1KYUA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
b'GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 69
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyuA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyuA02
1VTOA 1IU1A 1PZDA 1NVPA 1NGMA 1TBAB 1QTPA 1CDWA 1QN3A 2A7BA 1GYVA 3OC3C 5IYBP 1VOKA 2DWXA 3ZHFA 1E42A 4ROEB 2DWYA 4PY5A 1YTFA 1QN4A 1TGHA 1NA8A 3ASMA 1QN5A 3ZY7A 1GYUA 3MNMA 1R4XA 1PCZA 2D0AA 3EIKA 1P4UA 1KY7A 1QNEA 3H1ZA 1GYWA 4B0AA 1KYFA 3VN5A 1D3UA 1MP9A 1KY6A 1QN7A 2YMTA 1QN8A 5CN2A 2VJ0A 1VTLE 2E9GA 3HS9A 1KYUA 1YTBA 1KYDA 2MJ7A 1C9BB 4ROCB 1VOLB 2D0BA 4RODB 1QNBA 3HS8A 1OM9A 5IYDP 4BCXA 1QN6A 3OCIA 1QNCA 5IYCP 1W80A 1B9KA 5CN1A 2Z8UA 2G30A 1QN9A 1AISA 1QNAA 2D0CA 4WZSD 2IV8A 1JFIC 2IV9A 1NH2A 1QTSA 1TBPA 1RM1A
chains in the Genus database with same CATH superfamily
3V6ZB 1KFGA 3BAXA 1C12B 3AXHA 1DQMH 1JZIA 1TBAB 3JTTA 2C9QA 5FIEA 5C0RH 2HUEA 3L1GA 5I6XB 1BP3B 2YD3A 1BFVL 1OK0A 3IJEA 3P9MB 3HBQA 4CMMB 3OMIB 4JQIA 4DO6A 3FSOA 3PNWB 3DMMB 2WCPA 1MI5D 4K8RL 3DBXB 3DIVA 4H25B 3KPSE 5EDSA 2DWDA 4J12A 2ZNXA 4N2DA 3FQUB 3BJLA 4JQIH 1W6LA 3IYLW 3EYUH 1Z9MA 3CUPA 5KVDE 2CLZA 4QKTA 4WFFE 3MV9D 4QGTA 4K9EC 2LFGA 2Y06L 2Y3AA 3Q2CA 3IMRA 3SKOA 5JIQA 5AW4B 3AADB 2PNDA 3UX9B 1JHTA 12E8H 2C9RA 4FQQA 4QO1A 2IGTA 2YGOA 1WZLA 1B3JA 3MU3A 3IRZA 5T5FH 3T3PE 2CLVB 2D7NA 3RZCA 2OX5A 3P3TA 1A7NL 4JRXB 2R1YB 4PJDB 1NBVL 1EMTH 3QYNA 3WIIH 2ESVB 3WGVB 3THML 2VDQL 1S78C 1BIIA 2DBLH 4YX2L 3GK8H 2OZNA 3KYMA 4OQTH 3W9EB 1D2PA 5GZNC 3HNVH 3WE6A 5DLLA 2X4PA 3BKYL 2H2SD 1IX2A 3JV6A 2EABA 3V4LA 4QHUA 1P7KB 3N1PC 3JT0A 4YSTA 3UMNA 5CJQH 5BRZA 3AU1A 4FMKA 3UGUA 1BA9A 1SM3H 2R59A 4AYFA 1TEGA 2D03L 1TLKA 4YGVA 2H1PH 1FQ9C 4OD3L 2CUHA 5LQBL 3SNSA 5KANG 4CN6A 5GQBA 2W8CA 3DTXB 4G42A 4EBQH 4DQOL 4IOFD 1OF2B 4ZUWB 5HDOA 3S37X 4RDQF 4HIXL 3UAFA 3KYKH 2VM4A 1RIVL 1RURL 1WBZA 4ZMNA 2DV6A 5CLYA 4PBDA 4Z7WE 4IS6B 2CHDA 5KVGE 4TLKA 4PGCA 4C58B 2XBTA 4KU1A 1GZHC 4CVXB 2LAGB 3OKKB 2PTVA 3K0WA 4XNQA 3CIQA 3NIGE 4WI6A 4D9RE 2X41A 3AU0A 1BX2B 5C07A 2WLIB 4Y9FA 3DX0A 4K5OA 5TTRA 2DI8A 5EO0B 2BRRL 1EXGA 4OGXL 3WAKA 1G7LB 2Z0BA 4R84A 3MCKB 1SOXA 4PB0H 3S34L 1FVCB 2G0KA 4FXKA 4J3OC 1JWUA 4O2FB 1MVUB 3SPHA 1KGCE 2BMKB 4CN4A 1TMQA 1XZ0A 5JDSB 2YEVB 4H1LH 1EZUA 2Y07L 1AR1B 1IEAB 4R2GC 4OF3A 1MWAA 3QP3A 5SWZD 1CLYL 4U31A 1EQWA 1CTOA 3U4EB 4C56A 1DZ0A 1WCBB 4P0DA 5DQ9B 1RAMA 4LCUA 3WD5L 2MQ0A 3MYJB 5KSAA 3P11L 5D7IE 2ZCKL 1UWEH 4OLZL 4F9PC 3LH2H 4YSQA 1S6NA 1WICA 2AVGA 1MWAH 3JWDL 4X4XB 5F3BB 2YRZA 1YMHB 3FN9A 4JO2L 3S3BB 4B53A 5E95B 4I48A 4HAGA 3TO4C 3HI6L 1SY6H 4Q9RL 2WP3O 1WG3A 1RJYB 2R1XA 2NOHA 2CO7A 3FUHA 1IC7L 1UD8A 1M7DA 2TRYA 4FF9A 4LHUB 4MMXA 2DMCA 4JGMA 3BRFA 2APFA 3R8BB 5LXGL 4GFTB 2G2RA 3I6GA 4KROC 3VW3H 2CGRL 3PXJA 1P2CA 2ZYHA 3SJVD 3UBGA 1MPGA 4PJ9D 1PKQE 1JPGB 1G43A 4LXFA 3AREB 4P46A 4X80L 2FJFA 3JZYA 4FQCL 4LARL 4AZ8A 4JO3L 3KM2A 1PLGL 1QPKA 2VC2B 1ANUA 2WNWA 3B5HA 3IGUA 3HE7C 1GJWA 3DYPA 5DGRA 5FYJL 4CJ0A 4YHYC 5KBMA 3UTSA 5IHBA 4Y4KD 1KGUA 3LXBA 3RWGB 3V52H 4IMLA 2EDJA 5IWLC 1G1CA 4K94C 3GNML 1D6VH 4ZYKA 4HKJB 4XTRD 3RA7H 1BAFH 1RZ8B 4M93C 4GW1A 2UX6A 4U1MA 4NQSA 2E3VA 2EH8L 2YGPA 3CDYA 5DZNA 5EF1A 4MAUH 1OQXA 5IVZB 1DQQB 1E43A 3VWJD 2UZIH 5FV2A 1LE5B 4P9ML 4PRNA 1YA5A 5T5NG 2D2OA 3MAWA 1BEYL 3GMOB 4KVCH 5F6IB 1Q1JH 3O8XD 2Q6WA 2NY6D 5DR5H 3ZSSA 1QBLL 3ZHKA 2B9BA 5GGSB 1GMIA 3SPVA 1PLBA 2DQUH 2BY0A 5C0AB 4OJEH 5B3JF 2FR4A 2V8QA 3TZVD 4LF3A 1YEFH 3G5YA 3IPEA 1A1NB 3RP1A 2BSSA 2IPTH 1XH0A 3FC8A 4JQVC 3SE3A 1IM9A 4AYEC 3ROOB 5CU5A 2PXYA 2EVFA 2D0CA 5IJCC 4K3GA 2OQJB 4NN7C 5DJZB 5B1KA 2XA8L 5IFJB 1SXNA 2E0PA 2WYZA 3CAFA 4UUJB 5FW6A 5IW6B 3D25A 3ZDZF 1Z0NA 2YR3A 2IXQA 2OMVB 1A7PH 5BQ7B 1HKLH 1PYWA 4NZTL 2W07B 1AS7A 3T08A 3OQRA 2RFXA 1QYGL 3PDDA 4N2EA 5ICYB 4KMTH 4ENZA 1UENA 4BKLB 4DPCX 1T2JA 4RWYH 1AKJA 3PWPB 4MAYB 1GGBL 3RWHB 2YAQA 3QJSB 3VMPA 1LEIA 4MQXD 1BFTA 3CZKA 3GJEA 1ILUA 1CZ8H 3GMRB 4OF0A 3D85D 4OZHE 4PI2A 3T9WA 3NP3A 3PPSA 3GIZH 5E9DB 4CBZA 1U8PB 3UYRH 4NO0D 1A4KA 4YHZH 1I53A 1YYLH 1ZA6A 3NVQA 3ROLB 1IAIM 3TP4A 4KJQD 1FLRH 3X13B 3IDMA 3KL0A 2FWOA 4O2CA 1G1OA 4ONGH 1OAUH 3SODB 2IGFL 3D8MA 5H2BA 3UERA 3NZ8A 1YEIL 1NWPA 2BOCA 4JVPA 4ES9A 4G83A 2PF6A 4MD4A 5DD6B 2IGLA 3QRGL 2VZVA 4MD0A 2ISDA 3GXFA 4BJLA 3M1BB 1F45A 5T1KD 3UEZA 3QYCA 1YQVL 5LBGA 4CC0A 4HG4J 1MAJA 4XX1E 3EH4B 1COBA 1Y0LA 4MZIA 3U2SA 3BD4A 2ZWKA 3B5GA 3D3VA 5LWYL 4I89A 1DBBH 4DKEH 2KLSA 4Y4FB 4LT7A 3NZUA 1LD9A 5G4MA 3FUDA 2IDCA 1G0YR 1Q38A 5AZEH 1CL7L 4Z5RB 2IANB 2HB0A 2C3VA 1J1XH 1GOFA 4HCGA 3E6FA 5GHWL 4F7CA 4PMFA 5AVQB 3IN0A 4LHUG 3VXSD 4F92B 2WXLA 4DGUA 4OCNC 4XNXH 5DHVA 5JORA 4JCMA 3L4ZA 2NXZC 3O41A 1KLFA 4JO8A 1JN6B 3KLAA 4XNMB 5D9SB 4Z95L 3X1EA 2ZKMX 4NYLA 4Y88A 2Z65C 4IKLA 5DWPA 3L3DA 3QPQC 5AALA 2UUDH 3CH1B 1I82A 1T03H 3WSQH 1N39A 3LEYL 1A25A 5C0CB 2W0KA 5IBLC 3VFPA 3DX6B 4L3AA 4WKZA 5INCA 2Z31B 3U6RA 4ZFZB 2IPUG 3EOBA 5FKPB 5CSBA 1BJMA 3DETD 5FKAB 2Y8LA 4QRBA 3UMTA 3FF7A 1I8MA 3KLHD 4QXGL 1HHIB 3O81A 2FLRT 2X4NA 3FULA 3BCDA 1HEZA 4L1HA 2N4IA 2ZICA 4OAWA 3TN0A 1CDIA 1FAKT 1G4RA 3CXHJ 1I9RH 1SLXA 3ASWA 3VFSB 5AW5B 2C7FA 3QR1A 4PG2C 5GRZA 5A2BA 1FH5H 3LZPA 1VFAA 4P3CL 4QYOB 2BS8A 2LT9A 2F61A 1RK0A 4GG6E 1N64H 3H3BC 2QV2A 1TZGL 3DARA 4FC3E 4X9HA 4PWHA 3QIWA 3MRKB 4A7UA 1BZEA 2O5XL 3VXMB 3DTDA 1MW2A 1TVHA 3QEGH 5DK0A 2IBZX 1VPOL 4JPKH 5MENA 2LHAA 5ESQA 1KB5A 1UB5A 4GSDH 5DS8A 1AQKH 2V2WB 2VMJA 4H8WL 1S5HB 2ADFL 2ZCHL 4UYPA 1IEHA 1NA8A 2H32B 2FKFA 3L1EA 3O0RL 2B15A 2WXOA 2X4QB 4RBPH 4ZUUB 4ORGA 3VM5A 4FQ2L 1CFNB 2W65A 3T71A 1IC4L 1F0LA 3IXAB 4DKDC 3E80A 2Q87A 5E6SB 1ERNA 1UD3A 1SBSL 5E9NA 4KO5A 2X5PA 2QQLH 4DGVL 4CKVX 2WTRB 3I9IA 2R2EA 2ZX5A 4YHLL 4QHLA 1IUZA 1U3HD 2A2QT 1DP0A 1YNTF 3LKRB 5D96B 3HS0A 4OLUL 2A73A 5F7BA 4PVBA 2XTJD 3NT0A 3DSNA 3WY1A 4GQ9H 2IH3B 3UTTA 4GS7B 3IRPX 3WL9B 3NGBB 3CSGA 5IOKA 2ZYIA 1CQYA 3OB0K 3AREC 3GRBA 4M56A 3UJTL 3F62A 4PWKA 1JZ8A 2VR5A 4PJEB 4U7KA 1DEEB 1LNUA 2VLJE 4P57B 2VDLH 1JNHB 3NUKA 4X0KA 4X6EB 4OM0H 1ML0A 1T6WA 1UT1A 4XGZA 4PBVC 4EIZC 4EQ3A 3KPLB 5EUOE 3VFOB 4ZZFA 4UV7L 1CGSL 2R51A 1FNLA 2HPOA 3SQBB 2Q76A 1HNGA 4BRJA 1T1XB 1UJTA 3SDCA 3BKMH 3QZPA 5F1IA 3BH8B 5J8OA 4I9WD 4X7FC 5IW1B 3H3PL 4PRBA 1F97A 1FBIH 3TIDA 4FKHA 1R3LA 2GHWB 2X70A 1LWHA 4MJIB 3K7UA 5DT1L 3UPRA 3FUFA 4POUB 2EIKB 5I16B 1E7UA 2MMXA 3AJ7A 2J1YA 4HSCX 4KX9A 3IU3A 1YAIA 5CLZA 3IFLL 1PCJX 1MI5B 1N5AB 3B2PA 4ZZKA 5D2LE 4HHGA 1XSIA 5DUJA 1OCZB 4KKCC 4PD4K 3W38A 1LE9A 4IYKA 2A9ML 1LM8V 3ILQD 1UASA 3U30B 3WUWA 2E27H 3ZT5A 4Z8FL 2AEPH 4N20A 2ZWNA 2BC4A 3SQRA 1ACYL 2I5YH 3QG7H 1BG1A 1FNSH 1LP9B 1WRFA 4CU6A 5C6TL 4AIXA 4TVSa 5I1AA 3OPZH 3S0PA 4UOQA 3TNMA 4H8HA 2O6PA 1EZVY 1BBDL 1AE6L 4YE4L 3UG5A 1L4IA 2FBOJ 5ADPH 4TV3A 3T4AB 2XQYG 3A23A 2ENQA 4RMSA 1BD2E 1PCSA 4I3SL 3QUXC 2V6HA 4IW4C 4XB8A 4M9PA 3HCVB 4XP4L 4LSSL 4MAYC 3TFKC 4HDIB 1SEBA 3GJFH 3S88H 1NAMA 4OQ1A 3IPBA 1SYSB 4PS4H 2X0WA 3L16A 4XH2B 5F96L 4RFNC 4Z78A 4I77H 1FGVH 3KG5A 1I1AB 2B59A 2NY5L 2R15A 1EJ6A 3EJUA 4QXTA 5DUPH 2X7LB 3OG4B 4U3SB 1J5OH 4YOKA 1KDJA 2UZXA 3DWTA 4EVNA 3VH8A 5DC2A 1NGQH 3EH2A 3ZSTA 4Y1AA 4PLKD 4X9IA 5F72S 1KSRA 1E65A 2GI7A 3BKCL 4YWGH 4KVPA 5D1XE 5E2WL 1YQ2A 1XIWC 4YBLB 2HH0L 1OGAB 2WVTA 2E56A 2NQCA 4U3XA 3EBHA 1FE8H 3NEXA 4LBEB 4P5TC 5SX5K 5BUGA 4XXDB 2Z92B 4XP9H 1ZDQA 2BLFA 4Q11A 3JXAA 4NCC1 5FCUL 4Y4FC 1KTRL 2A6IA 1DN2A 4I2XE 3RI5F 1JGIA 4NPYA 3L5WB 1PDKB 2X38A 4PVNA 5IZ7A 1BZDA 3LQAH 3K5RA 4HS3B 3KWVA 1S8DB 1KYUA 3QDME 4G9DB 3DV6A 3R1GH 4UM9A 5J3HD 4BXVA 2WZPA 4KJWC 4JR9L 1OM9A 2VN5A 3VFUB 1ZV9A 3PV7A 3H9ZA 2V37A 1IJNA 2AXGB 2DB8A 4K5NA 1LO2H 3REVA 2VMDA 4BFNA 1LDPH 2VQ4A 5HYJA 1YY9D 4K9EL 4FEMA 1S7VA 3F12A 4ENEC 4LVOB 5CIPH 3MJ8A 3O4OC 2HFEB 2Z31C 3QRBA 2CRZA 4HXAL 1O6SA 3S3SA 4XNZB 1YSOA 3HMWL 3W39B 2ZYRA 2F7RA 1HZKA 1T21B 1TLMA 1ZLDA 2EHBD 1HXYB 4MNQD 4XZ4A 1P4BL 1T6BX 2CR3A 5IJBC 1GC1C 4RISL 5ICZA 1OD9A 4W9ZA 5ACZB 4Q2ZB 4WHYH 4ALAC 5DVLA 4EJYA 4XBMA 2IV8A 3C08L 4IBQA 3DVIA 3FQ4A 4AEIL 1QKZH 4NO3A 4UMSA 3ZZSA 5KYNA 3KXFB 4DO5A 1B6DA 1XCQA 1NCBH 5E03A 1IEBB 2NTSP 4LP5A 1AANA 1I7ZA 5EA0H 3EJYC 5C0IB 1JK8A 2XKSA 4W9LC 4PLJD 4GFXA 5IVXB 1PX3A 2OW6A 5AZ2H 1L0QA 2LFEA 2A6KB 3Q2WA 4RNRB 3SJVB 3MOAL 5EPMB 4A39A 1SYVA 4PJ9B 2CQVA 4KH2A 4S1RH 4P2OA 3X1BA 1KTLA 4UNVA 3KHOA 4BV1A 3BX7C 4XN5A 3MGTA 4Y9GA 5JTWA 5IV2B 3E0GA 3TEYA 3KEDA 1OKEA 2OI9B 3IJYB 1M71A 4EZLA 4I18B 1GRWA 3KPSD 1RHFA 2K8QA 3OKLA 5I8KH 4LVNB 4Y4KB 3I9GL 4PJIE 3H85A 1AP2B 2R23A 1FORL 3BZFB 5TF1L 3TV3H 3LOWA 3G3LA 3PV6B 3QXWA 4Q58C 3A0OA 2AJ3A 2YRPA 4ZW8A 1GH7A 1D5XB 3O2VH 4WFFD 1J10A 4G8AC 4AIOA 4HKBA 2D0AA 1WC7B 3BZ4A 2OYMA 3NDYE 2GK0A 5EMYA 4ZTPL 4DKFH 4BFEA 3LKNB 4F8QA 3VWJB 2A1WH 3QO0A 5GGVH 1KY7A 1ZOXA 3NAAL 5EBMA 1HOEA 2RTTA 4IU3B 5D96C 1OAYH 4FJZA 1ECYA 4NIYE 4ZFFB 2NTFA 2NY6B 3BXNB 4WGVB 1WAPA 3HLKA 3QJXA 1M57B 1AR2A 1ZLSH 1T20B 2XYBA 4AENB 3TZVB 4HP5A 5FHAL 5L8LB 4ATTA 1U8IB 2UY6B 3LZRA 4LE8A 1UUSA 3PWUB 3EFDH 2WD0A 3MQIA 3ESVF 2CM6A 2V3EA 2IFFL 2KUTA 4XP6H 1MY7A 2OJZL 2QGDA 2BCKB 4P2QE 4PJ7F 3CFQA 1DZBA 4DGYH 4KK6C 4Z7IA 2IMMA 2MFNA 4D9LH 1I1FB 2P3YA 2NY2D 1AY1H 3KJ6L 5EN2B 5F89B 3TM6A 5BJTB 5KUKA 1PKOA 5TDNB 3RIKA 3RWCA 5CCJA 2K7PA 4OZGE 2WMPA 4JPIB 3IDGA 4ZUSB 3KRMA 1GS7A 2JKSA 3VB8A 2FQFA 3UCQA 4F8NA 1QRKA 1GSMA 4O4YH 4Q4IA 1J0ZA 3IJHA 1T6VN 4MX7A 1KEML 3CX2A 5DSCA 2KLRA 3FUNA 4NO0B 1H8SA 3ML8A 3U30C 5IFAL 4QRQB 5JXEA 3VD1A 1UB6A 4HK3N 4POZD 2O6EA 4WU7B 4ZW5A 3TIEB 3DX1A 4J6RH 1OTTD 3GBMH 3UPCA 3K2UL 4ZFOA 2R56L 1T1ZA 5KJRH 3U36B 4Q9CA 4L8SA 4D9RD 1NPUA 1E8YA 2BNUA 3VGHA 3BC9A 4H1LG 4ODWA 1SDDA 3PWLA 4HMEA 1U8CB 4MQ7B 1OCCB 4PUBH 3G6DL 2J21A 4FNRA 5T1KB 4FQIH 1G9HA 5DFVD 3HPLA 4XPBH 5DJXB 1G1YA 2Q86A 3INUL 1NINA 4PRDA 1KGCD 4K94L 1L9RA 1Z9SB 1JSYA 1MH5A 3I75B 5G5DB 1W72L 5LBSH 1A7RL 4A2EA 1X7SA 1B88A 4H8UA 4ICWA 1SQMA 3ZE2E 5BRZE 1ZLEA 3OMNB 3DBSA 1KIRA 2A74A 3BP4A 4LPVA 5DZ9A 3SBPA 2XC8A 4XMLL 3BDBA 3F58H 3VXSB 1WLHA 1E7VA 3I9AA 3OAYK 4L3EB 8PAZA 1I1AC 1HQRA 1KJ2B 1RXLA 2BNRA 4QWWC 4DP9X 3PWVB 4K3EH 5FM4A 3RPBA 2R4SL 1QWUA 3VU1A 3TPUA 4J4PA 4XO3A 5JZ7C 1QFWI 3WLWD 5SWQA 2UZYB 4EALA 2DQMA 3ZVVA 5LKNA 1OE1A 3C5XA 2DJUA 3HHSB 3NIDB 2ICEC 4WJKB 4URTB 3CVBA 3CMOH 1VIWA 3VI3B 5GZOD 1BPLB 4W4OA 3HE6D 4OCYH 4WWKD 4G6KL 3D51A 4YDJA 3DV4B 3GLEA 3MV7A 4X7CC 1E4WH 1JGEB 5B7FA 1TNNA 2C7UA 1HNYA 3B6SB 3IE9A 2ZZUT 3HAEA 3O4LA 1GAFL 2WUBL 4N86A 3IMUA 4MDRA 4PWIA 4P4KA 3US0A 4WWOA 1VOLB 1ZEAH 1QNBA 1SHWA 3NSFA 1A6AB 1G9NH 2C26A 3CVHL 2ZWSA 3OXSB 4LSUH 4ZMLA 2WZ5A 3EBAA 5DFWH 2A0LC 1ETZB 1PZ5B 4ZAKA 3MLVL 2O61A 1TQCB 3HJ0A 2MNWA 1KV3A 4QF1B 4S1DC 3TWYA 5JMOC 2CK0H 4FEIA 3V8CA 5AB1A 4UIKH 3CU1A 3G5XA 1W80A 4MZ2A 2EEBA 2LVEA 3P4MA 4LOUC 4U6HA 2NOYA 4LVOC 2DQCL 3N06B 2FAUA 3MLWL 4FQXC 2A9BA 2HFFB 2XZCH 4JFYA 3T0BA 4XNZC 1QN9A 2PYFB 4NWUH 5I66B 3RFZA 4M6OL 4F2FA 2QLYA 1ZJBA 3WHE1 3M8OL 1RMFL 4Y4HD 3RWJA 3QQ3B 3SDXA 3F7YA 2VQ1A 3ARFB 4NNPH 4B9GA 4AUYA 4NAMA 1OHZA 1DSYA 2L7UA 3DX4A 2OR9L 3GRWH 1Z3GL 5ALCH 1E30A 2XPZA 2XN1A 4DTGL 1L6ZA 2DI9A 4A37A 4CU7A 4YQXH 5FYLL 1RZQA 5I15L 3EO1B 4U1GC 2J7LA 1AHWC 2BIHA 3BVTA 4HLZH 1U3HB 4KKRA 4OGYH 1VFMA 1FAIH 1CFVH 1ZSDB 3GXMA 4FE9A 5KZCD 1OAZH 1CGXA 5E51A 4A7QA 3QUZC 5CD5C 1DQLL 5GS3A 4N0RA 3U82B 2C8NA 3FFCA 4DVRL 4OI8A 3GS4A 2HJLA 1DCLA 3IDNA 4FG6D 4W68A 1BZQK 4N0YH 3SDDA 4CSZA 2FRGP 5EC1A 2IDQA 2YBRB 5J13B 4PP2A 4XP5H 4LVNC 3N91A 4C83A 3HTLX 4H8VA 5SWSB 3E9TA 4JM4H 3NIFF 4JDEA 3RL1B 2VLRA 1IC5H 1TJMA 3WXVH 2QKIB 2DQGL 1XSZA 2DD8H 2YKLL 1WBXB 2NYZA 3FU5A 1NTDA 4P23A 1NIFA 3EYVB 1SN5A 5D70L 2YAFA 1Q9LA 3FH7A 3QZWA 4M3HA 1QMUA 4Y16D 3VYPA 1RJZA 1AGFA 1KLGA 1MZZA 4KHTH 4YO0B 1PSKH 1X5LA 2GTZB 2YPVL 3WIFA 3ZDXF 1I8UA 3OHXB 4XC1L 5DZOA 1QN7A 4XMXA 1NCJA 4QOKA 3D4YA 3EBIA 5A2IH 4E9RA 3MACL 3VGDA 4YDVB 2PTUA 5I1DA 5AOJA 4QYAA 4P2YA 1KPRB 1N59A 2ZPKL 4AVKA 4PJCB 1JCKA 1IBYA 4G8FA 3SBWC 3UZVA 2ZAIA 5E6IA 1KIPA 1JDAA 2OXGA 3DXAA 3EFOA 4RAUB 4XOBA 4DP8X 3IBOA 1ET7A 5GGVY 4XAKE 3QO1A 3L5XH 1F1AA 5SV4A 1KT2B 1RPQA 3UAJA 4DN4H 4F8TA 1MHCB 3TH3T 1M3JA 3NESA 5IJVB 3JBG7 5B8CB 5D71L 1YEEL 3EYFB 3NTCH 4K9JA 4PLNC 2F5BL 4J6IA 3DVNB 4ABUA 4DESA 3ULVC 1P7HL 1E2WA 3BAIA 3BGFC 5EDXA 5I2IB 4JBSA 4NJAH 3AACA 4JZNA 3IU4H 3INOA 2WAQA 1D6EB 2PCFA 4YHML 2DY2A 5ADOH 2HT3C 3K6SA 3UYPB 5F0MB 2FB4L 1XH3A 2YWYA 1TJXA 2Z9TA 3CN4A 2P1YA 2AJYH 1H15B 5AVZB 4OLEA 3GIVA 1HH6B 5DJ0A 3P40A 2ERJC 5I23A 1E6OL 4KZDH 2BOBA 5ILTL 1K6QL 1PG7L 3ARBC 2BNQB 4EIGB 1L9QA 1OOWA 3U7YH 4JM2A 3D3VE 1OSEA 1G6RA 3LB6C 4XRCB 2VRQA 5FOBA 1UADC 3T0AA 3VFWB 5ABAA 1LLAA 2FECI 4LCYB 2EIZA 4LSDA 4FP8L 3W0WB 2JPIA 1G6RH 4S2SA 2FEJA 1L7TL 3PHQA 4D7BA 1YNKH 2QFPA 2CHWA 4WGWB 5E8PB 5DWUL 2BP0A 5TE6H 2EIMB 3MA9L 3C75A 3BP6A 2RA1A 1TVBB 1FYTA 2OCCB 4EAJA 4QI3A 3FH8A 4PBWD 4WK2B 2I7SA 3IEAA 1JYVA 3IMBA 1DJSA 5DD5L 3S35H 3STLA 3GBNH 1HILB 3BYTA 1W8EA 2DQDH 5CCHE 1XV8A 1JZ3A 4FKKA 4YHNB 3VXPA 2H6PA 3F64A 3WJMA 4HGMA 4MVBC 1PD0A 4APQA 3T1WA 4LCCB 5I71B 4R0LB 2CJ3A 4ODSL 2ED8A 5FOJA 3MA7A 3U1SL 3VI4B 4DEUA 5AD0A 1HZHL 1GYAA 3D30A 4FFVC 3ULUF 1I3RB 3QWNA 2F1EA 2LU5A 5AW7B 2IH1A 2C4XA 3QEHB 4XAWL 2JKLA 3SBQA 4BQCA 5CBEA 4MNQB 1HI6B 4LSQH 5LHDA 5CGYC 4N1EA 3NPSC 3DOSA 2ZWZA 1CT8A 4ZFGL 5IJKC 2DQFA 1NMCB 1A64A 2VLJD 4QRUA 4ELKB 5ESAB 3UIZA 5BRPA 4I8DA 3HG5A 2FL5B 2CRYA 3QUGA 3FSAA 2NX5B 1HINL 2VAAA 1MFEL 4WSKA 2PP9A 3UTQA 4P48A 4WHDA 1BMGA 4OJFH 4HOZA 1O6VA 2EEFA 4GKNA 4M43L 5MENE 3WKMH 1E4XH 1CLOH 5DS1A 5IY5B 1X9UA 5FFGA 3ZQ9A 4Z18A 5DC4B 1JHKL 4HIIA 4GW4A 4QIRA 2EO7A 1UGKA 3MRPB 2PCYA 4KAQL 2UVFA 3P0GB 2A38A 1H5BA 4JHWL 2A83B 3FT3B 4OCSH 3REWB 1NCWL 4WU5B 3SBRA 4L9LB 1SXBA 4G80B 4AQZA 1JDYA 1B2WH 2GITB 2X3BA 2H0EA 4HJ1A 3IFNL 4QRAA 2B7DT 2XJLA 3ARFC 1CICB 2E7BA 4XMPL 3GMMB 4HUXA 1CXEA 5E4EC 1XB8A 3BPOC 2ZD0A 4R4ND 3SGJC 5F88A 2QEJA 4ANWA 1ZHKB 4D8OA 4IBUA 3UTTE 4DKTA 4G6AD 1OE2A 3EO9L 5CILL 5B1JA 2X4UB 1FNFA 3GSRA 3MLXL 1ZK9A 5E7FA 4BYHA 1UZ6F 3ES6A 4WENB 1P5UB 3E9UA 4OF6A 5F7EL 1BD2D 4TKWA 4U2YA 2AAVA 5E24E 2F8XC 5JOEA 4GBXA 3WJLA 4RGOH 3ZE1E 1VERA 4JG0L 4NZFA 1F6AA 1AGDA 3BW9A 3OLGA 4KRLB 4W9DC 5IMKB 1JZGA 4HH9A 2ICWA 4IJ3C 3IWVA 3FOLA 4K3JH 15C8L 3FCBA 5IM7A 1NICA 5J13C 1BVKA 3U6XA 1F11B 1KCVH 1MHPL 2CJTA 4LQFH 3VXOA 1UJ3C 3PL6C 2Z93A 1SJEB 5LGJA 2X2IA 4K23L 2B1AL 2CIKA 3CU7A 1FVEB 5FYJU 4XNUH 1S3KL 3TEWA 4EI6B 3CFCH 1EWHA 1GPOH 2NY2B 1H3WM 4EOWH 1GC1L 2YA1A 2H2PC 4XBGB 4IGBB 3OH9A 4ALAL 2J57A 5D1XD 3EOTH 4GMSH 2XG4A 2NCMA 4A67A 3PDOA 4Z3HA 1KY6A 1N0LB 4GAGL 2D3NA 3MCYA 4ZPTA 5HHOA 1D5ZB 4JVWA 1AGCB 2APVA 2WQWA 2EC9U 5E2UH 5DUBA 3GXTA 4JFXA 5DVOA 3KYOB 3L6FB 4LSRL 4ZMZA 5JOPE 2CHXA 1PCMX 3Q6FA 2KLTA 2VDMH 4NNXA 2WBJD 2XN0A 4YFEA 1L7IL 2GEQA 2R1WB 3EF4A 3QULA 2H47C 3ZN6A 3NIGB 4BQ9A 1Q8MA 2XI9A 1PL3A 2ZXWB 3KDMB 1OAKH 1LL1A 3HZMB 3I85A 3QDMD 4HWNA 1IFRA 1DVFA 2AITA 2W9LA 4MJ6B 2B0SL 5B8CC 3B7RL 3NMEA 4U4BA 4N2LA 1MCKA 2DQHL 4NO2A 1EXUB 5JPNC 4OLVH 3DPUA 4GEIA 4TQHA 1IC0A 1YHPA 4RAHA 3DO7B 4PJ5A 2NNXA 3WS3A 3BT2H 3CFUA 4PCKA 4KK9C 1T1YB 2K45A 4OZFB 1KJ3H 1ES0B 4YBQD 2AF2A 1W91A 1J1PL 1NGZB 4S10A 4XMWA 2ZOUA 4YVNA 4GLRI 5D7IB 4TNFA 5BOZG 4P2RB 2VSDA 5HI4C 4BK8A 4ZXBA 4X5XA 4PV1C 5I1IH 1U8HB 3IRCA 5K39B 4FG4A 4JW3A 2B14A 1OD7A 3D2UA 5HD8D 3QFDB 5IB1B 3U9PH 5E1GA 3D0VA 5L0QB 1WA1X 2FJGB 3IFOA 4FQJL 2ETWA 4WHTA 1UZ8B 5E8DH 3WYRA 5EFIA 1I1RA 1KN2L 3ZR5A 1O9VA 1Q9OA 4LL4A 2PPDA 2Z91A 2YWZA 3ARWA 3RKDC 2I7OA 4B6ZA 2EEAA 4PAZA 4EUPB 4U1HA 2O26U 1ADQL 3RDJA 5T5NF 2J1XA 3HE6B 3A24A 4ABVA 2K6ZA 4GIAA 1HYRC 2JNZA 3MOQA 3QNZB 4HK0A 4OI7A 1A2YB 5J56B 1U8OB 2HKPA 1FGNH 5BVJA 3LKOB 5IMLA 3QAQA 2CKBB 4P4RA 4K2UH 2DEXX 2XNAB 2VDOH 4RRPG 1Y1DA 2Y25A 1I9JL 5HYJE 1EAPA 4FLOA 4N2IA 4WAFA 2AP2A 2E4FA 2K4WA 4HWBL 5IJDC 3PFQA 4J8RA 5SX5H 3H9YA 4Y2DD 3HFML 1I8KA 4PTUA 3GUTA 4G7YL 4LCCC 3A21A 1IM3B 2JTDA 3QHFH 4R0LC 4U1JA 7CGTA 2BVPA 1LMIA 3US1A 3L2NA 2BSCA 1P1ZB 3PDGA 4HW6A 1EEYB 3EG9B 1QN8A 3C8KB 4UU9B 1KTJA 1Q1PA 3QJFB 4Y4HB 5CD3B 4WV1C 4BD4A 3TNNB 4PM1A 4OJYA 1NUNB 1VHPA 4LPYA 2Y7MA 1L6PA 4MYWB 4I5BB 1G9EA 1YTBA 3H6AA 4HLJA 4PGDB 4HBCL 1C47A 4NQEB 4X5WB 3FTZA 5KYYA 4CVZA 4FZ8L 2AXFB 4Q74A 4KRPD 1FZOA 1BZ9A 4W9JC 1YEJH 4P2QD 1BW8A 5HYQA 2APSA 3L54A 4FQPA 3U0TB 1U9KA 5KZCB 1MCSA 3C2AH 1PZAA 2ADIB 3PU7A 4ZT1A 2EE0A 2KPWA 4A04A 3HLAA 4DVBB 3MRHA 4TMPA 3KL3A 3ETBF 1CF1A 1JE6A 2VIRB 1MJJB 5TH2A 5LDUA 4PREB 4PJXF 1CIDA 4TUUA 3V95A 5K9KB 5ESVA 2CHZA 4G5AA 3A4DA 5F6HJ 3MUZ1 4L9LC 4OZHB 3QYMA 5GZNA 4JZOB 4ZI8A 4P04A 1CIUA 1RZJC 3ZMNA 1DQDH 1OK8A 4WGKA 2XZZA 2YPKA 2DBJA 3BUQA 3ZIYA 1CICC 2XIDA 3VDBA 3RZCD 2FHBA 4QPEA 4I4WA 5GS0C 2RBLA 4YK4B 1TDQA 4JN1L 3RVVC 5KW9H 3VWKB 4AC4A 4TSBL 2B1OA 3PXHA 5FO8A 5B39G 4X98B 2JKRM 2J1KA 4OZFG 2W91A 3K4DA 4GRWH 4HETA 4Y16B 5KVEE 5AVUB 3QGVA 3T6VA 4A68A 1SN0A 4YPJA 1TZHB 5KAQG 2MZ8A 3ALXA 3MUY1 1S9VB 2L8AA 5TFSH 4QJ5B 1NCUA 1MJ8L 2ZCZA 1N19A 2NW3B 5BO1L 1D7CA 3QFGA 4RFOL 4Z7QE 1E50A 1WAAA 5BCAA 3I3DA 3FB5A 5J5EA 3D50A 1SLWA 1FI8C 1R46A 5F0PB 1CF8L 5BRZD 4XBEL 3OWRA 1GZHA 4O02H 3NCFB 4J27A 3V0JA 4EI5B 5CCGE 4NQCA 3T0EA 3ESMA 2KZ1B 4X6DB 1UCBL 3WFHA 2WWOA 4RMQA 4E41E 1MCCA 5F71A 3CN3A 2XCMC 1QSFA 4D0BB 5EO1B 4F33A 1KLUA 4G7SB 4PRAB 1CGTA 2WZ6A 4YLQT 5E5MB 3TBCA 4IGBC 2J73A 1G5AA 1KTCA 2FGWH 4X8JA 1UUNA 3C09B 3FO2A 3K74B 4U1SB 3V79C 2IADA 1A6VH 3MRRA 2Y5TB 3GBEA 2FNWA 1PQZA 2FX7H 4LCWE 2ENJA 5MEPB 2OL3L 4YJZL 4U6VL 1QA9B 4EQ2A 2YXMA 1SVBA 4GKSA 1XGPA 3FONB 1U95A 2V3DA 1IT9L 4F9PA 4Y9BA 2GW5A 1RUQL 1YEDB 2C5DC 2X6BA 2ZOLB 2VDNH 4OCXL 4JHZA 3UJJL 1GHFL 4GRLD 4D0CB 3T4NA 3QUYD 5EOCL 4IIQC 4FYSA 3H55A 1IKNC 1NFDA 2IH9A 3O11A 4CRPA 2G5BB 3O2DL 1CLZL 5DVKA 2QQNH 2VGLM 3G9VA 1UATA 2YS4A 3F00A 4W6XB 1WUNT 1RIUH 2XU9A 4ILDA 1FIGL 1V7NL 1SBBA 2NNAB 2BNRE 1J9CT 1SF3A 2GFBA 4W9CC 5LGKA 2GSMB 1IGIL 2AQTA 3FT2B 5IP4A 1J9TA 3HE7A 1L0PA 1JMZA 1U8KB 5C0NC 3RI5K 3AG2B 1EHAA 2X6VA 1KBWA 1W72A 5EEZA 4NP4H 2D4FA 5EU5A 4QRTB 43C9B 1PZ2A 2Z35A 2AK1L 2G9KA 4G6FD 1J8HA 3SKNA 2G60L 4TSAL 3VGAB 2YAMA 4LPWA 3MV7E 1QP1A 1HQ4B 2AZUA 4FCHA 4HPYL 4JANA 4KNUA 4P46D 2Y72A 1URZA 5IROA 4MHHI 3OZLA 2ZKYA 5E8OA 1OL0A 5AAPA 2AJXL 3I6KA 3O4LE 5DRZA 43CAB 1JI1A 1LTXA 4IRSD 3KWWB 3ZO9A 3U46B 2R8SL 1JK9B 1HHGA 3E1F1 3HB3D 1AD0B 3OAYH 4R96A 3MRLB 5GRJL 1INDH 2GSGB 1NM9A 3QEQA 2ZUQB 2OMUB 2Z64C 2VLJB 4KTYA 3HBGA 4DNLA 4JQVA 4HS6B 2HG5B 3HC2A 3FRUA 3ULVL 1C5DB 3SY0A 1NIAA 4HIEA 3LQMA 3MNVA 1X5KA 2NY1D 5CZXC 3LZNA 1UVQA 2X05A 5I1GL 4KKQA 2ICWJ 1KNOA 32C2A 2CE6A 3FRPA 1M2VB 4C7PA 3VFNB 1FFPB 4XX1G 4ELDA 1VLXA 2NWVA 3NACH 3VN5A 4KITB 5I8EA 2IOOA 4GUPB 5E6UB 1MP9A 5AW0B 3AT0A 2PWWA 2R9HD 2DQJL 1KN4H 4M5ZH 4WCYH 4AM0B 3HVDA 1IM9D 3QR2A 5D2LB 2WLMA 2PXYD 3CVHA 2NW2B 4H25A 4F7TB 3PP4L 1YPZF 1QFUL 5FYKH 4OM1H 4CADB 5BVPH 3FTVA 5F93C 1PW3A 1ZTXH 3AG4B 5EO9B 3VU2A 1IFHL 4BSWA 4L0YA 1DFBL 1X7QA 1OXYA 1IBGL 3HC4L 4Z3FA 3NCMA 3FCSB 1WBYA 2HWZH 4NQVB 4Q9QH 4DEPC 2W9EH 1DE4A 3M07A 2KQMA 4KTDH 1G84A 2OK0L 1H3GA 1AIZA 2V8MA 4NP9A 4OGQC 4DZBA 1UWXK 3FFCE 1AKJD 2CLVA 4XAKD 3SGEH 3M17B 1ESOA 3D5OF 3CHSA 4CKQA 5CM1A 3RGBA 2F53A 2BP5M 5E0QA 1OARH 2QDWA 2D4DA 2YAPA 1KJ2L 3P9LB 4QLWA 4IU2B 3JZ7A 2UVEA 3DX7B 1GR7A 1FN4A 3NRPA 4PD4J 3WFDL 2VLRE 2DKDA 3IFPB 4GIPD 4PYHA 1WS8A 2EDQA 1EBAA 3GHEH 2CKNA 4AV0A 3MCLH 4KK8D 5BV7H 4G1MA 1P7KA 1QZ1A 5FYJE 5EU4B 2PPAA 3ZKSD 3GGWA 4J1UA 1QHQA 2QADB 2FQDA 4N24A 3MRGB 5DTFB 2JWYA 2AJSL 3FSVA 4QOKE 4E5XB 5HYSA 1AXIB 3QA3B 1TU2A 5LBVA 1G7QA 3MV8E 1DBMH 3QZMA 3D3VD 4PJEF 2FEDC 3RWFB 4ZUWA 4UOW0 3FO1B 4ZUTA 2CLRA 2WJ5A 4I3GA 4MA3B 2ZXEB 3AQXA 4DWHA 4PJBA 2MCG1 1BMZA 3QEUB 1BBJA 3DXAE 3UG4A 3W2DH 1JTPA 1IQWL 2RGSA 4IS6A 3FN3A 3MRFB 4DW2L 1JAEA 2WQVA 4I2XB 2F54E 3C8DA 1UKQA 3E3QE 2OLDA 5I73C 1XSJA 4EI5C 1UT4A 4HPHA 2IALA 1BX2A 2YPVA 3ARXA 3LPGA 3QDMB 1IAIH 3W37A 4N85A 5KJ4A 3BSZH 4PG2A 2DQIH 1KXHA 2Y1VA 2HT4C 3ALPA 4X4ZA 5T1MA 4FOMA 5CJBA 3CXDH 4KK5C 4KY2A 4ODUB 2CDEB 4KKAC 3I02B 4NZDA 2B8OT 3MPCA 5EZJB 1DDHA 1YDPA 1IEAA 2BFVL 3U4EA 4XI5C 1LP9F 1S7RB 3ABLB 1UWGH 3NJMA 1ZAGA 2AEQH 2F7LA 3L17A 1TTFA 3LV3B 4U6YB 1JXJA 1S7XB 4LVHC 2OTUB 3F5WA 5FS5A 3TN0D 2GJZA 5I26A 4K73A 2CUIA 2RH0A 1NAKH 5FWQA 5D1QE 1UT7A 3CK0H 3MJ7A 5BZWA 1EZLA 2WOYA 1FL5A 1TCMA 1RIHL 5T3XL 3P4LA 3VGFA 4WJ5B 3RU8H 3WOVA 1FO0H 3FFDA 1RJYA 5J9PA 4MJ4A 1AZBA 3OL2A 3B1TA 3QIWD 3RNQB 5JHLH 2HT2C 4AMXA 3S4SB 3F01A 3NJHA 2ITDB 1N3NB 4KY1H 5CCKH 2ZCLH 4EZJA 5ISZA 5MEND 1QLEB 4QTFA 1UH3A 3K2IA 1FYTE 3V7MA 3OKNB 1IBZA 4MNGE 2NOBA 2BCMA 2PTTB 3LJ3A 5C8JB 4MKMA 4JFSA 4AYGA 2HUHA 1OM3L 3RNKB 4TUKL 5IT2L 5FWRA 1KGWA 2GBAA 3S97C 3SO3B 5CU9A 2FIRT 5EWIH 1T4KB 5J12B 1RM1A 1WFIA 4PJIB 1RP8A 3HNSH 1YN7A 3OAUL 4APXB 3B2UD 4XC3L 4ZMWA 5GGRA 4UOZA 3ILPA 2VDPL 4QHNB 4Y2DB 1I8IA 4FRWA 4FULA 4M3JA 5FUCE 4Q52A 1NCGA 2VISB 4XCEA 4HQQL 5F21B 5DQDL 2BHYA 4NENA 3UTTD 2A9DA 5AYTA 3GLAA 4TF4A 1KCSH 4AQ8C 4HKXB 4I0PD 4UV4H 3ZYIA 2VH5H 1KCUH 5EC2B 2OBGA 2JCCB 4L4VA 3H3KA 2QVIA 1Y7VA 3H56A 2R0ZL 4N8CL 3HZ3A 3QXUA 1Q0EA 1ND0B 1PVSA 5FUOH 3M88A 4OU3A 4ZNCD 1PZSA 3L95A 4ZS7L 3SDCD 3ARZA 4N2NA 4GXVH 4XCYA 2V2XA 4JFPA 5J57B 4LPCA 3IAPA 4UMGA 3JTTB 3WNMA 2Q7AA 2GYSA 1CGWA 1T66D 4KRPB 5IQMA 5HGHA 3IJEB 4M29A 2H7WA 5AKSA 3S35X 3S9DB 2AJUL 2A77L 3DJTA 2PWDA 1UM5H 3ECQA 4YHKL 3N41F 3QUXA 2FQGA 2DWDB 5LN4A 3DVFA 2WQSA 3OKEB 3Q6GH 4BKLA 4URKA 3KPPA 1WQVT 1FRGH 2WNKA 4MAYA 2QSCH 3WFEL 1URIA 3IBEA 3QFJA 1XB6A 2W95A 1UM6H 2CLZB 3CUPB 1WWCA 1BXAA 4G1EA 3Q3GA 3EJRA 1W8NA 2XICA 2XZQL 1ZT7A 2YJLA 5C0BE 3ZRSA 1XH1A 3E8VA 3Q5OA 5DJAB 1JHTB 3BYYA 1U8PA 4FQQB 1VTLE 4QO1B 2I24N 1QW9A 1C5CL 2QPFA 1AHMA 1OB1A 3L1FA 2J8UE 1NOLA 2UWEA 2OX5B 3IS0X 5EB9A 3RZCB 2AJZA 3ARVA 4PJFB 1NEZG 4LKXA 3LRSA 4RETB 5E2TL 4FHBD 3V9CA 2OP4H 2G3MA 4LLQA 2VMFA 3GSNA 5KANI 4YZFE 4UZUA 3ECBA 4R7DA 1BIIB 2CPUA 1XIWA 2Z4QA 1PZ3A 3AAZA 3OKDA 4OFYA 3KYMB 1HH9A 1DJGA 2GIXA 4P5TA 3WE1A 3GSNH 5EIQA 5F7YC 2XWTA 3WE6B 1TETH 4KDTC 1WZ1H 5D1ZA 3JV6B 3FO0L 2VR3A 5CINH 4LEXL 2L4OA 4QHUB 4Y4FA 1NCCH 1T2QL 2BVYA 1I7RA 1EGJL 4ZSOA 1ZA3A 5D4JA 5BRZB 2CCLA 3AU1B 3NH7H 3TA4D 2H0PA 4AYFB 4YGVB 4IM8A 1OIOA 3B3BA 1MCIA 4QT5A 3LHPL 4ONFL 3IS1X 4RA3A 2WCGA 1GXEA 1BQKA 4G42B 3NK4A 3HUJB 2QADC 2HRLA 3QQ9D 5HHOE 1PD6A 3U0WH 5KBPA 2RCSL 1TYEB 1WBZB 5GISL 1LWYA 2MKWA 4R83A 1F4WL 2VXQH 3K72A 2FWUA 3QRLA 4JDTL 5K9JH 1NUDA 4JY6A 1G7HA 4EZKA 4N8VG 3LEXA 2H0FA 4MAZA 4XNQB 3D9AH 3K2KA 2CG9X 3LH9A 2Z31A 4R7LA 4BDVA 4ZFZA 3WEOA 3SQOL 5C07B 2NYYC 1WAEA 2PP7A 5DMKA 2W5PA 4R26L 1NDGA 3Q1SL 1FIEA 3B9EA 1CGVA 3VQ1C 1BZOA 1MHEB 2VSCA 3I3WA 4UT9A 4UM9D 3QAZB 2WZPD 2DPKA 3GKWH 3OLEA 2DQ6A 4MZ3A 5AOZA 4FXKB 1VGEL 3JWOC 3E8UH 1MCPH 4HWUA 4UQ2A 2EH7H 1S9YA 1I8AA 1P4UA 1X5GA 1XZ0B 1JF6A 2PR4L 4UT9H 5DHXB 5IQ7H 2LABA 4PJ5E 4H88L 2Y69B 4LBAA 4QCIA 5D7KE 5HYJD 4ODVH 4JS7A 2V5TA 4IDJL 2AHIA 1V8HA 1MWAB 4C56B 1RULH 3MI6A 2WLKA 1GGCL 3S37L 3SY6A 1SGKA 4G8GE 1RZJL 3N1GC 3MGAA 4LCUB 5KSAB 1EO7A 1NCAH 2P7TA 1NCDL 5JA8B 2IWGA 4UDTA 5HPMA 1CG9A 4FI6A 4HZ1A 2W92A 3S36H 1JHLH 4YSSA 1LK2A 2VOTA 3ZDWA 5GS0L 2DQEH 3DGCR 2XWDA 4ZX6A 1E9OA 5DJDA 2F7OA 1KGYE 4I48B 4JFQA 4RCAA 5JUEL 1X9RA 2R1XB 1MJUL 1KMGA 3L2MA 3QARA 3RPKA 1OT4A 4BHUI 3ZZ1A 5I18H 1DBAH 2E5EA 1M7DB 4MMXB 4QRPE 3F0ZA 1XXDC 1JYXA 1QX1A 3P69A 1UA7A 2GUOA 3MKKA 5BOPA 1UTDA 1ZANL 3LN5A 4AGNA 4Y5VC 4MLSA 4OSUH 2G2RB 2NYKA 2WXRA 3LNEA 1P2CB 5IGXL 4TQIA 4Z7VF 2AZAA 1N6UA 2Y8QA 2CJUL 4P2OD 3LS5H 2JE8A 1KPUA 1MUJA 4P46B 5T1LA 2FJFB 4F9LC 1Y07A 3WXWH 3DJSA 3OZ9L 4AZ8B 4MJ2A 5I5RA 3P3UA 3HB3B 3JWNH 4PIBA 1FP5A 2BIPA 5SX4I 3UTSB 1G1KA 3W5NA 1WH0A 4IMLB 1PZBA 2QQKH 4P07A 3T3MF 4IBYA 4BFGA 5FXCH 4PB9H 1Q4NX 2BJMH 4ZYKB 4X6EA 3SO3C 4JKPH 1A4BA 4GW1B 5F7DA 4U1MB 4NQSB 2NY1B 2WLHA 3QUKA 5HVWA 4WXAA 1OVZA 4N0FA 3AY2A 4HBQA 4PRNB 3BH8A 3APDA 2BSTA 3P30L 5GRUH 1FDLH 2VKXA 4ANVA 1MFBH 3GLDA 3PAUA 4H0GA 3UZEC 3TF4A 1A0QH 3TTYA 3LS4H 4UQ3A 2K4AA 4MJIA 2BHUA 4AH2A 2BZCA 1L0YA 3SPVB 2D8KA 3LIZH 4KKLC 1MCEA 2NY3D 2FR4B 1INEH 4UILL 3ARDD 4G7RB 4LF3B 4XHJD 3ZTJG 1FFOA 2BSSB 3MRNA 1IGFL 2LAAA 4XPHH 1IM9B 3F8UB 1AKPA 4XXCC 1Z5YD 2PXYB 3WAJA 3APNA 1H6UA 1G7PA 2MIZA 3SE9H 3PAZA 5CMAA 2IVFC 2QVMA 3VD0A 1T83C 5BZDA 3CDGA 1QAWA 1REIA 1QNZH 4NHCH 3TCXA 2IXQB 2GJRA 5HHME 3QZNA 3MLZH 1TJGH 3RBGA 4E9XA 2BWDA 5MERA 2RFXB 4QRRA 3VXNA 3BWUC 5HHQB 4B5ZA 3D87B 4FLHA 2XFXB 1J5DA 3F83A 5GGRY 4B7IA 5JW3L 1JF1A 2I60H 3Q9QA 4E41D 1LEIB 4NKOA 2GBVA 1GJIA 3GJEB 1B4JH 4JKNA 4EMZA 1RP9A 4PS3A 5JXED 1A4KB 1M7UA 3GKZA 3I2CH 5D5MA 4JY4A 1ZA6B 4GH7B 2H26A 3QORC 4LLWA 1UYWH 3I84A 3IDMB 2FWOB 3V4PA 4O2CB 4KKBC 3LRGA 3O6KH 5H2BB 4LCWD 1PEWA 3NZ8B 4XNDA 5JPMC 3BN9D 1NLDL 2BOCB 4K8RH 5JMVD 3ZE0F 3ZW3A 4QRSA 4MD4B 4GQRA 4K8RD 3X3FL 4MD0B 3RWDA 3TT3H 1I1AA 1DO6A 2KPNA 3V4PH 3Q2NA 4OLXH 5KBKA 1OPGH 2YD1A 4CBPA 3IKCB 2EDLA 5EUKA 2HPTA 4G6JH 2HJFA 2EO9A 4KNQA 1JG9A 1N18A 4KI5C 2WN3A 1Y0LB 2OSWA 1JGLH 4WWNA 3U2SB 1HSAA 1Y6NR 4HWZA 3G5ZA 3D3VB 1WAAE 1J0HA 4CUCA 3VD2A 1SXSA 1LD9B 3CH8A 2NNRA 4JY5H 1KTDA 1YYCA 2ICEA 2P8PA 3JV4A 4LCIH 1R19A 1S7WA 2C3VB 3BUDA 2X2HA 2XXGA 1NBVH 3E6FB 3TA3B 4F7CB 4R8WH 2BNRD 2LTQB 2WB7A 2QPDB 3PHSA 5DHVB 1QSFE 2OW7A 3D7PA 1XAUA 3I6LE 3L5WA 3O41B 1KLFB 1RI8A 3BD5A 2GK2A 4YPGB 5D7LA 3KLAB 4HS3A 3GTTA 4RQQA 4KJPC 5AVVB 5IHZA 4ZX5A 4NYLB 2OMYA 2IPKA 4JGJA 3L3DB 3DGGB 2VDKH 4Z77B 4A7TA 1D5IH 4BFIA 2IDFA 4GUCA 1EFXA 5TE4H 4G59C 1CDJA 4YSPA 3X3GH 3VFPB 3A67L 3ZJAA 5JDJA 4WKZB 5INCB 3U6RB 1ZVSA 2R29L 3T04D 3EOBB 2CNZA 5I30H 3SGDI 1RZFL 4FQ1L 4DZ8A 5F7FA 4DP5X 4JEGB 3MV7D 1OGTA 3KYNB 4MKTA 2FO4A 2Q5BA 3W3BA 4GINA 4G82A 1MAMH 1EEQA 2FX9L 4FQXA 5CSGA 3O4LD 2X4NB 3T6ZA 2K1MA 3KL5A 1HEZB 5BOJA 4OAWB 5HI5C 3CQQA 4ODHL 3TN0B 1T21A 3KVDD 2GY7B 4GSXA 3HC3H 1S4IA 2VB5A 2A9NL 1NFDE 1TITA 3AS3A 3QAZC 2ZP0T 5EHFA 1O75A 1X6NA 3FJTA 1I3GH 2VSKB 1RK0B 3HRZC 1OY3B 2Y6SC 4FA7B 4NWTH 3ULXA 4ONHA 3HHMA 3QIWB 3WIHH 1IEBA 2P24B 2OL3A 4YDIH 1TVHB 5DK0B 5HVHC 5DURD 1AHWA 4ZX4A 2R0KL 1SF5A 5HJDA 1WPCA 3GBLA 5ESQB 4A7VA 1YEGH 1UB5B 4LSVL 1WYJA 2ZAHA 5DS8B 1UA6L 3KGTA 5JR1H 5KSAC 2E47A 4RNRA 4C8XA 2WWMD 4BFRA 1NIEA 3QUZA 5EPMA 5CP7A 2OCFD 1U3ZA 3H9SA 4MMYA 3HG1A 5D7SL 3RUGE 1CS6A 4ORGB 1IGTA 2ITEA 4NB7A 3UC0L 5EZIL 4HCRL 1J8HE 1AGBA 4JN2B 1A5FH 3M1OA 4JE0A 5E1AB 3MXVH 3PV6A 2R2EB 3FQYA 1XMEB 4QHLB 1F58H 2JK5A 3BP5A 5CJOH 5DD3L 5A2CA 1QD0A 5B4MC 2A73B 1KULA 4JO2H 4BM7A 3DSNB 3D09A 3ERXA 1T6AA 2DAVA 5D8JL 1K3IA 3BUIA 1BJ1H 4UBDC 4TNGA 5F70A 5IBUG 3TYFA 2N0MA 1NM4A 3FFCD 3QEQE 4LLMA 4XN2A 1LNUB 1FWXA 2N7BA 4X0KB 3SDDD 3KTUA 3C60C 4FLQA 2WO4A 1CTNA 1RZKL 3ZE1B 5J6SA 1T20A 1MREH 2WAHA 2Q76B 2QREA 5JXAH 4Z7NE 4XWOD 2VLRD 3GO1L 4QRFA 3SDCB 1SHXA 4P2RE 5F1IB 3PWUA 3D4VA 1JV5A 2BVUA 3NZHH 4PRBB 5JQ6L 3TIDB 5HDQH 4XT1C 3IVKA 1R3LB 4HLEA 2X70B 1Y18A 3MGOA 3T0XA 3SBWA 5KOMC 3UPRB 4P23D 4OCRH 3RJDA 3NJNA 2Y0SA 5FYJD 3RVXD 1IGML 4KHXH 5AVTB 3MZGB 4LIQE 3IU3B 1DCEA 2YUWA 4ERSL 2YK1H 2E7MA 3BGMA 2QELA 5GGTL 1J0JA 1CVRA 1U3JA 2XBZA 2XHIA 3TO2A 3SE8H 4AQEA 1LE9B 3X1GA 3Q13A 1JXFA 3P3YA 4QOKD 5BJTA 3BAEH 3ASNB 3WUWB 4ZW3A 3MV8D 2YXWA 4OW6A 4YGAB 2BC4B 2JJUA 5HJ3A 3CSYA 4NQQA 2UYLA 4GW5A 5DJCA 1XR8A 4HOXA 5I1AB 1EUUA 4FTVA 4FNTA 5DC0A 4QRQA 3DLQR 3DXAD 3MNMA 4KXZI 1THAA 4FNPA 5E6ID 3QRFM 5JA9A 3DIDA 3VGBA 4YXLL 2F54D 3FB6A 3PJSA 1P5GX 2Y7SA 4G5ZL 2F53E 4JRXE 4B0MB 3ARBA 4BIKA 5AYUH 4UQIM 4M03A 5E94A 3FU7A 3KPNA 2CH8A 2DKUA 3VA2C 4FABL 2JQZA 3MREA 2E75C 2HTLC 4JCLA 3S6CA 1EJOH 1QEXA 1SEBB 4I88A 5FYLE 2XWZA 1NAMB 1A7QL 1Z66A 1MCFA 2E46A 2X12A 2MTPA 1HK6A 5DJXA 4Z78B 4NGHL 2IC2A 5KYUA 3ZLQC 3FDWA 4AUJA 4F2MA 4EDXA 4FX5A 2B59B 4J3XA 4QXTB 4AXWA 3QWOA 1HX0A 2UZXB 1FZKA 1DSWA 2VXUH 4L29B 3C5JA 4EVNB 4NS0A 4YH6A 5T1DH 4Y1AB 4ZS6D 4HAFA 2VRKA 2IPUK 3WMSA 1KJ2A 3T3PF 3IKKA 3K6NA 1JVLA 3PWVA 5D1QD 2HFGL 1HHJA 5IR1A 5D6DC 5HYIA 2X4SB 1MCJA 1VZHA 1YECH 3PUUA 2OA9A 1WEJL 3WEAA 3M86A 4WEEA 4POYA 1X5HA 3GI8H 3FOMA 4JLRA 5I1CL 3SDAA 3CHRA 5AOMA 4NPYB 3WG7B 3LMJH 2J88L 1H9VA 4XPTH 3MODH 1IBFA 1X44A 3TA3C 3TBWB 1FYTD 2VT0A 3FPYA 2A99A 3K1DA 1BZ8A 2A4EA 3DV4A 4HF5H 4PGBA 4XX5A 3DV6B 1ET5A 1JGEA 1MEXH 3BAWA 1YQRA 4PJ7A 4IKKA 4OCWL 2HX9A 4C54A 1J1OH 4M1CC 5IJKA 4XCCL 2XXMB 2FTAA 3T6XA 5A7EA 2MNUA 2FJHA 4NLHA 5IB2B 1G7JB 3REVB 1CD0A 2HLFD 3DPBA 3BFOA 5HYJB 2J5LC 4Z9KB 3F12B 1MCRA 4PVLA 3CBJB 3MJ8B 1UOWA 3JYBA 4WKXA 3ML9A 1O6SB 2P28B 1A8JH 4HUWA 3CHQA 1OEZW 3PRZA 1C1EL 3Q8FA 4L0ZA 2DYPA 1ACXA 4LP4A 2Q2EB 5ICZB 4Z7WF 3F7LA 4AYID 1FPTH 2CBQA 3BI9X 3HI1A 4UANA 5HGDA 3O6FC 4FMFA 4GXUN 4NO3B 2XG5A 5H4ZA 3UAEA 3OGCA 4OFKA 3TU6A 1XCQB 3IETA 4QTHA 1ACCA 4GAYB 1I7ZB 2Y23A 4IK7A 3OLIA 2NUPA 1HZLA 1ORQA 2CDFA 3LDBB 1JK8B 4M5YL 3HRPA 4UZSA 1BXUA 1S9KC 3A47A 4ZO6A 1SYVB 5GS1A 1EJ8A 1YYMH 4P2OB 1KTLB 3LKSA 1R5IA 2ORBH 3MGTB 5CEZL 1JZDC 4K3HA 4K7PH 4OF7A 4PV9A 4PWGA 3L3JA 1M71B 5HJGA 1NH6A 1OTSC 1LK3L 1XF3B 3OKLB 2CD0A 4IBLT 4PCYA 4U49A 5D7IF 5KAQF 2R23B 2F74A 1AZVA 1RV6X 3U25A 1HJCA 3NJKA 2XZAL 2AJ3B 3R0MA 2O93L 1CDGA 5GS2H 3TBTA 4BK4A 3F84A 2O5ZH 3D07A 3SZ6A 5C0BD 4HKBB 1V3LA 3BWSA 3BZ4B 5DUML 2NOZA 1KBKA 2GK0B 5A3ID 1BQLL 5L2KA 3CTTA 1DL7L 3N43B 4P99A 4WRLA 5AUMA 1UJ3A 2OSLA 3PL6A 3QO0B 4BCXA 3WN6A 5D7EA 5K9QI 3BDYL 2GABA 1L9NA 5EBMB 4UYQA 3O0RH 1X5XA 3ME0A 5C0EA 1U21A 2FGTA 3L3OA 2NTFB 4JKWA 4F58H 4GBXD 5KG9B 3GYRA 1ET8A 2W9DL 2NY3B 1JPSH 2HP4A 5C0AE 1JFQH 3L08A 1IKOP 1QLFA 2RHEA 4M1GL 3MC0A 4DN3H 4CJ1A 3VH8G 2QRDA 1MRCL 2WYIA 2XQYK 4QXUL 3TYGH 4QJ3B 4PP1D 5HVFB 1BHGA 5IKCA 1DLFL 1DTUA 2XIIA 4HIJA 5AW3B 2XHNA 5CLXA 4Z7QB 5LG6A 4FJYA 3EXLA 1UWFA 25C8L 4S1QH 4PS8A 2X2UA 1NGMA 4QTIL 3R7RA 2BHFA 1CVSC 2YC1A 1RKRA 2FWLB 4MJHA 4B5EA 1KWGA 1WA2X 1C16A 1Z6JT 1FC1A 2Y1ZA 5FGRA 1FV1A 3KNBA 4XWGH 3BLBA 3VE0A 1UGNA 3PWPE 3RWCB 4C55A 2V17L 3V5DA 3Q06A 3PCYA 2WMPB 1N6VA 2JFCA 3QFJE 2NDFA 3IDGB 4HSQA 4J7RA 5IJVA 5B8CA 1MFNA 2VO5A 5TF0A 5HHOD 1NPJA 1M7IA 1NGXA 3IJHB 4JRWA 5E9DE 4F57L 3ESOA 5G4NA 5DSCB 5JPNA 1H3UA 1AH1A 4JL2A 5EZOH 1UB6B 5AB2A 4K0OA 1N5YH 4OIAA 1JPTH 2UWEE 1E67A 1XGYL 2VXTL 4HAKA 4ZFOB 1T1ZB 3FTGA 3L4YA 4L8SB 3D0LA 2NOEA 1M53A 2F8IA 2YSSA 2BNUB 4N9GA 3GEFA 2MCPL 4N0CD 4XVUD 4B60A 4HJEA 4ODWB 1DQJB 1U4FA 4LRIC 1SDDB 3PWLB 2GTQA 4NKIH 1TTCA 1ACYH 1RUKH 3TJEH 3Q01A 3HPLB 1T3FA 3QBTB 1E4KC 2QLVA 1TZ8A 1LO4L 2DICA 2Q86B 4PRDB 1TIUA 3KLKA 1BBDH 2ATPA 4YDKL 4PJ5D 3VJ6A 5D7KD 4ZSOE 2YH5A 1MW3A 4L1SA 4XVTH 1XGRA 5EIVA 4GT7A 1KIRB 2A74B 1BM3L 3BP4B 4OZHF 4HWEL 5IQOA 4G8GD 3H9HA 3IAQA 2O6DA 4MD5B 1TF4A 3W0WA 3CDCA 5L4MA 1UT9A 1HQRB 3KW8A 1RUPH 4ZXBD 3GHBL 5T3ZH 1OT2A 4Y2NA 2VNCA 2JJSA 4LU5H 3FQXA 2VDQB 3D2UD 3QJQB 3WLBA 2LU4A 3FW6A 4RODB 5BQDA 3TPUB 3O3AA 3B5TA 1DSFL 1KFAL 5SWQB 5DI8A 4LASH 5B3JE 1A21A 3L5HA 3PE9A 5TPWH 2F19H 3CFKA 4JFVA 4QRPD 5IEKA 5F9CA 2LGNA 1LMKA 5C0RL 3LN4A 4HALA 3KH4A 2R2BA 5CN1A 3LQAC 2X1WL 4S0SD 3MRCB 2ED6A 1KXQE 4YDJB 3ZDZE 3MV7B 4XE0A 2WB1A 4X8CA 5DEZA 1PX8A 1AG0A 5I76A 4L5FH 2C7UB 4N2GA 5CZRA 2CMRH 3S5LB 3HAEB 3O4LB 3AQZA 3VTAA 1X5AA 3U9UB 1GKOA 2WXQA 4OZIA 4JQIL 3OKMA 3P9WB 3EYUL 4JREC 4P4KB 4U0RB 4H20H 2QDVA 4WV1A 3BMWA 3EYQC 4RRPM 4XXWC 4BKSC 4KUZH 4FXGA 3ZYJA 4ELKA 3TE5A 4TS6A 3HA0A 2H4EA 1VGKA 2KH2B 12E8L 2H6OA 4ZAKB 3UBXA 2O61B 2YAOA 5EU6A 2PPFA 2G0LA 5T5FL 2QGBA 1U2HA 2HX8A 4NN6B 5JHDB 4KX8A 3KWUA 1HIMH 3G5XB 4AVJA 4G43A 2O6FA 3P4MB 4U6HB 4RGMB 3FCGA 4KWUA 4JFYB 2W38A 3SYAA 1EMTL 1HHHA 2JI2A 3WIIL 2NDGA 5IB4A 2WSKA 3QQNA 4N22A 5DQJA 3D69A 3RWJB 3SDXB 2DBLL 1KBGH 2OR8A 3F7YB 2VQ1B 3GK8L 2QGCA 3AW5A 1DLHA 4OQTL 1LGVA 1A4JA 1Z7JA 4OT1H 1PFCA 2X2JA 4OY9A 2Z6FA 3HNVL 1VCBC 4L9LA 3LZFL 5E6RB 5I6KA 1SJXA 2NPLX 1UOKA 4E9LA 1P4BH 2NXYC 3WY3A 5CJQL 2MH4A 2P5EA 5HHMD 5AVXB 1SM3L 3ESUF 2PCXA 2QSQA 2H1PL 3N9GH 1MRFH 4GG6F 4L1TA 2HMIC 1A7BA 4R7NA 4YHOH 2AW2A 1TUPA 3ATFA 3FFCB 2E74C 3PWNA 2HJLB 4EBQL 2OR7A 1S78D 3VXUA 4JHUA 4DCQA 3SDDB 4G8IA 4JDZA 5EC1B 3KYKL 4BEIA 1HSBA 4PP2B 5J06A 4AUUA 1CK0H 2AABH 2VTFA 5GZND 3J07A 3SCMD 4C83B 1K5NB 2Y7OA 3OMAB 1MXGA 3V6FA 4JDEB 2J1WA 3B2MA 1TTAA 1VFUA 2X4OA 3FQRA 3B56A 3PF2A 2JKXA 3R0NA 1G94A 4MJIE 4KNSA 4P23B 2WW8A 4JHVA 4AGMA 1JS4A 2YMXH 4OBRA 1Q9LB 3QZWB 2V9UA 3SOTA 1RJZB 4PB0L 4GEJA 1KLGB 3WIFB 2FUQA 1UFUA 3FMGH 4QOKB 4IGBA 1H3TA 3QS2A 5I0DA 2EXTA 3GMNA 5I1DB 3RX8A 1WHPA 4HJTA 1BQHG 2O5YH 1HWGB 3HN5A 4CVUA 3ULUH 1N59B 4HUCA 1D5ZA 4G6MH 4PW4A 4QRRE 4YAQA 3ZYOA 5EUOF 4MRBA 2P8MA 3UZVB 1P5DX 1UWEL 1KIPB 3DXAB 2OXGB 3EFOB 3LH2L 5E6IB 1IAKA 1MWAL 4A7GF 3QO1B 3V5KA 3GD1C 2XYCA 3VQLA 5LG1A 1QSFD 1T0MA 2WQUA 4K7FA 3I6LD 1SY6L 3BHBA 3PQYA 4J3OD 2WGXA 3BESR 4IIQA 3PPEA 1DVYA 5D5ME 4A38A 1GZPA 1RQ5A 1RUAH 1IKNA 5I6OA 1QW8A 1CQKA 2BY1A 3B1UA 3EZ8A 4R2GD 3VRLF 5D2LF 5D7JA 5BW7C 3K6SB 4UQ9A 4KBPA 1XH3B 2I25N 3VW3L 2VZ1A 4ZTOH 3F6IA 4CILA 1R5VA 4DF9A 3GIVB 5DJ0B 1KF9B 4LPUA 1NSNH 3ZY7A 2BOBB 4WW2F 3TO4D 2BH0A 3NOIA 2V33A 3O3BA 2F68X 4WLCA 2MPVA 3V52L 4AK2A 2VZUA 4C4KO 4JM2B 5K39A 1G6RB 4QNPF 1D6VL 1OGAE 3RA7L 1BAFL 1E5CA 5FOBB 4NUQA 3SOBH 5EORH 1B0RB 1PMYA 2UX7A 4IIZA 4E9TA 4KUCD 2FSEA 2EIZB 4MAUL 4S2SB 4WUUA 4JE4B 4KROD 2UZIL 3PHQB 4PW9A 3QXVA 2BP0B 2WXPA 4KVCL 1Q1JL 3WKPA 5DR5L 5I0YA 5D7LE 1FYTB 3ARYA 4JG5A 2DQUL 5KSUA 3HE7D 3QIUA 2QPEB 1YEFL 1RFDH 2C3HA 5FV1L 1ED3A 3OAWA 1FHNA 2IPTL 4JGNA 3STLB 1TPXB 3U7AA 4J4PC 3VXPB 2H6PB 3WJMB 4APQB 1J8HD 1LO3H 2WNXA 3K6IA 4M48H 1A7PL 2R39A 1HKLL 1IAOA 2YARA 3H2PA 3RGVA 4F5CE 3MA7B 1D5RA 1K4DB 2VR7A 1GS8A 2YGNA 3NA4A 4UAHA 3MDJA 3R18A 3MJ6A 3QWRA 4YNYA 4D0DA 4KMTL 2IH1B 2IG2H 4XPGH 2VL5A 4AJWA 4ETQA 4PGJA 4RWYL 1MIML 5CBEB 3DOSB 1RZGA 3VFTB 2H1XA 1CT8B 4HZLA 2GIYA 3LH8A 3QEQD 2DQFB 4QRUB 2BK8A 1G9NC 1CZ8L 1EEYA 3GIZL 4JX0A 3KXFE 3WU1A 5T1JA 4QAMB 2IAMC 4HS8H 3UYRL 2YQ2A 2OM5A 3PDKA 4P4KC 4YHZL 3QZWG 1YYLL 4LO9A 2HFTA 3QT2A 5CD3A 2WJ7A 2E8ZA 2AC0A 2YBGA 2HTKC 2R29A 4O9HH 1QPXA 1FLRL 3UTQB 3MJ9H 5ICXA 4S1SH 4P2RD 1NEUA 2KI6A 4GKNB 1OAUL 4ONGL 4PGDA 5C86A 2A7BA 1PIFA 4ZAKC 1SJVA 5JYLA 2ZNWA 5AKRA 2FVNA 1KO9A 2JXMA 1CDUA 4NN6C 3ZKMC 4HIIB 1I3UA 2VUKA 4GW4B 3LY6A 1OCRB 2L04A 3HG1E 5A2AA 4LIQH 5CF3A 4C57C 3EJQA 1H5BB 4PRIA 4ORZC 5DRXB 3MKGA 4I87A 3N0AA 4UTAH 5CGTA 1CD8A 1DBBL 4JUTA 5E23A 5E56A 4DKEL 3PP3H 4WY7H 4RFEA 1V55B 5E99H 5AZEL 4HUXB 4MXQC 3NSXA 4U4IA 5F88B 3WIAA 1J1XL 3RX5A 1QBMH 1U8NA 2FE0A 5H37A 1GZQA 3GSRB 4XNXL 4NUPA 4AW4A 3ES6B 2EDTA 1N7MH 3MTRA 2F53D 4JRXD 1G4MA 3IJSA 1T0PB 3P1VA 4GBXB 5LAXA 2BVQA 3AITA 1WWBX 1F6AB 3BW9B 5AOKA 3V0IA 3TS8A 4HH9B 2ICWB 2WLLA 4OI9A 3WN5C 5J11C 4HCRA 1T03L 3WSQL 1ZCRA 5FYLD 3LXAA 2ZUSA 2GG1A 1TZHA 1BVKB 2DLHA 4BZ2H 3CMGA 4LHJB 4U7MA 5HTSA 4XOAA 1D5BA 2Z93B 2PO6A 5LGJB 3DURA 1LQBC 2CIKB 3TJPA 3P2BA 4ONOA 5A43C 1KBBA 2IO5A 2NXZD 3GSVA 5E8EA 5TE7L 1I9RL 3ULVE 1PJ9A 1FNAA 1FH5L 2XG4B 3E7JA 3QPQD 4HGKC 3PDOB 3ZMEA 1XF2A 1N0XH 4JFOA 4OD2A 4ZPTB 5IK3A 3X11A 5HHOB 1PLCA 4C4UA 1N64L 4CL7A 4Y5XC 1UD5A 3EJCA 4XN7A 3P73B 5IBLD 4FTVE 5DC9B 5DUBB 4JFXB 1X5YA 4U1SA 1QLRA 3QEGL 4NNXB 4NCDA 3QXDA 4AMKH 2HG0A 4JPKL 3QULB 4GSDL 1AQKL 1K5WA 1QA9A 4BZYA 4LFHD 4XC1H 2XUWA 3FONA 5GGTA 3VFGH 3UAJC 5EEXA 1DVFB 1U36A 5F9DC 4YEFA 2K3HA 4GG8B 1YEDA 3FL7A 3Q1EA 3K91A 4NO2B 1JDCA 2BXYA 2H3XC 3D1MC 4M7ZB 4D0CA 4X9FA 1INQA 2E7DA 4F1ZA 2QQLL 3NCJH 3ZHFA 4PJ5B 4AGOA 3WS3B 2HVJB 4F2ME 4OZGF 1AO7A 2XN2A 5KS9F 1YEHH 2EE3A 3FXIC 4TUJA 1OE3A 5DS2A 4Z3GA 1GTNA 5CZKA 3T77A 1Q0YH 4GQ9L 3QPXH 1ZT1A 2X1OA 4N0UA 1U93A 3CHPA 4L3EE 1GGIL 3FZUC 4X5XB 1SMOA 4B96A 3RVWC 5E0FA 4AVIA 1AC0A 2VDLL 2CO4A 3OWEA 2I07A 4OM0L 3D2UB 1KV7A 1YLBB 2IWFA 2CXKA 4YHMH 5F1KC 3TJHC 3FT2A 3D0VB 1MVYA 2ZUYA 2IH8A 2Z8SA 5I28A 5IEHA 2DQTH 4JM2C 2DM4A 4NX0A 2M8XA 4PSRA 5EFIB 4AE0A 3BKML 3LQZA 1WCQA 1Q9OB 2EXSA 3KS0H 1SXCA 2Z91B 2QZQA 2DL2A 1FBIL 1GYWA 4NC1C 2LR4A 5ISZD 5LCVH 2VLKA 2X10A 4BJUA 2B2XH 3VI3E 1A66A 3RB5A 3C9NA 2DLFL 1AZUA 5ITBH 3DHPA 4F3FA 4HK0B 3LKQA 1SXZA 2FT8A 3KEHA 4AQ8A 2VDOB 3QS3A 5JW4N 1A14H 2J1ZA 1JZHA 2IDSA 3ARED 3BH9A 3ZE2F 2VC2H 5BVJB 3L3IA 4IKNA 5IMLB 4FI7A 4IJTA 5IQNA 4P4RB 5FUZH 2C9UA 2WIIB 3U46A 5KTEH 1NZRA 2E27L 5L88H 2AEPL 1A3RH 3EGXA 1L7TH 1EAPB 2I5YL 5E1QA 1FNSL 1TPXC 3CZEA 2CR6A 4J8RB 3W5MA 3DHMA 3OPZL 4UT6H 5CS7A 3WNJA 4PJ8B 1I8KB 4PTUB 5I1LB 3GUTB 4QHKI 2ODIA 4JZJC 3V4UL 4APQC 1FNEA 5ADPL 4U1JB 2D9QB 1GCYA 2VW6A 2BVPB 4U3CA 5IESH 4MHHG 2DLGA 1CGYA 4Z7UA 4MDIB 1JBJA 4S0TD 4L4VD 4UOJA 1RERA 2VABA 1HE8A 3SGDH 4KKCD 1F6LL 1S5IH 4TM9A 5C0AD 2AQSA 3CLWA 2G9HA 1MZYA 3S88L 5DFTA 5FA4A 1S7TA 1NBCA 4AKQA 1AD9B 1QTSA 4PS4L 2ED9A 5IMOA 3TVMA 2ZF8A 2OYLA 4CVZB 5KYYB 1R9FA 1ZDSA 4NUGH 4I77L 1FGVL 4AIZA 3O3DA 1FZOB 1GA2A 1ZK5A 3IWUA 5DUPL 1BZ9B 1J5OL 1ROWA 2W1NA 5HYQB 1RUMH 1NGQL 1MLBA 2HRPH 3ZKNC 3QUXD 3VMOA 3HLAB 4GJTB 2HA1A 3MRHB 5T3XE 4YWGL 4NO5A 5ETUB 1P4LA 1Z32X 1S9XA 2V5YA 1NCTA 3PWPD 4MAYD 5TH2B 1H9DA 3TFKD 2ZKXA 3EUDA 4GUOA 3DPTA 3QFJD 3ZKQD 1FE8L 2W0PA 5ESVB 2VL4A 5CBAA 4XP9L 2YD9A 1UD4A 2CWRA 4KDTA 5SWSE 4AEHH 4B7LA 1JVOA 2ZJSH 1TYJA 3B9VA 4TRPH 3T8MA 2YPKB 3EDKA 3SD2A 4AE1A 4WO0A 1S7QA 4GRWB 1IGCH 4I4WB 7TAAA 4IRJC 3EJSA 3LVEA 2J6EH 3LQAL 5EU3A 3S3PA 2G75A 3DI3B 4AKPA 1T80A 2CUMA 4KZ0A 5FO8B 3IJ8A 3HKZA 4RMVA 4GAFB 3R1GL 3S98A 4WI8A 5EU4A 5I24A 5AW2B 3TT1H 4X9BA 1XIWD 5IBTL 4NZUH 4Z6AT 4XMKH 1UZGA 4OFYD 4YSUA 3WJLC 1WF5A 1AACA 1NFIA 3KVQA 4P5TD 5IUSA 1BWWA 5CR1A 1LO2L 3MOBH 3AB0C 5I1HL 1MCWW 4EZMA 5JYMA 1DIZA 3FB5B 3L4WA 3B2VH 2BXZA 4Y4FD 1TZIA 4PJCE 2BFGA 4MA3A 3W11C 3T0EB 4NQCB 3B83A 5B3NA 3IGLA 2EE6A 2XWBA 3QUMA 1GOHA 3WFHB 4JDVA 4EDWH 3VXRA 5FAAA 1QSFB 1OP9A 2YKKA 1MCLA 2EKSA 1QKZL 1VKLA 4KJWD 1KLUB 3II3A 4N2OA 3GF8A 4YXHH 3QUMH 4XP1H 4F20A 1NCBL 5I8OH 1BEXA 4KMLB 1LWVA 2DIAA 3MLSL 5IYCP 4X8JB 3FO2B 5LO7A 5EA0L 1J5IA 2IADB 3MNWA 5JW4R 2IMNA 3MRRB 4ENED 4X7TA 2PETA 1PQZB 2MNJB 2YRLA 2VDNB 2Z31D 1XO8A 1XGPB 1U95B 4S1RL 3V5HA 3I02A 2O30A 1KPVB 3HPJB 5EZJA 4HJIA 2F58H 2D0GA 1F56A 1P53A 2K78A 4PV8A 1JZ4A 1CDHA 2NR6C 1TMCB 1QVOA 2BNQE 2ZXBA 2XQ0A 5I8KL 1XTMA 1E3FA 1I3VA 3PHOA 4KXZH 1SHMA 3B9KC 2BHZA 3TV3L 1DVFC 1NFDB 4FFYH 4LSRH 2K0RA 5E6ZA 3O2VL 3EJYD 5HDLA 2F7PA 4KXCA 3R4DA 4NKMA 5ID1B 1VCAA 3CSPA 4DKFL 4N2CA 3PNRB 4Y5VA 3S5YA 3W0WE 4X9YA 4KROB 2A1WL 1AGEA 5GGVL 2ZXGA 3NIFE 3PWJA 3QZOA 4N2BA 4MMZC 4B9IA 1OAYL 2GFBB 4H26A 5C0DA 4F9LA 5KN5B 5ENWB 4KRNA 3WTSA 3MXWH 1BXVA 3F6LA 1ZLSL 3LCYA 3SPJA 1H8OA 1NMBH 3HE7B 4HUNB 2H32H 4YHYB 3IB4A 3ZL4H 4D7PA 3RTQA 2AV1B 1ZV2A 1I9IH 3EFDL 4NAQA 4Y5YC 1W72B 3FU0A 1A3LH 1TXKA 1A6ZA 4M93B 1D7BA 2OOXA 4JG1H 2Z35B 1NGPH 3GINA 4JG9A 3SKNB 1J8HB 5GGQL 1VACA 3I0WA 4FDWA 4XP6L 2VXSH 5C09A 4APXA 4BE6A 2XWRA 4JANB 3QHTC 5T1LD 4N2FA 4W9IC 1FZMA 3WNLA 3Q43A 4DGYL 4G7VH 1OCWH 4MNHA 1WFOA 1X6LA 5EBLA 5DRZB 1NDTA 2VYRE 3CJJA 3I6KB 4D9LL 3G04A 3L5JA 5FA3A 2VMEA 1AY1L 2VN3A 3UYOD 5D2NC 1HHGB 1MNUH 4TTGA 4R96B 4WFHE 2AFNA 1AC6A 1VDGA 3B7TA 4JB9H 3RPJA 4WW1A 2D9CA 3QEQB 1ZLWK 3SO5A 1PLAA 1IV8A 4O4YL 4XXCA 3FRUB 5GJTH 5DMJB 3SY0B 4JFZH 4HIEB 1KIQA 4NN7B 5EU6E 5AB0A 2NX5E 3MNVB 1DQKA 4TSCL 4HFWA 3DUUA 4IQHA 1OTUC 1UVQB 1T83A 3VVWA 3NSCA 4Z7NB 1TJHH 1B0GA 1KNOB 4J6RL 1W0YT 3FRPB 3GBML 4KNTA 3V0HA 1ZGLM 4H0LC 2Y1YA 5KJRL 3ARQA 3T4YA 1P1VA 4PJ8C 2N01B 4KK6D 2WYHA 2RALA 4HCIA 2DH2A 4B3EA 5GIRA 4MJID 5I8EB 2V5MA 3WFBH 2OFQA 3GUFA 4ZFOL 4PUBL 2ZG1A 1QWNA 4EJZA 4FQIL 3ENEA 3MV9A 3L9EA 5DZPA 4XPBL 4R3SA 3CVHB 4V1DA 3R06A 4I8OA 3TWCH 2PABA 1SFHA 3OKEA 5LBSL 2NRDA 3H0TA 1SPDA 1ZVNA 4OB5H 5DO2C 3QORA 1OSPH 5T5FA 3FTWA 4BSWB 1X7QB 2YEZA 2B4CH 2JI3A 2KERA 4J3OG 4ODTH 4M61A 1WBYB 4QRRD 2ZF9A 3F58L 5DJAA 5JPMA 1QTPA 1JZ6A 1DE4B 1ID2A 2XX1A 4A1RA 3LPWA 3PAVA 4U6XB 4UINH 1ETB1 4DZBB 2WVVA 4K3EL 1G5GA 2WTPA 2NCEA 3GZPA 3GPSA 2W88A 3VXUE 4PJFA 3RJQB 2F53B 4KQ4H 1P7BA 4ZQKA 4Q8BA 2GTWA 3QQ4A 4OQTA 3PLYA 1BGXH 1FN4B 1L9PA 4UB0H 2DOCA 1R3IH 2OYKA 3SPGA 2FZ3A 2DKCA 3CMOL 2JB6B 1AYOA 2IIJA 3NABH 3U1QA 3UJIH 4GUQA 4OCYL 5L7XH 2KZKA 2CJSA 2XY2A 1AZZC 1XF1A 5DYFA 1F02I 4F1SA 1E4WL 3ETBJ 3K5SA 4G1MB 3GXIA 5EIIG 1I1AD 4QWWD 1F42A 1EK3A 3GGWB 4J1UB 9PCYA 3KWXA 1R24A 1SVCP 2GJJA 2NXZB 4ISVA 4DPAX 3EDEA 4HHWA 3WS6A 1GJUA 3PGDA 5HYSB 5JZ7D 1TU2B 1WIOA 4LSPH 1G7QB 2DMGA 3TBBA 1JZ2A 1ZEAL 1E28A 3EGDB 1G9NL 1GTFA 3GTVA 3HUJA 4KDWA 4LSUL 4RIRA 1OGAD 3H7LA 4ZUTB 2CLRB 4PJBB 2DIEA 2MSPA 4N6QA 1BBJB 2CK0L 1SDYA 4UIKL 3DX9A 5B38G 4OF5A 1A22B 3Q48A 4YXKH 4HKZA 1I1YA 2GJPA 2XZCL 4CSTA 4NWUL 3JUZA 2IALB 3T0EC 3QNFA 4Q14A 5FW8A 5D7LD 4LLUA 4LL9A 3PXLA 5CHNB 2C1OA 3NCXA 1GOGA 4OD1H 1MHEA 2BOLA 4NM8H 4BRVA 2YQBA 3V0DA 1YQKA 4NNPL 1EFXD 4H1LA 4KI1A 3GRWL 4U1KA 5T1MB 3BPLC 3QW9A 1PFOA 3UP6A 1CURA 5ALCL 3EXJA 2X2YA 4XBEH 3HRZA 1CCZA 4YQXL 1A9BA 2WV3A 2AQRA 5ECGA 3TH4T 3NA5A 1SOKA 1L6XA 4ACPA 4S1DD 1DDTA 1CR9H 1NJ9A 1TYRA 3CW7A 4OGYL 1DDHB 1JGUH 1YDPB 3KM1A 1FAIL 4AT6A 1CFVL 1TQBC 4LOUD 1TR7A 3GMLA 4GRLC 1OAZL 3VTMA 2MPAH 4FQXD 4I85A 4Q7DA 3NJJA 3F5WB 2VRAA 3B43