB 4TV3A 3CMOH 3L3DB 4AH2A 4M5YH 1UZGA 2YKLL 4JCLA 3NSXA 5EOQL 3DGGA 5BO0D 4ZPVB 3TV3L 1TVBB 3AQYA 4N2FA 2Z0FA 4XNQB 3BN9C 4IBVA 3ZKNC 2QVTA 2FGTA 4A37A 2Y06H 2YA2A 4P3DB 2IO5A 2Z64C 3GHBH 2Z31B 1A9BB 3B43A 4R5XA 1S7UB 4AZUA 5IROD 1FBIL 3DV6A 3FT3B 2ORBH 4QXTA 4XZUB 4FQXB 3SE9L 1USZA 1WICA 2WVVB 3QIWA 5K9OB 2Y2TA 3L3KA 3TZVB 3WKPA 1IEBB 4JRLA 3TFBA 3L4UA 1HZKA 3CD4A 4G7RB 4JRWA 3CLWA 4PBDA 2PCPA 4OLZL 4X2UA 3I9GL 2DQMA 4IW4C 3OR7A 5EA0L 2AITA 4TTGA 5IESH 4NBXB 1CLZH 1HKLH 3QXDB 4K23H 1YA5A 2G30A 1MCOL 1E5BA 2VO5A 2WLYA 4LHUG 2H3NB 2DIBA 3CLEH 1MCOH 4PJFB 4Q2ZA 3FHAA 5I6LA 4EI6B 3PJSB 2PTTB 5IOKA 5D2NC 2HT4D 1C7TA 2APSA 5GRXG 5L4JA 2HTLC 2Z31A 4HJGA 1VGKB 3E9TA 1S5IL 3W2DH 4JRXE 1TEFA 1AYOA 4XTRD 1QFHA 4AWJC 5EIVA 2GSIA 2X4OB 5AW5B 2ENJA 4AV0A 3QDJE 1S7WB 5SX5K 2P8PA 1LK2A 3S48A 2ZOKB 1NA8A 1CVSC 4X83A 4UQCA 3VNYA 1D9KB 1LQSR 2ADFL 4P46D 4PRIE 4HCRL 5SWQB 2IMMA 2DLIA 4Y19B 4ZYKA 3OAZK 3DJ9A 1MHPL 5E8DL 3VYPA 3CFJA 1I82A 5JHAA 5J12B 5C07D 1QAWA 1HH9B 1XF3B 1QA9B 3CGTA 5FGSA 4KI1A 4KZ0A 3P2DA 1RH8A 4KRPC 4O58L 4S0SD 3H9HA 5AENA 1FFPB 4RNRA 2ESVA 4M7KH 2ATPB 1E6JH 1BQLL 3LMJH 4H20L 4NJAH 5BXFB 4JFHE 1WBYB 1V55B 2DEYX 3AS1A 4X9HA 4YHKL 4OIIL 3LNIA 5IV2A 3EF4A 2BHZA 3S37L 1USQA 3MX0A 2LFEA 5E2WH 3HUJB 4P0DA 1DIZA 4JFHD 3VGHA 2HRLA 1OWWA 4GH7B 1WP6A 5D6DC 4NO5A 5IBUG 3RVTC 4F5CE 1NBVL 2WO2B 3QNYA 4NC1E 1E42A 4MMYA 2P43B 3KLAB 3L5XH 2G2RA 4FFYH 4GKSB 3ZIYA 2LE9A 2VRKA 1WUNT 3V6OA 1V27A 4WK4B 3T3MB 4POYA 4HWZA 2WXRA 4LOUD 3VFUB 1EO8H 1QBLH 2N59A 4DN3H 3J27A 3LD8B 1MI5D 3W9EA 2HWZL 1XIWD 2IJ0C 2WQWA 4AXWA 2KERA 1YEDB 3GZKA 2OCJA 3QAZB 4B53A 2PR9A 3QYMA 1A7PL 4HK0A 5HYSB 1YN6A 4U1HB 3UZQB 2D0CA 5GRZA 5AUMA 4PRBB 3KPPA 1SN2A 4M8VA 1B2YA 3OZ9L 3D4YA 4HCIA 4PVMA 2CIIB 3OG4B 5JIKA 2PWEA 4DFHA 1WD8A 4UIKH 4WNQA 1PZ2A 4YO0A 4PUBL 3A24A 5K93A 1QLEL 2UYLB 1NBQA 1JHLH 5EO1B 5DLML 2A6DA 3ETBF 1WA0X 4ZXBC 1DQML 4FFZA 1A47A 3LHAA 3QNYB 5KOVC 5I74C 5IHHA 2VMCA 4KRPD 4Z7QB 2QR1A 3V95A 3OC5A 2ZT9C 1X5KA 1CN4A 2CRIA 4G7SB 1E9OB 1MCWM 2W91A 5FYJU 2H32A 3OWRA 1EDYA 4KO9A 1KGCE 2JKSA 3P73B 1RQ5A 4I85A 2PYEA 3ZKMC 4LNRA 1PSKH 3DRQA 4X9BA 2GUOA 1CDWA 3VD5A 1QNZH 4PSPA 4GQ9H 2NOZA 3TO4C 3IJ7A 5IJVA 4N3UA 4IKJA 2COQA 4PV8B 1IKOP 3TN0D 1JGUL 5I8OH 2AGJL 3KS0J 1ECZA 4QRRE 3TO4D 3QNXB 1LVEA 3ILPB 2V7HA 2XIDA 1WK0A 2HRHA 3C5SB 5F0LB 4U3SB 1MELA 4OQTL 4OFVA 4I48B 1KXQE 4YL9A 3ZDYE 5H35A 3D6GA 1PW3A 1RZ7H 1T22B 2CDFB 2GSMB 3WGUB 5F9CA 3GZPA 1M6OB 4FXTA 5CU5A 5HPOA 1H3XA 3C6LB 3T6XA 2QADB 1PKOA 3O9WD 1K5NA 4JCWA 4LDEB 2NUPA 3SD2A 1T66C 2FWOB 4HK0B 2H1LM 5E56A 1Z5HA 3IMBA 4PRNB 1RZIB 2VXTH 1RUPL 1INDL 4GXVL 5DJ8B 2H8PA 5E6IA 5EH1A 3PL6A 4M1CD 1SM3H 4QRSB 1VAHA 2WP3O 2Q86B 3STLB 2AMGA 2FEEL 2ITCA 1ZDQA 5SWSA 5T1DH 5JQ6L 3B5GA 2Q20A 4N20A 3IDJB 2J6EA 1CFSB 4R7DA 3SCMB 5EUKA 5T3ZH 1TTFA 2NZ1A 3QIWD 4KK9D 1RIHH 1RK1A 3QG7H 1XR9B 1Q38A 3FT1A 1GA2A 1GGUA 4PSRA 5D7LB 4L4VB 1QVOA 1YN7B 1P9MA 1JOIA 1ZT4B 1E9QB 3QNZB 1ZHBA 4JNXA 3TT1L 1QHQA 4HSAC 2J8UE 1JYVA 2UV3A 2B4CL 1QSFA 2JF1A 4PTUA 4UQ3A 5KANI 1EBAA 2FWSA 3QGVA 5CAYB 5GRJL 1IVTA 4L9LC 4JHAH 2SODB 3RX5A 1HINL 4F7TB 3K74B 3WIFB 5EORH 3K0YA 1KTDB 2MCAA 3U4KA 4JFPA 4G8FB 2NZ9D 2P3YA 3T3PF 2R9HD 3WJMA 4U6HB 5HHQB 2WZ6A 1OD9A 5IFJA 4G7VH 3O0LA 2LAGB 4OZHA 1ZSHA 4KQ0A 3TVMD 4ANWA 4U6TA 2CUMA 3LEXB 1Y0LA 3B9KC 3QZNA 4RMTA 5CMAB 2L04A 5TQ0H 1DHKA 1T5WB 3HRPA 4RCAA 3S2AA 4TSAL 3K4DA 3L3JB 2OP4H 4M43H 2D7TL 3O9WC 4V2CB 1YMME 5LO7A 4G6JL 4X0KB 1A66A 3V5HB 4GUPA 5IB3B 2FJGB 2VAAA 4AQ1C 1DDHB 3EYFA 3BEWA 2BDNL 4JKNA 3UTPD 4PJHA 1PS3A 3AM8A 4BE5A 3GUFA 5IHZB 2VR9A 4NFDA 5FO9B 4BFGA 5A6MA 3GSWA 2NYYD 5FYJH 3D2TA 3HN5A 2BOCB 4Y4HD 4YHYB 4XE5B 4PLNC 5GRYA 1AIFA 4QF1A 3GC3A 3SKNB 4OZ4B 4OZGB 4BZYA 12E8H 5SX4I 4BKSC 1UASA 2UWEE 4Z77B 4XMKH 5LDUA 5HHVL 4KNUA 3L3GB 3I3WA 1S6NA 5GS2D 1XT5A 4NZRL 2ZG3A 5KBMA 3HUJF 1T83A 4BSVA 4ZMQA 1OARH 5C2UB 3RGBA 4F3FB 5I1LB 2OMTB 3DXAB 2E46A 1PNCA 4C55A 3NRQA 3IMUA 4HUUA 2FUVA 2C7UA 3IJEA 3TDHA 4OD1L 2JKIS 3IS0X 4U49A 4P99A 3WTTA 3O11A 3N43F 1HT6A 3TXAA 4E41B 3I0XA 4G42A 1QR1B 3ZKXC 3EXLA 2WYTA 4TNFA 3MC0A 2EDNA 4X98B 1KIRB 2ZX8A 4NRYA 3WE1A 4BK5A 4W81A 3IWVA 4M5YL 3DMMB 5GGQH 1C16A 3FUKA 4LVEA 3VGAB 1JNLH 2YUVA 1NDMB 1COBA 4IU2B 2H4EA 3HG5A 4IOSD 5KN5A 4GI9A 2DDQH 3VRJA 4WVRA 3BSHA 1HYRC 3QDME 3QI9B 4Q89A 1U3HC 3N1PC 1JPEA 5GZND 5D5MB 3DXAE 2H2PC 3U1PA 5EIIA 2QV4A 3EFFA 3LPOA 1WWWX 3VXSB 4KJYB 2AJ3A 1AE6L 3LKPB 4MDIA 4AVHA 3IDMA 2GK0B 3HZYB 1ANUA 1IM3B 1C1EH 3B5HA 1QP1A 4J3BA 1BWMA 3EDFA 3RHWF 5LAXA 3RUGA 4YX2H 4Z7NE 2IALB 5I17A 5CILL 3WTXA 4CU8A 4JLRA 5FYKL 3B2VL 1LO5B 1KELL 2X4PA 3PJSA 2W0KA 5CZKA 2G2PA 3SEPA 3RFZC 2YRLA 4DUXA 1QUNA 1QKZL 2PMZA 4S2SA 1W0VB 1CE6B 4DGWC 4E36A 5LXGL 1NLBL 1CFSA 1X9QA 4Z23A 4I18C 3EHBD 1TMQA 4Z7UF 4Y2DD 1QQDB 3A47A 4A7VA 4AZ8B 2A9BA 2V9JA 5H37A 2ZSWA 2DQJH 2EH8L 1M2VB 3TN0A 2QFPA 1KLGA 3E8UL 4FERA 3SBWC 4MJ6A 4FEIA 3HHSB 1CD1B 3O45A 2RACA 1KFQA 2Z93A 4CAGA 4XP1H 1A7QL 3SZKC 1AQKL 3J07A 1HQ4B 2G0LA 4F92B 4DKDC 3AG1B 1TBPA 4BKLB 1H5BB 3Q13A 3STZB 4C8XA 3VFGH 3C6LA 3VUAA 4WSGA 2VLRA 3PGDB 4ZTEA 2BIIA 3CAFA 4GW5B 1MCEA 1RZJL 4R84A 4JCMA 4TQ8A 2VLRB 3AWGA 3PGDA 5BCAA 1WDAA 4ANVA 1U92A 2HX9A 1HCZA 2ITEA 2VMDA 4TL4A 1NPUA 4ZMXA 5C0GB 2IANB 3HMXL 1ED3A 2DN7A 1YNLH 4I1PA 4BUQA 1CL7I 2VC2L 2H2PD 1M7DA 4HMCA 4JO2L 5CLWA 5KYUB 2CLZB 5ICXA 3MRNB 1MFMA 3T09A 3CXFA 5DD6A 4Q9RL 3WFBL 1D7FA 1NGXB 4Y4HA 5HJ3A 1M2VA 1TCRB 2NYKA 1FFNB 4LHJB 1HI6A 4JGUA 2Q8AH 3MLUH 4GIPD 4QTFA 2ZZUT 4PJDE 2AF2A 2HKHL 3MOQA 3ESVF 4JM2F 3GMPB 1FNFA 1XFPA 1C47A 3VWJC 2X87A 3P3YA 2XN9E 3QA3B 4X5LA 3C5ZD 5HDBE 4NWTH 4L4TD 4DEPC 3KG5A 2HLEB 4XC3L 3LTVA 4HUVA 3MLYL 3DO7B 1J1PL 3MRFB 4NYLA 2GJ6E 3GPSA 4NQCE 4Z77A 1NCIA 4XMPH 3ULXA 1KTLA 3K2UH 4P2CG 5JXED 1UADC 4J3OC 5EA0H 4OV5A 4KY1H 5E8PB 2VL5A 2KLSA 4PJEB 5T3XL 3Q6FB 4OFPA 3V5KB 5GZOC 3GRWH 3P54A 3O3AA 4PYGA 1KGJA 3IGAA 3TO4A 1NOFA 2IGTA 2WINA 4H0LC 1KIQA 1T0NA 4UWQB 5KYUA 1IKFL 2EIMB 3V5HA 5BQ7B 4I87A 2IWFA 4PG9B 2L7JA 1U42A 1YNKL 1H0DB 3BWUF 4OT1H 5D4JA 2PWGA 1Z5LA 3DETC 4WXAA 3LAFA 2VN7A 4C56D 2EQDA 4CSPA 1WC7B 5I1DA 3G7TA 3X11B 4DKTA 3DMMA 5IEHB 1QASA 2VLKA 2PXYD 4TPRH 3V0DA 4ZDHB 1OCWL 4GMTL 3FMGH 3D9AL 1EQWA 3FUDA 3NA5A 3A21A 3MQIA 4FXGA 2WBWB 1RHFA 1T6VN 3U0WH 4ZFFB 3KVDD 1RSYA 2HVKB 3CC5B 1M3IA 3OLDA 2DM3A 1E5AA 1BAFL 3PABB 5D2LB 2AFNA 2C7UB 3HOGA 3CDFA 1PZ3A 5CZXD 5BRPA 1H9VA 3MJGX 4IGBC 4K9EL 2VIRA 5LG6A 2OTWB 3IAGC 4AQ1A 1QVOB 5DJ0B 4PRHA 1C5BL 2R27A 3ULAB 1J0YA 3PWVB 5EIIG 5BRQA 2ZF9A 3KAAA 1FF5A 5HGHA 3GSWB 5I1JH 2Y1YA 5FUOL 4LIQH 5KAQG 4PJHB 3M17B 3LZRA 4LSPH 1MH5A 1IAIH 1PF3A 4I4WA 3BVNB 4K8RL 1J8KA 1I8KB 3CHRA 4A2GA 2WQXA 2Q6WA 1MEXL 4M29A 4MMXB 1JYNA 3TBBA 3EG9B 4ZX4A 5JR1H 3VWKC 3MRHB 1X5MA 2YARA 3AXLB 3GGWB 3LKPA 3O3DA 3AMKA 5CGTA 4KDWA 3BKQX 3QQ9C 3SDCA 2Q76B 1CT8A 4JPIA 4LLYA 1EGJH 3RVXC 3ILDA 4N25A 3OMNB 1U8NB 2ED7A 2OCFD 3KW8A 1UWGL 1O7DE 4JO8A 5JQ6H 4RZCA 3Q1EA 4JJ5B 4ADGA 2NY4B 1V7NL 1NH2A 2AAVA 3BT2H 3TP4A 3QR2A 1WCBB 5KVGH 1RJLA 3UXFA 2FX9H 1RIHL 3C6EA 1J9RA 3BZ4A 3QVAA 2OXGA 2Q9OA 3MR9B 4OB5L 4PB0H 2Q87A 2ZWZA 4NN6B 4R5VA 2AQTA 4A7SA 4JRXA 4IOFD 2HKAA 4UBDC 4L1DA 4ZUTA 4Z7AA 2APBA 5EUOB 3ARFD 4M6OL 4YLBA 2V8MA 4DPBX 3AU0A 2D3VA 4Z7WE 3TBYB 1I3UA 1MFDH 3I6LE 3MJ9A 3VXRE 5K1NA 1A1OA 1AJ7H 4I2XE 2V7NB 3PE9A 1CTNA 5IMLB 3RRQA 4FQXC 3RWGB 3HPLB 1UB6A 2ZYRA 4YBLC 5AOIA 1HOCA 3BPOC 5E6ZA 5AVTB 2Z7UA 4L48A 1SN0A 4KK8D 2FQGA 2XWCA 3ECBA 4UDTA 5DHXB 1ZWIB 4ZAKB 4F8OA 4OZIB 4LP5A 2X7LA 1J8HE 5DJDA 5DS2A 2NW2B 3LQAC 2XXGA 1MJ8L 2KZWA 4JFFE 4CSZA 1PD6A 4KJWC 3VM5A 1EERB 3KVPA 1RV6X 4LBAA 3HI5L 1I1AC 5D7HA 3MLTA 3HNVH 3MBEB 5H2BA 3VGAC 4YHPB 1PGRB 5ICUA 1DJIA 1QW8A 2CXKA 2WYZA 5C0BB 1R17A 2VERA 5AVZB 3ZE2E 4NO3A 1L5GA 2HFGH 2FLMA 3L5WB 3Q3GA 1T1WB 3GIVA 3V6FA 1BD2E 1KCVL 4JVWA 2WUCL 4NZUH 5EWIH 3OSKA 4XC1L 3UTTD 1I3RA 2WUBL 3CXHK 5C0ND 4PRPB 8FABB 3OXSA 2HFEA 3DOSB 3QK0A 4EN3C 4Z6AT 5E2VL 1TR7A 1X5GA 2AQNA 2XU9A 3EJJX 4J4PC 1MW2A 4OV5B 5FS5A 3MRLB 2DQCL 1AS8A 3K6NA 1K3ZA 3C60A 1UG9A 1U0QA 3QH3B 3CN3A 2K9UA 4V2BA 2DKCA 2E9JA 4ONGL 3ARGB 2MWCA 3F5WA 4NAMA 4RSYA 4E5XB 5BS0D 2CO4A 3QJRB 1K8DB 1JJUA 1AZBA 1KIPA 3IU3A 1RK1B 4H8WH 4QRTB 3BUYA 4PS7A 1FVCB 2OS7A 2VDQL 3Q0HA 4YC2C 3ILQD 1LGVA 1VB9A 4NAJA 4QT5B 4NNXB 3HA0A 4NO3B 1CI5A 4HH8A 3F7LA 1T0MB 3GXUB 2J55A 1WZAA 3NA9L 4NGHH 3I6GB 3S7GA 1XCTB 1A7RH 4KUZH 2TSAA 5CEZH 2R1YB 3KRMA 4OZHF 1CDCA 2FWOA 4NXSA 1A65A 4AV5A 5EEVA 5BVJA 5D6DA 1OGSA 1JZEA 1E8WA 4A38A 4Y2OB 3GJFA 3WG7B 1KC5H 4X80H 3CFBA 2WVSA 1E7UA 4UU9B 3NZUA 4B9GA 3TEYA 3IGFA 1DQDH 5FYLE 2I5YH 4HGKC 3EO1B 4KKLD 4FG2A 3TYGH 1DQDL 5F9WC 3AADB 1KIUB 4A7QA 1YVLA 5LAPA 2OMXB 4MZ2A 3WIHA 2EE0A 2ZOUA 1FFRA 1OANA 3I9AA 3QNXA 1NBYA 2ORBL 1HVXA 3SBPA 5HY9B 1K35A 4IL8A 3WMSA 4FNTA 3IFNL 1HHIB 2NT1A 1EAQA 1NC4D 5F7NC 5MEQB 3TA4D 3QXTA 2K6WA 2BM3A 3Q2LA 3KS0H 1JDDA 1OAZL 2DBLH 2IVFC 5ISZD 1KBVA 3WEOA 1WGOA 2IGFL 5D7IB 3GBLA 3DRQB 2IPUK 4MZ3A 3QQXA 5DT1H 1D3CA 1KTJA 3MLXL 3W2DL 1TTUA 2MOQA 4O4YL 2ARWA 1Z3GL 5C0AD 3UYOD 1JPSH 4K3HA 2K7PA 1UD6A 4MJ2A 2EXSA 3T04D 3QXWA 4QHUB 4Z7WF 2NY6B 1HL5A 2Y72A 3DIFB 3MJ7B 5ESQB 4BH7A 3ISWA 1E8XA 4P5TC 1DQJA 3FULA 3UYRL 3SDXE 5FO8A 2ZFDB 3MLRH 3EO1A 5FM5M 1WHOA 2DQ6A 4DQOH 3KXFE 2P44B 5D70H 2V5MA 4APXA 5DEGB 4D9LL 2VZOA 3DETD 2XTJC 4OJYA 5CJXA 3KMDA 1NBCA 3W0WE 3HAEH 1NMCB 2YGPA 4LO9A 4C56A 2VJ8A 5HYSA 3AG4B 1N70A 5HDQH 4HDIB 2DAVA 3NCJL 3CWUA 1DLHB 4UOZA 4XXDA 3IDYB 3L6FA 4ZSOB 2CJ3A 2Q3AA 4ZODA 2ZX6A 4P23B 3M17A 2HKHH 4Z7WB 1JN6A 5JIMA 5DZLA 2HH0L 4J1UB 4O2FB 4PJBA 1CXHA 3MV9D 1KV7A 3V4VH 1IB5A 1IBGL 4EAJA 4FMKA 2VZTA 1AAJA 4M61B 4TMPA 3V52H 4Z7UB 2XWZA 4PV1C 2FJUB 1MWAL 1WWCA 4E9SA 1FLTX 3BVDB 4WI2A 5EC1A 1E4WH 4ZXBD 1TUOA 1NTDA 1XGRB 4Y8DC 1C5CL 3BQUD 1KCUL 2G9HB 5IESL 3BC9A 4G8EA 4HUNB 4IRZA 2PXYA 2X9XA 4WWKD 3GSNL 3SE8L 3VI4A 3I3EA 1RFDL 4LPYA 2XJLA 3T2OA 2R2HB 2M1KA 3HRZA 3L9EA 4UT6L 3X1FA 4K94H 4RNRB 1NL0H 3KJ6L 3TH3T 4MMZB 2N4IA 1TZGL 4NN7B 1I8LA 1OAUH 2F54E 4X7SH 2PKDA 1JPFB 4XCNA 3RU8H 3L95B 4ZDHA 2YHGA 2IH1B 3D09A 3DGDA 2B77A 2AQ1A 5DQDL 5T33H 2JB5L 1PCZA 3L3DA 3PL6C 3VXMA 2UX7A 4NHUA 1NPJA 2JKXA 3FMGL 4OM1L 3BAYA 4MAUL 4X0NA 1P5UC 4GMTH 3PWLA 5CCJA 3SE4C 3ZR6A 2EE3A 4XVUD 5DGRA 1M56B 3L3JA 3L13A 2R1YA 4JFWA 2W0FA 2XETA 3QEGH 4YBQD 2VXVH 4NENB 2R69L 3HG1B 5BV7H 3QJXA 2BNUA 4HWBL 5J5EA 4NBZB 1QI4A 3QEUA 4R0LC 4PBWD 1Q8MA 4RGNE 4EJZA 1KGYE 1BM3H 3ZHFA 4YHMH 4PM1A 1AGFB 4L4TE 4ZUUB 5C0IB 5HXMA 3GUTB 2FLRT 1M3HA 1U33A 3MRCB 1CD0A 4YSAA 4OLEA 3S36L 3FL7A 1QUPA 2P48B 1A25A 5AVYB 1XWVA 1ZA3A 1MVUA 4OVVA 1YEIH 4CKVX 4OLXH 5CS7A 3QO0A 1OO2A 4ECNA 4JFTA 2YXMA 3BUTA 3C9NA 1ZLSH 3ZKMD 5I18H 2VZSA 1ZTXH 4R4NC 3L4YA 3MYZA 1CTOA 1ZHLB 5DS8A 1TCRA 3FB6B 3B2XA 2ARJB 1LLAA 4HUWA 4MXVF 4LLVB 4G8AC 3O6LH 3L5WA 5B22A 1IGIL 3GSOA 4GAFB 4ODSH 4QO1A 3FCUB 2VLKB 5JDSA 5LGHL 1O7DC 1MIMH 3WUWB 3NJHA 1S7UA 3JV5A 4C4UA 2BFGA 5KUMA 4ZMWA 4EN2A 1KPUB 1OQXA 2ZUVA 1QI5A 1SJEB 4BCZA 1JUFB 1B4JH 4JN2A 4NP4H 1CB4A 3IVKA 5EC2B 2XN2A 1AG0A 4UV7H 1IBHA 2W0PA 3BVXA 1UD5A 3S8FB 2WJ5A 2WINB 2HT3D 2FIKA 3ZHDA 1FAIL 2H3XC 4NWUL 3DX7B 1S9XB 3VXNA 4EALA 3MLVH 1FAIH 3LVEA 2XPGB 5B8CB 4Z3EA 4ODHL 3BPLB 3AG2B 2C3VA 3OGOE 4FG0A 2GK2A 4G6ML 2C9QA 4R97B 4X99A 3CVHB 1BYOA 1OAQH 3QIUC 4WSJA 1I1AD 5DUMH 2X38A 3DO4A 5GRUL 4MJ6B 1AQMA 2NR6A 2EDXA 3NRFA 4TPRL 4DKEL 2CR0A 2KS0A 1GW6A 2BHUA 2WM0A 2ATAA 3SPVB 1UGKA 1CLYL 1JF6A 1JK8B 4F8LA 5TD4A 2X12A 4KJQC 3EFOA 4W9EC 4XVJH 4F9LA 3VWKB 4QIRA 43C9A 3HAEA 2QLVA 4YDZA 2Y25A 3EYQD 5BZWB 1VPOH 4O02L 4PJ6A 2X9ZA 1G7LB 3FW6A 3UO1H 4PFEA 5L88L 3DPTA 1F00I 2DMHA 15C8L 2AMUA 1KBPA 2UXGA 3AU1A 3FCSB 3VXTB 1QFWL 4HHWA 1DBMH 4HCFA 4ISVB 1KZQA 3TBTB 2ADGA 3JTSA 4ONHA 5ILTL 1M7DB 4ADIA 5K69A 1X6NA 3RTQC 4KO5A 2W9DL 3IDMB 3MLSL 1AQDA 4FDWA 1YJDC 5MENA 1B0GA 1U36A 3ZQWA 4BIKA 3CQPA 1AXTL 5I8KH 1LEGB 5I1GH 3F2LA 3O0RL 2LW3A 4NQSB 4OZFH 3H6JA 4QHPA 5CFHA 3VCLB 1IC5H 2B1HL 4HXAL 5F3HB 3L9YA 4PRPE 1W8EA 5KS9F 4D7QA 4ZNEA 5JPMC 1F6LL 1QN4A 1M71A 5F88A 4O51B 1R9FA 1WISA 3AXLA 3FO0L 5BMPA 4PWHA 1MI5E 4IRJA 4JFXA 3KYOA 1SFHA 5CLZA 3P0GB 1G6RB 1HXKA 3CZSA 4HWNA 4BFKA 1O9ZA 4FAAB 3UTSA 2ZCZA 2O6PA 3CSFA 1VADB 1YAIA 4L37B 3Q6FA 2F53E 3LZOA 2DQCH 3O11B 4PLKC 3TBWB 3ENOC 5B38A 1P5GX 3T8XB 2HZSA 1ZS2A 1KEML 2YQ2A 3P0VH 1TJMA 4LLQA 1AXSB 1Q9OA 1YZZA 5FDWB 1INEL 2WXPA 1NIFA 3RB5A 3GJEB 2H26A 3FPXA 1ASOA 25C8H 2G60H 3MFFB 1P1VA 2YFNA 3H7BB 4RGOH 3FFDB 4KVCL 4XMKL 3RX9A 1JZ6A 3EDDA 2J1ZA 1EWHA 3VGFA 3PDKA 4LPXA 1OK0A 1O9WA 3UTPE 3MCKA 3OAUL 3QDMB 3NJGA 5BUPA 3PAYA 1WBYA 3SQOH 2WAHA 4LCIH 2PP7A 1SXNA 4GRMB 3W9DA 2JHJA 5IJCC 4XNYL 4MJIE 4G8IB 2ZNWA 3IJHA 1Y18B 1T7XA 3S97C 5HVGB 3MRIA 5JNYB 4P05A 1T7YA 3F7VB 2EDBA 4R4FH 3AY4A 4MJIA 5FLUA 1IV8A 5JOPD 5C1MB 4DGYH 5DHEA 5F1OB 4EZKA 1ODUA 2PWHA 2EP6A 4JUTA 4Q9QL 2AVFA 2ZONA 3VXPA 2P4AB 4D94A 5EF3A 1OY3B 1XF5A 3C5ZB 3RWFA 3G04A 1JL8A 5F6HJ 4RGNC 3VXPB 1Z5LB 3GNML 2DWDA 3BZFA 4P2QA 2UZIH 2Y36L 3O9WA 2OK0H 2DWYA 3LN5B 3FSVA 1CCZA 4KHXH 4AQ8A 1KIRA 5KL0A 2BIOA 3QIBA 1JHTA 2D03L 2KT6A 2Q3ZA 3WXVL 3BH8A 3C2AH 4AJ0A 5C2BL 1Z5YD 4A67A 1BREA 1MCDA 2BSSA 3UPRA 2CJUH 1JHKL 2CE6A 3DX9B 4HUCA 2C1OA 5E8PA 5HHXH 1KCKA 1XF1A 2WNXA 1Y07A 3FFCA 4LRNL 4M3JA 3VRLE 4OCRH 1H6EA 2X28A 5I76B 1AZRA 4DK5A 3W56A 3TBSB 3IDIA 3OKOA 4MB3A 4GNKB 4CSTA 3I9GH 1ETZA 3TVMA 3ARBC 1QSZA 5FAAA 4ODWA 5D4HA 4HH9A 2YD2A 2AEWA 2RCSL 2JJWA 5HP5A 5I8CA 3FOLB 2E7BA 1TITA 2K7QA 2OL3L 5DHYB 4L1LA 3KCWA 4WWKC 2X2JA 2BJML 3N3EA 5I75C 1HSAA 2G4EA 3EKCA 3QFJE 1FFTB 1GGYA 2IANE 3BQUC 4BKTC 4R0LA 3PQYB 4L3ED 1B4RA 1QPXA 4PW3A 4PS3A 5AZUA 1JS4A 1NCCH 5E0QA 3O4OC 1JZIA 4AQAA 4KKCC 5I2IB 3DX9A 5IT2H 1X9UA 1OAYH 2R2BB 3QDHA 3MBWB 4GAGH 4JY5H 1UUSA 3CPLA 3VQMA 1SMOA 3AZUA 3IPBA 3TURA 1DQIA 3PF2A 2WQSA 5CEZE 5C0GA 1OAKH 2VDKH 3V0FA 2MQ0A 5IREA 1D7CA 3RNKA 3CFDB 2FSDA 4FFVC 3X3GL 3VGBA 3MLZL 2WWNA 2P26A 4F2MA 4P06A 1FAKT 3DGGB 4C47A 3FF7A 5F9JB 3P69A 3T3PB 3VI3E 5DWUL 3L16A 2AZAA 4R8WL 3ASOB 4EDWL 5E1HB 1GAFH 3W37A 1S9KC 1P5UB 4FQLL 3BWAA 4X6DE 4MA3B 4TOYL 1SNRA 2LOEA 4DZ8A 4D0BA 1BP3B 1H3VA 4YQXL 2OV0A 4WJG3 4XC3H 1RIUL 3D85D 4WKXA 1RCYA 4OM0H 4WWNA 3HC3H 2EDRA 2ZCHH 2Q2EB