1KYUA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
total genus 69
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyuA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyuA02
1QNAA 1KYUA 1GYVA 1GYUA 5IYCP 3HS8A 1OM9A 1B9KA 4PY5A 2IV8A 3VN5A 3ZY7A 1QNBA 2MJ7A 1D3UA 2A7BA 1QN4A 1KYDA 2D0CA 3OCIA 1E42A 1VOKA 5CN2A 1MP9A 2VJ0A 3ASMA 1KY7A 2DWXA 1YTBA 1KYFA 4B0AA 1PZDA 1VTOA 1TBAB 2G30A 1QTPA 3ZHFA 1W80A 1YTFA 1NVPA 1TGHA 2Z8UA 1QTSA 2IV9A 1GYWA 1VOLB 5IYBP 2D0AA 1QN6A 1QN5A 2D0BA 1P4UA 1QNCA 1NGMA 1QN3A 5IYDP 1RM1A 2E9GA 4ROCB 1NH2A 2DWYA 1C9BB 4RODB 3EIKA 1TBPA 1PCZA 1JFIC 4BCXA 3MNMA 5CN1A 1AISA 1IU1A 1KY6A 1R4XA 2YMTA 1QN9A 4ROEB 1QN7A 1CDWA 4WZSD 1NA8A 3OC3C 3H1ZA 3HS9A 1VTLE 1QNEA 1QN8A
chains in the Genus database with same CATH superfamily
5JDJA 3FS9A 2XOTA 3QEQA 1UA7A 4I9WD 5GQBA 4JHUA 4NQCB 4UT7L 2B77A 4W81A 2XTSA 3W0WD 5C0FB 5IROD 3OXRA 3DJ9A 1PY9A 1MCJA 3L7FB 5HJGA 4GLRI 1UZ8A 3P30L 2WWOA 3VFGL 1CD1B 3L4YA 3OZLA 5E56A 2XNAB 2ATPB 3RGVA 5T1KA 2XIBA 3LEYH 2CRIA 2NY3D 5EWIH 4XBMA 4LB8A 2BOBA 4Z7WE 5IUSA 5L7XH 2C3XA 5L88H 4FFZL 1S3KH 2DZEA 2D3LA 1LK2B 1NGPH 3L1GA 3BPCA 1YPZE 2PP9A 2XN9A 3PNRB 3AREB 5DJCA 3IETA 4MA7H 4OLVL 1E9QA 4M5ZH 4QEGA 1X4XA 4AQ8C 4Q8BA 2XWDA 4LHUD 3UCQA 2IPUG 3UYRH 2Y3NA 3GDBA 2WWNA 2YA1A 1UJTA 4Y1AE 5EU7C 3H9HA 2IH3A 4ELKA 5HY9B 2EDKA 2IFGA 2DKMA 1RZIA 1JV5B 3GSQA 5DD5H 4ORZC 3TPKA 3FNKA 3TZVC 4H2CA 1CGYA 1HWWA 1OPGL 2W0FB 2DQGL 4BFKA 4F1SA 1K8DA 3VCLA 2G75A 1O6VA 5JUEH 3QZPA 2BP8B 2W0LA 4WFED 1HHGB 4BQ6A 1A7OL 3WSQH 2ZUQC 5DUMH 1MVFA 3KL0A 2XIIA 3G9AB 1SHXA 1ZJAA 5EOTB 3EFFA 3JWOL 1K9TA 3R06A 4DGYH 4X7FC 5C0BD 1U8IB 2XZAL 5BMPA 4GRMB 1VB9A 2CIIB 4PRHB 4NO5B 5CCGE 3MRBA 1QN5A 1NGYB 4GSUA 3WIHA 3WNMA 4AYMC 3QDME 1PSKL 4JY6B 1KIPB 1VA9A 4Z3JA 3P3RA 1RV6X 3LEXA 1MOEA 5FO9B 4OR1A 1NFDA 4R0LA 1DTUA 2F0CA 4P9HL 4FLQA 3T0XA 5EU6D 2MOQA 3PFQA 1I8LC 5ITBH 1L7TL 3KS0J 1HEZA 3DX8A 4F33A 2NT1A 1UOVA 4M7JH 3MGTA 4P2AA 1JPGB 1S7SA 5C0ND 5E4EC 1UASA 3ARBD 3MRHB 1NUFA 1AS8A 5AKTA 3RVVC 3TIDA 4KPHH 4X9HA 4PJXB 1YNKH 3AY2A 4LARL 4XPTH 2QVMA 2MHAB 1PZBA 3ROLB 3U1SL 4D0BB 3SBPA 3KM2A 1RK1A 5C09E 1VGKB 5AOMA 3GLDA 2BY1A 4B5ZA 2NSXA 1HXMB 2YD0A 4JGMA 5H94A 1Q9UA 1R3LA 2AW2A 3BSHA 2J55A 4OFQA 2DQTL 1I1AA 2YXMA 4TYUA 4E9TA 3SYPA 4DSYA 4HIEA 5IM7B 3DX7A 3FB8A 2VDOB 3GSNB 3BVNB 1D5ZB 4M6NH 2EDTA 2EXTA 1R3KA 4AW4A 2WUCH 3FO1B 5D1QB 1A4KB 5HDRA 4HJSA 4EN3C 2WMPB 3UO1H 3B4NA 1GR7A 4XVSL 2YPVH 3GDCA 4G9DA 4GAJH 4AENA 2R0LH 2MNUA 3VM7A 3BISA 4U3HA 3F00A 4GUOA 1CTMA 4JGNA 1LVEA 1F58L 2ISDA 4YPGB 3WYRA 1Z3GL 2YD4A 3ARFD 3FOMB 2XQ0A 3VD9A 4GAFB 5J6GA 3MRCA 3MZGB 1BIIA 4PQXA 5IB1B 3FH5A 2BDNH 3RU8L 1NCAL 3OKKA 2FL5A 3MRKB 1T3FB 4XMXA 1QFOA 4KGLA 2ERJB 2MKWA 5B4MC 2H9GB 2NZIA 1AQKH 1BX2B 2R0KL 3QYNA 3I2CH 4L37A 5IHBA 1KJVB 1G0XA 4OGQC 3FB7B 3GO1L 5I1JH 3X11B 5IROC 3TM6A 2BIMA 2IXQB 1ZLWK 3VI4A 1ETZA 4ALAL 3WUWA 4IGBB 2X87A 1N7ML 3PXHA 4W6WB 2NY5L 1SBSH 2OJ1A 2X42A 3PPSA 1IAMA 3CZGA 3WGVB 5KYXB 2AXJA 4W9CC 3SBRA 2IANE 5GS1B 1ASPA 4NKOA 2FT6A 4M8RA 5IJVA 4FMVA 5C3TA 3O8XD 2HVKA 1OLLA 2H0EA 3OKNA 4B9CA 1EHKB 4KRMB 1J48A 1K4DA 3KYMB 1KFGA 2WSDA 4HKXB 4M61B 5FXCH 4J8QA 4LPYA 5KEZA 3IVKA 2RH0A 3D18B 3CW7A 2P28B 4QCIB 4EALA 5IHUL 1DQIA 4CC4A 2MPVA 2KT6A 4MMZB 1S7VA 1W6WA 1UCTA 1WCBA 4YDLC 1OB0A 4TSCH 3IMUA 3WUWB 1FC2D 5TQ2L 4JQVA 4M9PA 3B9KD 4Z7OB 4U6YA 3QIWD 4DQOL 1G9NL 1RU9L 1BX2A 35C8H 5LBSL 1IUZA 2ZAHA 4BDVA 1ZHLA 4DHLA 4YXKL 2EIZB 2Z64C 3RGBA 2CUIA 4FXGA 4Y2NA 4AK1A 3B9DA 3IRCA 1ZXKA 3SGDH 4B96A 2JV6A 2IAMB 4DK6A 2QHRL 2AK4D 3VFRB 2IC2A 5BZWB 4HPYL 3QJHB 1TOXA 5AB1A 3QEUA 3EHBC 4FFYA 4ELDA 3ABMB 3BP7A 3DK2A 3HI5L 1EVUA 3GIVB 4NCC1 3TH4T 4KZEH 4Q9QL 3ARGA 1DBKH 3BP7B 3T5WA 2A77H 2H2SD 2W8CA 5HHQB 3HBGA 4YIQB 5GZNA 4F9LA 3NRQA 3DPTA 2WTRA 3HIZA 4FS0A 5L2KD 4LOVA 3DXAA 1EANA 3GSNA 4KKLC 2B1AH 4JKWA 1NSNL 4J6IA 1XF4A 1KB3A 3ABKB 4LSVH 1IGMH 5I1AA 5FW8A 5GS0D 5MP6L 5MEQA 3CLEH 2GG1A 3PHAA 1WWWX 2AKRB 5FK9B 1D6EB 2ADGA 2R23A 5E99H 3QHZH 5EO0B 1E2WA 3CFNA 2FO4B 3ZRSA 1ORQA 3SGJC 4HEPA 2EADA 3LRGA 2X4OB 1LO2L 2DM7A 2XQYK 2L7JA 1UYWH 1EXUB 3OJDA 1E0OB 3OJVC 4WFFE 3B3BA 1FL3A 4HISA 1A7QL 4N28A 1OGAD 3HI1A 1IE5A 4YDKL 3AQYA 4LBAA 3GMOA 5FA3B 5DVLA 2A77L 2BP0A 2YRBA 4NLHA 4OSUL 1RFDH 4Y4HD 3O2DA 2Y7NA 3TN0A 3DDFA 1OCZB 3FC8A 4TQ8A 3D8MA 1B90A 2EP6A 3Q8BA 1DZBA 3P0VH 3P0GB 3BN9C 5ICYB 2HX7A 3OKNB 5FM5M 1ES0B 3KPSA 1OARL 4Q58C 4PS7A 3F58H 3H42H 5HHOA 4AY0A 1CLYH 3FU5A 2JFCA 2QKIC 5I0YA 3DX2A 2XPGA 5KSVB 5KYXA 4ZAKA 4NPYA 3ZTJG 2QSQA 4WW2C 5I0WA 1BQRA 1MHCB 1J1XH 1CFQA 1TIUA 1VJSA 1ZHBA 4KUCF 4M5YH 4MA8H 4M8VA 4R26H 4YHLH 3WMPA 3FU7B 2XXFA 4JPVL 3ZL4L 1R4XA 4R0LC 2JQZA 5D1ZC 5E2VH 3KPNA 3VXUA 4F7KA 3F7VA 5D6CA 1YY8A 4E9SA 4A6YH 2BNRD 3KPLB 1DBML 3KXFA 4XMVA 2BNUA 3MU3A 1INDH 2EEXA 1L9TA 5DJZB 3MCYA 5J3HC 1MF2L 5FEBA 5B8CA 3A67L 3KL3A 2YC1B 5FGBA 1R5IA 2KYIA 3QUYB 3CVBA 2VSDA 3RNKB 4J3OD 5T5NG 2N0MA 4I1RA 4XPHH 2DM3A 2DIEA 5J6GB 1QYGH 4KUZH 2K3HA 2ADFL 4JFWA 3QQ3B 2CDEA 1HL8A 4EIBA 3WHE0 3EAYA 1I7TA 3SGJA 2VXTH 1F56A 3ZE1E 1U58B 3REVB 1XXDC 3L17A 3D50A 3M8OL 2AEPL 2Y06L 4ILDA 2FATL 5IOKA 2R29A 5GS0L 5T3ZL 5DS1A 1CN4A 5TPWH 2DMHA 2KS0A 4JHWH 1ZWIB 1TCRB 2KH2B 2XQYA 3QJXA 3HZ3A 5EULV 3L45A 2VXQL 5GZND 2K1MA 1T7VA 1UZ8B 3ISWA 1OT2A 1M53A 1BMZA 1HX0A 3PJSB 1TLKA 1NBVL 1XR8A 1PVHA 3D12B 1NAMB 3T77B 1KCKA 5CFAA 4F9PC 4NUQA 3MQIA 3SE4A 3QDGB 4KUZL 3BP6A 2H1LM 3FH7A 1GGCH 2DF3A 2IFFL 3H4HA 3RA7L 4BQCA 2W94A 2BMKB 1TZHB 3IJEB 4MRBA 3KLLA 3D85B 2DEWX 3CIQA 5J9PB 1UJ3C 3OHXA 2W9EL 4X4XB 2W0PA 1FCCA 3H0TA 1GAFL 1E5UI 5CJQL 1NANH 3W37A 1L6XA 3U2SB 1TMQA 3ZHNA 2FATH 3MXWL 4Q2ZB 1WICA 4U2YA 4R0LB 4FQXA 3QO0B 4OTXL 4MXWH 3BOVA 3U46A 4X98A 3SE9H 4YJZL 4Z7VA 1PLCA 4N86A 1B4LA 4JRYD 3UEZA 2XTJB 5HVHB 2GTZA 4G9FD 1A1OB 5IK3B 3A4FA 1BFOB 3D07A 1DQTA 3MJ9A 1E8WA 2XN2A 3MO1A 3VG0H 3I6KA 3MBEB 4MZIA 4AM0Q 4POYA 1DUYA 5EU4A 4Y8DC 1NGQH 2HKFL 3HMXL 3CH8A 3GMLB 5GJTH 3U4BL 2CHZA 3N44B 3HTLX 4HMCA 1F3DH 2O6CA 2CWRA 5CR1A 3V0AC 1NKGA 3EBGA 3APCA 5HGBA 3O11A 4NRYB 1A6WL 2W9EH 1J10A 4LCCA 5CN1A 4YHML 3QFDA 5EIVA 2EUVA 3DRTA 3O8XA 2OSYA 1NBVH 4YN3A 4CU8A 3NJKA 1USZA 3E6FB 4L3AA 2FT8A 2PO6B 4MDJA 3SQBB 2BSRA 1EUTA 1A3ZA 1S8DA 3NZ8A 1OK8A 3DSFL 4JDTH 1JERA 4Z1PA 4E41B 3BXNA 1RVFH 4A2LA 3LOWA 5ABAA 3KPPA 3CQQA 2OMYA 3DBSA 3U0PA 1YJDH 4EN3B 1OGAB 1PF3A 3DROA 1ZK5A 2R0WH 3LDBC 4W68A 3WXWL 2B8OT 1H3TA 1J5CA 2E4FA 2AQPA 3Q5YA 2BVUA 3QZLA 3DYPA 3SE9L 2AZUA 4ELMA 1EFXB 5GRVK 1KJ3H 3ATFA 2FQEA 3BO8B 2EDNA 4GRWF 1RJCA 3DUUB 1BECA 5TQ0L 1ZOXA 4PUBL 2QPEB 4EIZC 4M43H 2FRGP 4LF3B 4FQXC 4KI5C 3FUIA 3VI3F 2D0CA 4WV1B 3S36X 3UJJH 2IBGA 5DRZB 3V5KA 1IC5H 5JW3L 4XWGL 1FRGH 4I2XA 5BW7C 2PCFB 1ZHKA 5JNYA 5HYJB 3D4ZA 1M9WA 1P4LA 1SHMA 3QZWA 4AMXA 2APBA 3VM5A 3B9EA 3LS5L 3VSQA 1HIMH 4RGND 3RDTC 4ESKA 1W72B 3MSPA 3JYCA 4APQB 3DC0A 2X3BA 1RAMA 4GRWB 4CJ1A 3QORD 1H15A 2J44A 3WY3A 1KTJA 4ODWB 1IFRA 5LQBL 3D69B 4LVNC 1VGKA 1XGYH 2AXFB 2OULB 3U4KA 3MJ6A 1NKRA 1AZUA 3RVTC 1N8OE 1YQVL 4OV6F 5EBWB 2HRPL 4X7SH 5D5MB 5CJBA 4LSPH 2W1NA 4XAKE 5B39B 1CF8L 3BPOB 2BHUA 2PCFA 3UJJL 4LCWE 4PJFB 1F0LA 1CQKA 3RIAK 4FA6A 3BKQX 3F5WA 3WUZA 4N9GA 2Q8BH 3UYPA 3FQNA 3NDYE 4E9LA 4JO3L 2VLMD 2LTQB 1BZ7B 5IQNA 2OTUB 4JO5A 3K71A 1BAFH 3HE7A 2J88L 2FH6A 2TSAA 1GRWA 1HC1A 5JYLA 2LT9A 5MENE 2M26A 3CLFH 8CGTA 2DKSA 3TZVB 3VFSB 3ARWA 2L7UA 2CGYA 4AL8C 2WLLA 1RZKH 3LEVL 1JP5A 5CP3A 5JIHA 1KBPA 3U6XA 2PMZA 3DV4B 3RPJA 1XGYL 3R06B 5E9DA 2LGNA 2KLTA 1KXQE 4LKCB 3K72B 4GKNA 5JIMA 4YK4B 2FIKB 3RKDD 3ULVE 2GJZA 1ZA6B 1S9WB 2NTFB 3NFPA 3NZ8B 3FTZA 4L8DB 4PJAB 4B9JA 4E9VA 4OKVA 1GCFA 1X5HA 3KW7A 5F88A 2VABB 4S0HA 1GYUA 4GQPH 4DUVA 4XCFH 1VACB 4CC0A 1E3FA 1QFUL 3LSOA 4GY4A 4YDKH 5BS0D 3CC1A 4Y5VC 1JJUA 3QR2A 3QQDB 3ZTJH 4KKCC 4KC3B 2OYPA 1BCIA 3D0VA 1X7TA 4MHHI 3UTTB 5B3NA 3V5DB 4GBXA 4R97B 3QEHB 1X5XA 1LWJA 4BK5C 1CFNB 4NNXB 3EYUH 1YQ2A 3LXBA 4KVNL 1E4KC 1OIOA 4A37A 1Y1DA 1H0DB 3MZTA 3I9IA 4OGAC 3UTPD 1KN2L 4JFDB 2WCGA 1DUYB 2XN9D 1MNNA 4ONHA 3VRLE 3SDYL 1FJ1A 2JCCE 4ZAKC 4HK0A 5FFOA 2CLZA 3PL6C 1SF5A 5CGTA 3RBSA 4YSUA 3IGKA 1O5PA 1FE8L 2CLRA 3QW9A 2AK4B 3HC4H 1MCHA 1RU9H 35C8L 3ARPA 2ZPKH 4HWNA 2BWDA 2F08A 3GI8H 4PJDB 2TAAA 4QRFA 4X99A 2R2EA 4NPJA 3W5MA 1CZ8L 4WRLA 4N9GB 1U8CB 1XX9C 4LASH 2OXHA 2JB6A 1X5ZA 3IB4A 4YSAA 3NJIA 1CD8A 2ZJSH 1LO5A 3V6ZB 1G4MA 3RI5K 1MG2C 4A63A 3K4DA 1ZS8A 5MENA 3JSSA 1B88A 4GG8B 1F4XH 1P1VA 4MA3B 2DL9A 4CGUB 4G7SB 4DGIL 3QA3A 3VD0A 2VDPL 4U1SB 1UM5L 2XKNA 4PJ5A 4NKQB 4XOCA 4NFBA 3I02A 2BOCA 4HJEA 3NCYS 4DH2A 3ZDZE 3J27A 3ZHLA 1I9RH 2J20A 4NYLB 2XWXA 4LCWA 4MJ2A 4M1CC 4KITB 1O6SA 4NZTH 2A74A 3N3EA 3OAWA 4P23A 2VUOA 3FRPA 5JN5A 4WWKA 3TVMB 1MLBA 4QRPD 4FQQB 4HCGA 2AXGA 4YHOL 4F3FA 2F58H 3FQXA 5FGCB 2AV1A 2V17L 4UQ2B 4YFLI 5FYKH 3TJEH 1BP3B 2JHJA 1N2RB 2P46B 5AOJA 2WZPA 3B7RL 1IJNA 2LE9A 3N1GC 4J4PD 4FYRA 1D5MB 4RMSA 2NZ9D 4ISVA 1CXLA 4V2BA 3G9VA 2AQTA 2ENPA 3MFGB 2F7PA 3MRMA 1GZQB 2CK0L 4DN4L 1KCRH 1QFWI 2Q2EB 4DGIH 1MWAB 5HYJE 3FW6A 1S9XB 1OPOA 1PJ9A 1SLWA 5DHYB 4B6ZA 4CBPA 3E1ZA 1JZ4A 3VG9B 2ITDB 1INEH 3X1NA 2OTPA 3N50A 1XCWA 4XMWA 3VGEA 2KQNA 5DHDA 5HGGS 5EZLA 3QJOA 1P5VA 3AG4B 5EG6C 4YNYA 4KTGA 5F96H 4L5FE 5JHBA 4WHYG 1LDSA 4PCYA 3U2IA 2CMRH 5EV7A 2OMWA 2IANB 3O6FB 5E6IA 4BZ2H 4AL8H 3F2LA 4R4ND 3F6LA 2VR4A 3UPAA 2XFGB 4ELME 1RJLA 2A4ZA 1F02I 3EOBA 3HMWL 3US0A 4WJKB 3SOBH 3VFPB 4MCNA 4IYKA 1ES0A 5J1AA 5GS2D 3KPRE 4CKVX 1KXVA 4OCRL 5HVFB 1MHPL 1ETA1 3QFDB 5L4FA 5ADOL 4ZFFA 1X9QA 3APMA 1A4CA 1JZFA 3GM0A 4IBYA 2P5WD 3B5TA 3NSYA 4LPXA 5K59E 1BGXH 4YVUA 2BCKB 1Q9LB 2EDOA 3ZDYB 1ZD6A 3R7QA 5B38A 3BDYL 3ZGHA 3O6LH 1KJMB 4YHIB 2BC4B 3EYVB 3NPSC 2UX7A 4X6BB 4GG6A 1Q94A 1TSHA 2BXYA 2J3SA 4LOUD 1LGVA 1BFOA 1NWOA 4UF7C 5JQHC 3IFOA 3GEFA 4NC1C 5G4NA 2EC9T 1AKJD 1I9IL 1PJWA 2YAEA 4F91B 3RB7A 4GEIA 1WEJH 3DO7B 3TN0C 4FFZH 3CIAA 5DLML 2BSSB 1KG0A 2NX5B 2GJPA 3KWWA 4XN7A 3G5XB 4K7FA 1DDHA 5I8OL 1A9VA 4HKBB 5AW2B 3VXRD 1VESA 2FO1A 3S98A 1ED3A 2YRZA 3LN4A 1QFWM 3RTLA 2APSA 2HMID 2GUYA 2WQSA 3UP6A 2JTDA 1KCVL 1CFVL 2JJWA 3BD5A 3CDCA 5DK3A 4F58H 5J9PA 4Y5YB 3EFOB 5AW0B 3R4DA 2FT7A 2A9BA 4QRTB 5HI4D 1G7IA 3C8KA 2H6OA 4UQDA 4J3UA 3KAAA 1FH2A 1AGBB 4ECNA 2ERJC 3TESA 2WLIB 2IDFA 4P2OA 3V4LA 1FHGA 2ICWJ 4NUGL 5IVOA 3L3GB 5KVEE 15C8H 1ZV2A 3CMOH 5IMLB 4YE0A 2A4CA 3CN3A 4ZW3A 2CXKA 4I48A 3L3OA 2X4UA 5D2LB 4G8EA 3FFCB 2P3YA 3QG6B 1OM3H 2KUTA 1MAJA 2R2HA 4A38A 4R96A 3DUSA 1QBLH 2NW2A 4QWWD 5TDOA 4K3JH 4PLOB 1A3LH 4WK4B 3EYOA 5KAQG 1JYXA 4XX5A 1KCUH 2VQUA 4A7VA 2GQHA 4YBQD 4EO5A 2RCSH 1KV7A 1M7XA 4OFPA 1J8HE 3CHSA 4PJBA 1HXKA 4FFZA 3ZBMA 1N0LA 1A7BA 3WEAA 4FQIH 4HOMA 2K6YA 5C1MB 4PJBB 1P7QB 5D1XD 4OJYA 1NDGA 2ZX7A 2MJ7A 3T09A 1HSAA 4RSVA 4MNHB 3FCTB 5KTEL 1OZTG 3DX0A 1QSEB 3OKYA 4LPTA 5CEYB 3V4VL 4UAOC 3TEXA 2VDRB 3LKSA 3PGFL 4L23A 4PGBA 1A1MB 5EU3A 4A67A 4M1CD 2DD8L 2QVTA 1RERA 3UPCA 1WV7T 2OFQA 2Y7MA 1IE4A 3L08A 4Y5XC 4N26A 5CP7A 2ZXEB 1A0QH 3PWJA 1KEGH 1U0QA 3CFBA 3D7PA 5C0AA 4WCYL 2V0AA 1SOXA 1LEKA 5AZ2L 2F1AA 3HS0B 3CFJA 5EA0H 3NIFB 3U9UB 2FK9A 1J9RA 2NX5D 3KS0H 1B0RB 1Q9WB 2HZSA 3E8UL 4J1UA 1BZ9A 3QFJD 3O3BA 5FGCE 3KYOA 4PMEA 4DF9A 1SY6A 5EOCH 2EIKB 4Y5YA 2WZ6A 1QZNA 4QTHB 4PGDB 4LU5L 1HU0A 4WO0A 5DUBB 1T4KA 2MIZA 3HJEA 2D31A 1CDBA 4IJTA 1S7WB 4UV4H 2EICA 2ZSVA 1IAIH 2WUBL 4RLDA 4YL4A 1T1YB 3OZ9L 4TNWK 3RHWF 4P05A 2DD8H 2VISB 4KAQL 1C08A 3HRZC 1DBBH 1ZLDA 3RWGB 3TXAA 4ZZFA 1PZSA 1HJBC 5JW4Q 4ZS6C 5B4MD 3RWGA 2WWKT 3IFOB 4PRIB 4EPSA 3CHXA 4P5TC 1T0NB 2BVOB 1RZ7H 4B9YA 4W9KC 2CPUA 4KKBD 4P5MA 4PJ8A 1PTZA 4WU5A 5I18L 3Q8CA 3LYRA 4ODHL 1FGVL 5GGQL 5FLUA 5DUBA 5HDOA 4HWEH 2EKSA 2DW5A 1AO7A 5KANG 4GB9A 4JO8A 1ZGLA 1BEYH 3PDOA 5DVKA 5I9QB 4ZS7L 3IXAB 5B21A 2YN5A 1BZ9B 2WXFA 2ZT9C 4PRNB 3JWNC 5FM4A 3MR9B 2B5IB 2NW2B 2O5ZH 1BVZA 3UJIH 1JHKL 2AEIT 2X7LA 2FE0A 3GWJA 3FT4A 1TQSA 4RAHA 2PWWA 5HHXL 3RWIB 3WFCL 1AGCB 3KWUA 4L3EE 1IFGA 1YRKA 1ZAGA 4IOIB 1LO3L 4N20A 2KZBA 3PFUA 3T2NH 4R2GC 2QKIB 4UQ9A 1KXTB 3CFDB 3HBQA 3M17A 1T66D 4UILH 3LZOA 5HJBA 4KK9D 4IRZL 3FSAA 4AEFA 1QSEA 1VDGA 4HQQH 3O3EA 3DI2B 4QF1B 3UW2A 1Z0MA 1LWVA 2AJZA 1MAMH 4KZCA 3EFDH 4OQTA 2G9KA 5K9OA 2AJXL 3A5VA 4X9GA 1GZQA 4JPQA 1QN4A 3GXIA 4QRSB 4H40A 4ONOA 3FUEA 3KDMB 4X80H 4EUPH 1Z9PA 3OB8A 5CMAB 4Z8FL 4IMKC 1MCIA 2DQEL 1N2RA 3R0NA 1HI6A 4Q11A 2NNFA 5KYWA 3WJLC 2YHGA 4QHNB 2V8LA 3L9EA 4HWEL 4OZHF 2G60H 1KJ2L 3BVXA 3C8HA 3V0HA 2ZWKA 3P4NA 2C4FU 2QV2A 2G75B 4PW9A 1MZZA 4NGHL 4XNYL 4GIAA 2JKNA 1RUPH 1SZNA 1KFAL 4ZQKB 1QFPA 1RURL 1KACB 4LQFH 4Y2DB 4WU7B 3AXLA 1AZRA 3JXAA 1NFIB 4ZFFB 1A4AA 1ETZB 4FFWD 3FZUC 5MENB 3GS0A 1KC5L 4WEBH 5HY9A 2J4WL 1BQLH 2F19H 4ZTEA 4ELKB 1S9VA 3EKCA 2CALA 4XH2B 1C5CL 4DWHA 2JB6B 4IGBC 2XETA 4GP8B 3KPRA 1NCJA 4BZ2L 3N1MC 3GB7B 4TNGA 5E8EB 4IRJC 5IQOA 4ROCB 25C8L 4ZBJA 2CDGA 3NFSL 3SGDI 3W9EA 4XNZB 4MQ7A 2F53B 2LAGB 3EOTH 3IBEA 4IL8A 2XZCH 4PP2B 3Q8AA 1OAXL 5DD3L 2CAKA 1ILUA 4PW3A 5IWLA 3CVSA 3Q2NA 4HIHA 2XI9A 1JG9A 1HOCA 2O6DA 3QO1A 4XB3A 1G1CA 3BGFC 2Y36H 4CNIA 3IDXH 4GSQA 1L9MA 3IJ8A 4LT7A 1HNFA 2EECA 1FFTB 2WO4A 5HGDB 5DEFA 5ESVA 1Q9KA 4DUXA 1ZSHA 2BX5A 3CZUB 4QI3A 3ZE1F 3OGCA 4G8GA 2IPKB 1BWMA 5ACZB 2FNWA 4Z3HA 3TURA 3T3MB 2C9AA 1XGRA 1Z9MA 5DWPA 3WKMH 4P3CH 4MSWB 1A1NB 1UUSA 3PY9A 3B2DC 4WNQA 3CHOA 3CSGA 4GBXC 3NSJA 3QI9B 4PYHA 1ZVHA 3QULB 4L3CB 1XTLA 3DWTA 5BRZE 1YEFH 1QNZH 3JWOH 3UG5A 4H8PA 1W0WB 1D5BB 1L0QA 1AP2A 3TC9A 2HT4C 1V7MH 2QVFB 1UACH 5LGJB 1OE2A 1KGCD 3QIUC 3OJ2C 1U4FA 3K72A 4GAAA 4HAGA 4OCWH 1SXSA 1U8OA 1PX8A 5EZLB 4JFVA 3FFCE 4LL9A 3UABA 3HPLB 4HUUA 1J5HA 4F33B 2FO8A 4MA3A 5EF2A 3DX9B 4ZDHA 1MRDL 2YMOA 2K7QA 3EZJB 3FAWA 3QI9C 5C8JB 4Z7OE 2DQDH 4WSJA 2ZP9A 5F70A 1J1PL 4HJ0D 3FT2B 4PP1D 5DJXB 2X10A 3LDBB 3LPFA 1JMXA 4N22A 2V2XB 1MZYA 1U8CA 4Y88A 5JOPD 1JGDB 5E94A 3QFJA 3MRBB 2R2EB 1SVCP 2ZXCA 3O4OB 5SWSD 5IMKA 3RVUC 2AK1H 2C9PA 4RWHA 4IDJH 5A2AA 4I77L 3RSMA 2HH0L 3T0EE 4XOAA 3ZE0B 2YKLH 3QHTC 4G83A 4IBSA 1S3RA 3DGGA 4WDIA 4KQ0A 2LU5A 2FVNA 5CEZH 3HCVA 2VIRA 3C2AH 1AD9B 4NN7B 3LTVA 3WGUB 2H3NB 1FDLL 3FJTA 5CINL 3S5LG 1SJEA 3WIIH 9PCYA 4D7BA 4UWQB 4J3OC 2W0FA 5FYJD 1RHHB 2EH7L 1PG7H 3JV5A 3QFGA 4B27A 1U8JB 2D0BA 4J27A 4FZEL 2XWBA 3DX1A 1ZLSH 1OP5H 1HCFX 4PCSA 1UQSA 1H3PL 5DJAB 3FQUA 3VX0A 1MPAL 2QPUA 3PDDA 4P23D 3OH9A 4YQXH 4GO9A 2DL2A 1YEGL 1CE1H 1CTNA 3O41B 3POHA 4LOEA 2PWDA 5DU7A 3D4CA 5BO1H 2OL3A 1LO5B 3S5YA 3EJZD 4QXWA 3TFKD 2CKNA 4DGUA 5K93A 5IBLD 3LH2L 2CBPA 3PLYA 4F2FA 1X44A 4TQEL 4TVPH 2ICEC 4JG1L 2WP3O 1YEJH 4ADIA 1FIGL 1WZ1L 5F71A 4W9IC 4UT6H 4X6FA 3DVNB 3V6OC 5D93B 1MVUA 1ZEAH 5EBMA 5DD1H 2QSVA 3MJ9L 5CM1A 3T6XA 2YAMA 4UQIM 3CWSA 3CV5A 4NNYA 3N89A 4L8SA 2ARJB 1T5KA 2E8YA 2JJTA 4F37K 1O7SA 4ONHB 4BKTC 5IMMB 1QR1B 1B9KA 4MS8C 1P7KA 1T2JA 1UM4L 1V10A 1AXTH 2L7EA 4EI5C 5HDBE 4FABH 4NJ9H 4A7TA 4Z7WA 3VXNB 5AOLA 4DP7X 1VFAB 3ZKMC 4NRZA 2LV4A 5DZVA 2PO6A 1G0YR 3SQBA 3P2BA 1P6FA 3CBJB 4PJGA 2GUOB 5FDWB 3LSOB 4QTIH 3QB7C 4YK4C 2CO6A 2DBJA 4KQ3H 3VXRA 1IGIL 2D7PA 1ET8A 2ZD0A 4JKMA 3BZEB 1NIBA 1NMBH 1CQYA 5BO1L 4FQCL 5JOFB 2E7LC 1KDJA 4ZXBA 2CJSA 1P69B 2WVVA 4JN1H 4F2EA 2VIRB 4MNQD 4LSQH 4AH2A 3EH2A 3KW8A 2WLNA 4XNUL 1BEYL 2IO5A 1ACYH 1IVLA 1L4IA 5JW4R 4X6DA 3NCJL 1L6PA 3MO1B 3EHBD 4G1MB 4R97C 4Z7UF 1JGDA 3WN5A 4AJ0A 3VFSA 4KBPA 4PBDA 5HDQH 1DQKA 3TO4D 5DD0H 4GH7B 1KGUA 2JOIA 1K4CA 3RY6A 1HK6A 5JHLA 1T89A 4N85A 4ZMYA 4FTVB 3BEWA 2H0FA 1YN6A 3CFKB 4M1GH 2G9HB 4TQIA 4I2XE 3VTAA 4PMFA 4KKLD 2OJEB 5IYBP 4E0RA 3ARQA 2V9UA 3GRBA 4Y2OA 5D93C 3K7UA 5CEZD 1R24B 3O6KL 3OHXB 3NCMA 1LP9A 5KJRH 1KIQB 1FFOB 4KZEL 4MZ3A 4QYOB 4K23H 3T6ZA 4BUGA 4MJ6A 4NQVA 5I2IB 3RPIB 3BEVB 2Z8RA 4XCEA 3IGUA 2K9UA 5LJYH 1TBPA 1EQWA 1F4YL 3QG7L 4TUKL 2AJYH 2PXYB 4F20A 5GGVY 5I6LA 5DTFA 4G6MH 3W3BA 2QR0A 1TKWA 3T3PB 4JFEE 1N3NB 3MR9A 3RIAF 2YMTA 4PJIE 3N42B 3WY2A 4FFVC 4PRBA 5D2NA 4N0YH 4HGWB 4U1MB 1UH4A 4URTB 5FFLA 1NA8A 1OSPL 4PRDB 4DP2X 1FL5B 2DJUA 4P2CG 1EJ6A 5EEWA 3WS6C 2QDWA 4ZQKA 3E6FA 3QJQB 5DVNA 1TEGA 5DEFB 5JW4N 3GYRA 4MAUH 1TZGH 3L3HB 4P49A 1LWWA 1ND0B 3PHOB 1X7QA 3QORA 4JFZH 1JV2A 4IDLA 4RGNC 1LWHA 4LCCB 2J8HA 4XPBH 1XIWB 3CFEB 1X5GA 4LF3A 3AWEA 4K23L 4R5XA 3QQ3A 1L0YA 3QC5X 2R0ZH 5G5DB 2UXTA 3BGFB 3BO8A 3E38A 5E51A 3SKNA 3T1WA 2ATKB 2PWGA 4LVHB 1RUML 1S6NA 2DYSB 1BZOA 1EAOA 1TZOA 2AQSA 2EILB 2FX8L 1PZ5A 4FZ8L 1M2OA 4BCYA 1M3QA 4Q7DA 2FEEL 3IXTB 5AYUH 4DP4X 1FG9C 2ZFDB 1NUNB 4APQC 1A14H 1OARH 2GK0A 3L9YA 4R4BA 1I1AC 4Z7VB 4IMLB 3CX5J 4TQPA 2ZUWA 5IREA 1F4YH 3OZKA 1G43A 1G84A 4XAWH 1KB9J 1KIUA 1DJZA 3LCYA 2UWEB 3HG0A 2NUPB 2ILLA 4IHBA 2C7FA 5DMJB 4KI5E 4Y4FC 2N7AA 2Z7WA 5I15L 1DYZA 5DHEA 5EORL 3ALPA 5A2IH 1EJOH 2OCFD 5LBSH 3NIFF 4FQLH 1FZKB 1J18A 3M88A 5D2NE 2HL8A 1QBAA 5I8CB 1TZHA 2P4AB 2UZXB 3CPLA 1MI5D 1TJHH 1WPCA 1KIRB 1BPVA 3QP3A 4CSSA 1IBGL 1J5DA 4O2EA 5EU3B 2QZ5A 2LHAA 2Y24A 1KB5B 5IJKA 3S34L 4XGZB 4EBQL 2IVFC 1FP5A 1VIWA 1CI3M 5CZKA 4DK5A 1QFUH 2GITB 5EN2B 2R7EA 3ABLB 4OAWB 4YC2C 5EC2B 1GYWA 3U4EB 3W81A 5FKAA 1VOLB 1MRFH 4LHUB 1DQLL 2F5AH 3GMNA 5HYSB 2O61A 2V8MA 1AR1B 4PSRA 1MFAH 1KT2B 3KPMB 4TTDC 5DZLA 4MDIA 2GBVA 5LCVA 2IG2H 3I75B 1UT4A 2WWMD 5F7EH 5IYDP 3D5OF 4UIMB 4DP1X 3VFGH 2V3FA 1U3YA 1HINH 1D9KD 1N10A 1XIWC 5TDOB 3VFTB 5EEZA 1MY5A 2YPLD 1OAKH 2O5XL 3F6JA 2EUWA 4JRXB 2B0SL 1XF4B 3BKYH 3VFVA 4N2OA 2OI9C 1CXEA 1EAPB 3IJEA 5ES4B 4X6DE 3S3PA 5I76B 2VISA 2FGWL 3QUYA 4FN0A 5CN3A 3DOSA 2VDMB 1O9WA 2OX5A 4HJJL 3QXAB 3LY6A 1CYGA 3N41F 5ALCH 3TONA 1DANU 1NUGA 3GBDA 4P4KB 5IIEB 1WQAA 2F7OA 3BP5A 4JZNB 2Y25A 4PJEF 5TE7L 4N6QA 4XXCC 3DX3A 3US9A 4BFOA 2FX9H 5CKAA 1ZWIA 3F7LA 1P5UA 3K2KA 3NCFB 4QIRA 5IVZA 1A6UH 4UQCA 3PF2A 4UQ3A 1OAJA 1MFVA 3T8XB 5EZIL 2EKSB 1C4GA 3U9UA 2OR7A 3HS0A 4Z18A 5F7YC 3UP1A 4E41E 5CBAA 5C07A 1CDHA 1I4FB 4CVWA 4Q6KA 5C0NC 3FFDB 5F7UA 3HUJA 3EYFA 1FAKT 3ARDC 4IU2A 5CCJA 3EYQD 5E2WH 1A25A 2CDEB 4LRIC 4OGYL 1QLEL 3HZYB 3AG1B 4PGBB 4LLQA 5I1EL 1AQMA 1HQ4A 5INDA 4JDVB 2OR9H 3LPGA 3DX4A 5H2BB 5TFSL 3I6GB 4FRWA 2P9RA 3RWJA 3IDXL 3WNOA 4JO4H 4X9YA 4AGPA 1A6TB 2QLVB 3D7QA 3P9WB 1BQHG 4WWNA 5EZJA 2HLAB 4GAYB 4ONGL 5JMRA 1YECL 2KDYA 3T4YA 4O02H 4GW1A 4PJ9C 4MNGA 1Q1PA 3IPFA 5LLIC 1Z7JA 5INCB 2EXWD 3KYOB 1CFQB 2C4FT 2CMRL 4KKZA 2MCG1 5GZOD 3R4RA 1J5OL 5D4IA 4F5CE 3DLQR 4A39A 3AT8A 1QRNA 3C6SB 4Q4EA 4XVUC 4JL2A 3TT3H 1CI5A 3QNYA 3OSEA 3QG6A 4G8EB 1NMAL 1V8HA 4PSPA 5JOEA 1WFMA 3KCWA 2C8NA 4KMLB 2OZ4A 3T65A 4FNLH 3ZUCA 5C0DB 1XF3B 3KD4A 4YIQA 1IGML 1P4UA 3TT1H 4NZUH 5EWIL 5GISL 4KKAC 3U4AA 5D1QE 4YBHA 3IJHB 1RCYA 3OPUA 4HPHA 3H7BB 5DGRA 2VR6A 4ONGH 3WNIA 5I1CL 1H6TA 1MHPH 4UAOB 4Y4FD 1BQHA 4XVSH 1IL1A 4JNXA 3WBDA 3LKOB 4M7KH 1CU4L 1IKNC 4PJEB 5AB2A 3LRKA 2X4OA 1NCCH 1FGNH 2QRDA 2V5MA 5TFSH 4Y5XB 2XVKA 3FTUA 3QQXA 1DL7H 5I66B 1R17A 1B2WH 3P73B 3SE8L 2QADB 3CXDL 2R15A 2ZIDA 3QI9D 3GPEA 1F45A 2YD7A 4KHTH 3VWKB 1AHKA 1I7ZA 1ECYA 2RTTA 3L4VA 2NOZA 3L95A 2CCWA 1HH9B 3W9DB 3MLVH 3SCMD 2BIHA 3DX7B 1U95B 3OAUH 1OE1A 3MJ8A 1T89C 2I32A 2HKHH 2KMWA 3CU1A 2HZHA 4WI2A 1WWCA 3LV3A 4LFHG 5FUCE 2VRKA 2QR0B 4LHUG 1KB5A 5C0RH 3F01A 5HYQA 1FPTH 2XKNB 4PJ5B 1FORH 3QA3B 5ITBL 1SY6L 2V92A 5DMKA 4MAYB 4R26L 5J06A 3KYMA 4XCEB 4DGWC 1OF2A 3SSGA 1L7IH 4A2EA 3CN0A 4MJHA 2OMXB 4AI7A 2FJGB 3QUML 1DBMH 3PMGA 2OMZB 4ZOBA 2BM3A 1JRHI 1FL6B 3VFPA 3C08L 4YHMH 1O7DE 3EXJA 3MGTB 4P59H 5DURD 4FG6D 3S3DB 3EDDA 3QUHA 2J5LC 4FXGC 4UOQA 1S78D 4YXLL 4G8GE 3G5VA 1XH2A 2IANA 3O6FA 4OZGF 4AQEB 5KBLA 3WO3B 5SWSB 1UWFA 3B5HA 3BWUC 2AK4A 5E2JA 3HA0A 3MA9L 4MBRA 1FV1A 1XGTA 4XZUA 4GW4B 5DZOA 1MRCL 1A02N 5KSBE 4LEBA 1TLMA 4NO0A 5I17A 1R47A 5AOKA 4DP5X 4DEWA 4B7IA 1MIEL 2BZDA 3DURB 4HALA 1NDTA 2FBOJ 5FYKU 3UAJC 4C56D 1BA9A 5I1IL 3GLZA 3DMMA 4FKKA 1XCXA 1BJ1H 3FOMA 2A6DA 3QUZB 3B9KA 1S5HB 4XCFL 4UTAA 4XO4A 5JR1L 5ETUA 2Q10A 3UTTA 5A6MA 1A7PL 4M6MH 2D7OA 3C08H 1ZHNB 3FU3A 4MYWB 5EOQL 2QHLA 4G9DB 1ET5A 3OPZL 5FW7A 2F54E 4JY4B 5KOMC 2NY2B 4Y4KC 3EOBB 1QVOB 1RJLB 5DSCB 3IFNH 3RVTD 2D0FA 5D71L 1GC1L 3FUNA 3BWZA 3NAAH 2IXQA 2WZAA 4EDWH 4F5CA 5B7MA 3RVWD 3X11A 3VGGA 4ZX4A 3PV6A 1OAUL 3H9SD 3SDYH 1B4RA 5EPCA 4P5TD 5E9DB 3IH7A 4OCXH 2ICES 4JCLA 1TO5A 4YXLH 1CDWA 1QLFB 4KGJA 4DW2L 2ZICA 4WX8A 1PYWA 3GTTA 3QGVA 5BPPA 5DHYA 5I2IA 2G5BA 1TYRA 4NNYB 2AQNA 4FQLL 4BCZA 4KMQA 2BNRA 3KTUA 1RSYA 3T9WA 2VXUL 2HUHA 1CIUA 5EBMB 3E80A 3GTNA 4GXFA 3N91A 4XO3A 4LSPL 1FH5L 3JV6A 5E9AA 2DLTA 3Q01A 4KTDH 1M7UA 1GGBH 2XZZA 3RRQA 3UZEC 1NM9A 4WFHD 4UQ2A 3ZIYA 3ZE1B 4FNPA 1COBA 3KPSD 5HHOD 4ZFOB 5C6TL 4I89A 4OF7A 4P46B 4QAWA 5HHMD 5C97A 3FRPB 4TSCL 3GXMA 4KXAA 1YEIH 4G1MA 3WN5B 2F7LA 1FJ1B 3BQUC 1MFAL 2AXFA 4YBLC 5H8DA 2DLFH 3ES6B 3MRQB 3EH4B 2IWFA 3PHQB 1JUFB 2HTKC 1BSIA 2JJVA 3QE5A 1HINL 2BP5M 1JUFA 4MQXC 3S37X 1HHJB 5A3IC 2OK0L 1NCTA 2FBRA 3NZHH 3T0EB 5KW9L 5DGQA 4Z23A 2NXYC 3NEOA 1FNLA 4W93A 1ZLVH 4V1DA 1AD9A 3W1ZA 1N68A 3U0TA 4DVRH 2ZG3A 1T0PB 2QMJA 1I1AD 3WG7B 8PAZA 2CD0A 3RWEA 1CVSC 1E65A 1A9BA 4MNGE 2MRYA 1VTOA 3ZMEA 3JWNE 3P54A 2HKAA 4PWEA 4OU3A 1DQJB 3U30B 4DGVH 4ZUSA 4XE0A 1MFEH 2IEPA 4HUVA 2D2CC 4NQCD 3G5ZA 3A4EA 4Q56A 4R4FL 4G70B 3HNTH 3MGOA 1DFBL 2W07A 5CKGA 4DFIA 1P6AB 1R3JA 3DIFA 1OB1A 1PX3A 4NQEA 1RSFA 3BUYB 1CXFA 4J3TA 5JORA 1TQVA 3V6FB 3EGXA 3ZE2E 5AG8A 2Z0UA 3BKJH 3R18A 4N87A 5AYUL 4PJIB 1IC4L 4NHCL 2OLDA 2EZ0D 2ZCLH 4XCYA 4XMPH 3UTPE 2XN9E 3ZRCC 5KN5A 1URLA 1G9HA 3LS5H 3II1A 3SDAA 1ZPUA 2C9VA 3JTTA 4I13B 4CFFA 3DVNA 1INQA 2JSFA 1NCOA 2OTUA 4RCAA 4X5PA 2NW3B 5C07E 4E41A 1RIVH 2JB5L 3K71B 1YEHL 1DQJA 3NIFE 1HHGA 2QQLH 2IDUA 2BP8A 2QTEA 4DCQB 2AXHA 1UXSB 1PCSA 5AUMA 2XBZA 1A3RH 2UYLB 3KRMA 1BAWA 5JMOC 4L2YA 4JHWL 4MJJA 5D5MA 4FEMA 2A9NH 3CJJA 4JFHD 2IADB 4KV5F 3VU1A 4MMXA 1OD7A 2VDQB 3T8MA 2WBJC 3QEQE 5J1TC 2NY6C 4U7KA 2V9QA 3D2UB 3MI6A 4X4MA 4YUEH 3RJDA 3K6FA 3UYOD 3AU1A 4B95C 3UBFA 5TH2B 4N3UA 1BBJA 4LCYB 4KO5A 4D9LL 2WXQA 5EIIA 1C1EH 3ULUH 2A73B 5EEYA 7FABL 4BZ1L 2V7HA 3NEEA 1HAUA 1NBZA 2NZ9C 2GBTA 4X8CA 3SBWC 5HDBB 1CLOH 3MLYH 3B1TA 2NCEA 4HV8B 4DETA 5IR1A 3KYAA 3WNPA 3TCLA 3QRGL 3K5SA 1RK0A 3GLAA 3MYZA 3SDCB 5T1KB 3IDIB 2EXYC 2CDGB 2CRMA 2DQ6A 1SEBB 2K7PA 1HNGA 2L4OA 4YGVA 5AVTB 4DKAA 2OQJB 3ZW3A 2FTAA 3WIIL 1EBPA 3QJFB 4JANB 4A7SA 2V9JA 3SN6N 4K55A 2P5PA 3ARFB 1NC2A 5FUCC 3E1F1 4FYTA 5DJ2B 1MCEA 1SF3A 4E68A 3C6LC 3FUFA 3RGVD 4P9HC 1JWMA 3H9SB 1OAXH 4R7DB 5DD3H 5E00A 1CFTA 7TAAA 5EO9A 3O4LB 5BZXA 4B0MM 5IV2A 1MCWM 3QPQC 4I9WE 4BZ1H 1MXGA 4KY1H 4WFGE 3SE3C 5ID1A 3RZCC 4GUQA 1HILB 4PV9A 5TE7H 2VQTA 1MIMH 4PRID 3A6CH 2PN5A 4NENA 2XN0A 1YTFA 2XY2A 2Z35A 5EEVA 4G7QB 2J21A 2CKBH 2H3XC 1RZPA 1N18A 3AROA 4OQTH 4HJ0C 4X7EC 3NSDA 3KVDD 4H8UA 2K4WA 2AVFA 5I74C 4J4PA 3QIBC 4HF5L 3BYTA 5C0IA 3MODH 1LWRA 4NN5C 3T4AA 5I1KH 2DYPA 4ZPVA 3THMH 3L2MA 3D4VA 5JHLL 1P6WA 1VGEH 1SXNA 4ZOEA 4CILA 3MNVA 1U91A 4OGXL 4H25A 2D4FA 2ZAIA 1DANT 1Y1UA 5E1QA 3EG9A 2OJZL 3RVXD 5E08H 1PNDA 4YHZL 3RA7H 5K9OB 4Y1AD 2P5WB 3NN8B 2QV4A 1WBZB 4EVNB 4HK3N 3GSVB 3DURA 3MACL 1LLAA 4FXLA 3OG4B 5E70A 3CH1A 3RTQC 4ODUB 2ZSWA 2BNUB 1QG3A 4DKFH 2XWEA 2VO5A 4LCIH 4MD0A 4CC4C 4U0RC 2GSMB 3MFFB 4D94A 4Z77A 2JKLA 1E2VA 5HI4C 1KGWA 5FYLE 3EH3B 2IALA 1TZ8A 2BW5A 4JFYB 5C7XH 1KBBA 4ZO8A 4WFEE 3LZPA 4P23C 4NPYB 3NJXA 3U2SA 5A2BA 5BVJB 1TVHA 4NJAL 4G42A 3OR7A 2MMXA 5DS2A 3QHFH 2FWOA 5DURB 5DMGC 1B0GA 3OAZH 4JO1H 1NPUA 2YO3A 4OF8A 4LZKA 2PP8A 3RX7A 2B9BA 4JFEA 1CFVH 3LXAA 4JRFA 1PIGA 1E4WL 1AO7B 3SJVB 1NAMA 3LS4L 1BD2B 4PR5A 2EO9A 2GC4C 1JGLL 4QHUA 4XOBA 1UADC 4JKLA 4EJZA 3IGLA 2E8ZA 5FX3A 3VRIA 1NBYA 2I26N 4KK6D 1JF6A 1PG7L 1EAQA 1SXAA 1GJUA 4RBPH 4MWFA 1MDTA 1U95A 4P04A 3ULVL 1HQ4B 5INDB 3WMSA 3S48A 3HR5A 4AYFB 4PJ8C 2GKIA 3HZYA 3NP3A 1ADQA 5I1DA 1JAEA 2HX8A 1J9TA 2OSWA 2XKSA 5C70A 1OM3L 3S2CA 2ADGB 2R23B 5I8EB 4PBVC 2ZWSA 2M2DA 2ZSVB 4JPKL 1OAZL 4CL7A 5B38G 5C09D 4H0LC 3C09C 3UTSD 4TUKH 4XC3H 1LILA 2I07B 4K3JL 4YH6A 4ZD3L 4B0AA 4TVPL 3NIDB 4AYBA 4X9BA 1OGTA 2CJTA 2Y1AA 1BREA 2VL5A 4Y9EA 3ASWA 4JGUA 4LVHC 4NFCA 4PS4H 5DVOA 1G9NC 1U6AH 3HMWH 4TUJB 4U49A 4K7PY 1FNFA 1IBZA 4P5TB 5E9DD 1HZHL 3PWUB 1KO9A 3GIVA 3TH2T 4MZRA 5CHNA 1JWUA 5FF6B 3MCG1 1J8KA 3IDGA 3X3GL 2GSGB 3NUKA 3S35H 1YDPA 4MXQD 1GTFA 4QXGL 5DQDH 3VB8A 3ULVC 1OTSD 4NWUH 4NUJA 1DQDH 3JBG7 1AI1L 3MLPA 2C3VB 2VM4A 3GNML 1S7RA 3CWTA 2YQBA 2UY6B 3IKCB 4PBXA 5SX5H 4BDVB 2ZXGA 3SDAC 1MFMA 2I9LB 3W0WA 5JW3H 4NQSA 1BVOA 1F6FB 3NIGF 1T6AA 1EFQA 2VCOA 3K4ZA 4GAYA 4Z7OF 3KPMA 4NP4H 1KT2A 2I07A 3TN0B 2RA1A 3O3AB 5LGHL 4ZI8A 2X44D 1JYNA 2HG5B 3AW5A 4NT6A 3RNKA 1RMFL 3FZUD 4KTEL 1FSKB 1UD2A 3MRLB 3V9EA 3ZE0E 4EQ3A 2X3AA 5FLVA 1JS4A 2ZOLA 2XV3A 1QMUA 5CS7A 3WEMA 1NCIA 2WVUA 3CSPA 5IQ9B 4I3RL 5A40E 2Y2TA 4MXVE 5BUAA 5JR1H 3AADB 3JVFC 2FNBA 4LLMA 2Z92A 4U1GB 5I71B 3PDGA 3TVMC 4L05A 1HEHC 5E4EB 3HI6L 1VAHA 1S7WA 4R8WH 5GRUL 4EN3D 5BV7B 4G6AD 5I9QC 4NKOB 3MV7B 4WXAA 1ID5I 1U3HC 4GI6A 4G6ML 3ECWA 3SJVA 2ZX8A 1DSYA 3HHRB 2DWEA 5C6WH 2E7BA 4GLRH 4JFPA 5ABDE 1SOQA 2PNDA 1G6RL 3NSFA 1U21A 2AJVL 3SBQA 3C5JB 4JB9L 1BEXA 2VL5B 1EERB 4AYDC 1T66C 4HUXA 4ZTPL 4HHAB 5I26A 4WHTB 1YEHH 1E4XL 4IOFD 3N40P 5HPMA 1QFWH 2QLYA 1P5UC 3MRKA 4F7EA 3D87B 3TWYA 1UWGL 2NY7H 1UCBH 4GJTB 5F93C 3G5XA 5F7HA 2DQIL 1KXQA 1OSZA 2WNXA 5E2VL 2EAEA 3FB6A 4UDUA 5T3XH 3T04D 1ZE3H 4L9LB 5J13B 5AAPA 4PJ6A 1M7IA 2HRGA 3OAZK 4N2BA 4QR7A 3V0VB 1YMMA 1EJ8A 4F2ME 2WUCL 4BJUA 1B2YA 1X5LA 1TGHA 2AK4E 3RDTA 2EYSB 3IU4H 4RFOL 3ULSA 4PJHF 1WS7A 3QUZD 2H1PH 4N24A 3KWXA 1EAJA 4N2MA 5CLYA 2DIBA 2YN3A 3NMEA 3RLSA 5GXBB 1MJUH 5D7IE 5F89A 4HGWA 3OGOE 1GS6X 1UD8A 3N9GH 4XVJH 1QHPA 4U6HB 4I8DA 4PG9B 3P3SA 4OFYA 2BDNL 2CKBB 1B0GB 1WD9A 4BFRA 2FWOB 2XXCB 3DUSB 5DJ8B 1TCMA 3GXUB 2JI1A 3L3DA 3TBWA 3U7WH 4AVKA 3B9VA 4UM9D 3SD5A 4W9FC 4KXZH 2QL1A 4KFMA 4NENB 1OP3K 3I6SA 3NGBC 1HU8A 1XCTA 5TF0A 3QS3A 1MEXH 2CZNA 2E86A 3M7FB 3MFFA 4JRYA 4GT7A 4NS0A 2BIQA 2IIJA 2UY7A 2R1XA 1TJIH 3MV9A 4IIQC 3QIWC 2EIZA 4ONFL 2P80D 5J6HB 1G6VK 4BFFA 2VDRL 3PWLA 1MCQA 4Y2DD 4C4KT 4WGKA 1OGTB 2IQ9H 2H6PB 2QSCH 3Q8FA 5ALBL 1DFBH 1KEML 2NR6C 2RQ8A 3S37L 5FC9A 5LBSA 2AAVA 2O4EA 1RZJL 2BVPB 4WSKA 5IG7B 4NC2B 1JD7A 3QDHA 1DDHB 4X9FA 4D0CB 3QCTL 1BXVA 3QR0A 5HHVL 4HG4K 3MBED 3MRDA 3CBRA 4MXWL 2R9HC 1F5WA 4ODXA 3O0LA 5SV4A 2KBGA 1T6VN 2HSIA 1YUHA 3GI9H 4UINL 1RUKL 2QEJA 2EH7H 3WEOA 1P4IH 4MJIE 5TQ2H 1CO1A 2KHAA 4N8VA 2XTJE 3T3PE 2IGFH 3P9MA 4KRPC 4YHKL 1WWBX 5BV7L 4LVNB 4AV4A 2WCPA 3TT1L 2BY3A 4WTZG 2BY0A 4QT5A 3GSQB 4C54A 3TBTA 3JV4B 4ZMLA 4U1KB 5SV3A 4WLCA 2YUZA 3B43A 3F7KA 3S5LA 3S5ZA 1A6UL 2ENYA 2JCWA 1T4WA 1X9LA 3CZJA 1KTDB 3ZKMD 1YEJL 3V0FA 2X9XA 2ZUVA 2PXYA 3KBPA 3ET9F 4DCQA 5IMMA 1DVUA 2FBJH 3BC9A 1Q9OB 2Y07L 3GHPA 3GI9L 3SKUD 2J1YA 3QDGD 5EBLB 1QLEB 2Z31D 1MCLA 4EF3A 1TQBC 2ZNXA 3I0WA 4GRWH 1KLUA 4Q9BA 5JLZB 3D85D 1T7YA 3R8QA 4BH7A 2ZSWB 4KX8A 2DMBA 2FECL 3B34A 3O4LD 3NCEB 4DZBB 5JXAH 2NVMA 3RVUD 1WBZA 1H8OA 4FYSA 2WMPA 2GHWB 4RODB 2ZXBA 3QEQB 2QFRA 3HZKB 2ZX5A 1E6OH 1I8AA 5H4YA 1UB6B 1MWOA 5KUKA 5DT1H 1UYWL 1CLVA 1CBVH 2FJUB 43CAB 4N2AA 3UXFA 4KJYB 3KVPA 1D7FA 3G6JF 4JVUA 4JFDE 1A4JB 3NP4A 1JF1B 3VRJB 3VXPA 3MUY1 4R2GD 1GGYA 1DQML 4U1JB 3VH8B 4ODTL 3OF6D 4LSQL 2NYYD 3QUXC 1N5AB 4I3SL 2GJZB 2NTFA 3NFPB 1A66A 4FJZA 3INOA 5D4HA 5EA0L 1OF0A 3P9LB 1PY4A 1FNSH 4G72B 2C9SA 3AB0C 1KYUA 4MASA 4PV9B 4XCCL 1UXLA 5AAMA 2JPIA 3SDAB 3G04A 2PWEA 2GAZB 1MRCH 2WYTA 2EINB 1A7OH 5EPMB 4G11A 1A5FL 3HFMH 4QTFA 3QJTB 3O4LA 3DX6B 1QNIA 4HBCH 1AS7A 3NESA 3NFSH 5E94B 5FYLL 1NFKA 3DVGA 2CUHA 3CMGA 4RMUA 5SWZA 5I5IA 5SWQB 2OCJA 2F7IA 4KFZC 4P3DB 2V3DA 1PD6A 2QPFA 3II3A 4U6VH 5SWZE 4F24A 5MI0C 4HWBL 1SBSL 3FF8A 4WUUE 4DEUA 4DIXA 4LMQE 2VJXA 5EB9A 1JK8A 1FGNL 5K69A 3NIGE 4F7CB 5GZOA 1LK2A 1HXYA 5C6PB 3A67H 1E4KA 2FSDA 2VLRA 2BP3A 1E5AA 1W0VB 3GKWL 3OPZH 5G4MA 5HVGB 3JTSB 3G04B 3HRPA 2ZG1A 2X1OA 3PUCA 4K94H 1NDMB 1BFSA 1XSOA 4X50A 5EBLA 3NA4A 2RCSL 4XN8A 3PL6A 4NO3B 3RIFK 3WEXA 4ODBD 2BNQD 5HGAB 2DLIA 3VXOB 3VXUE 1BBJB 4OVVA 3MHZA 5PCYA 5BJTB 1FPTL 3UGEA 3BT0A 1KTBA 1KZYA 4WNJA 1NEZB 5E8PB 5FYKD 1KOAA 1W80A 3EF7A 4DUWA 5A7BA 5KVDE 3HHSA 3WD5L 1BLNB 1V27A 4HWUA 4GAJL 5GRYA 3SD2A 1RZIB 2E9BA 5FV1L 5FECB 2Y7LA 4H0GA 4XPBL 1Z2KA 3HB3B 1JGLH 4WNSA 4YZWA 3ECBB 1WVZA 4HHWA 3OX8B 2X4NA 1OGPA 3SGKA 2HAZA 4M6NL 1WBXA 4QRQB 1QSFD 3U83A 4PY7A 5TF1L 4IEFB 1W15A 4PUBH 4TSBL 5JXEA 2AGJH 1N70A 3QH3B 4H20H 4H88L 5J6SA 2R51A 4TXVB 2J6EH 4HA1A 1LE9B 2ZKHH 4WEUD 3BAWA 3O8XC 2DTMH 4RA3A 3D06A 3HNSH 2R0KH 3N04A 1IV8A 5DEJA 4RGNE 4TMPA 3CWUA 2ZOUA 2AK1L 3UAAA 1JPTH 3EGXB 4X6CB 3QUYD 2DLFL 5CFHA 1GOFA 3KPRB 3VXSD 1J8HA 2YJLA 2RFXA 4WO4B 4MB3A 3NCJH 4QHMA 3LKPB 3WFEL 4FJYA 3CZKA 1S9KC 2WLKA 1UD6A 4OD1H 3LZNA 1I8IB 3PRZA 3BXNB 4U1GC 1HOEA 2VZ3A 5FGSA 2PF6A 3ZUNC 4YSSA 3BCFA 3HNVH 4G80A 1HJCA 4OLZH 1KJ2H 2FEJA 1QVOA 3RVWC 4CVXB 3DXAE 4TSBH 3NQIA 1U8OB 1FL6A 1SDDB 4ZPTA 5D9SA 5FCUH 1ETB1 1HHIB 1ZVNA 2QADC 5I18H 4HIJA 4OGZA 4N2FA 3DGCR 1ONQB 2LVEA 1N5AA 3KGRA 1FIEA 2P5ED 5DJ8A 3I50H 4O58L 4WW1A 3Q6GH 1SQMA 3MRIA 5T3XD 1E67A 1LP9E 1GIGL 4NN7C 3WJJC 3A4AA 4JM2F 3OM3B 4JFED 4DPBX 1WA0X 5ACLA 5DJ0B 2BFVH 3CVHA 4GP4B 4YAQA 1M3JA 1HVXA 1ZDQA 2H6PA 1XGTB 1H3UA 4OM1L 5HYJA 3QO0A 3U46B 4FL4B 5EC1B 2PCXA 5FYJU 1IAII 1ZT1A 2ZCKH 3BJLA 4BKLB 1GCYA 1QO3B 2AZAA 4I88A 1HOCB 4HIHB 4Y5XA 4B50A 4QOKD 1J1XL 4MA8L 4QRUB 3BGMA 5F7LB 3RIKA 2G3MA 3UJIL 4M8UA 4CMMA 3VD2A 4XMLL 2QKIA 4LPWA 4MQ7B 3OC5A 1CDIA 1JK9B 4KO7A 2C7UB 4JPIA 3QCVL 1QLRA 4M03A 4PRAA 3ZDZF 4LHQB 4JPWH 6PCYA 3ARBA 1MH5B 2P7TA 3EO1B 3VFUA 2YBRA 1KBKA 4ZMZA 5I0DA 2X2HA 3QCTH 5HHVH 3MBXL 3CDFA 5KVMC 3IXAA 4FQCH 5AENA 3EO9L 3ULUE 3VQ1C 5B8CC 2YQGA 3DHMA 2DWEB 1R46A 3GMQA 4UV7L 3B83A 4I5BA 1I75A 3UZQA 3RZCA 3ARDA 4RRPA 4PW4A 5T1LA 5ERWB 1Z3RA 3TL5A 2J1ZA 4P5MB 4FC3E 2AITA 1F8TH 4LL1A 3KDPB 4XNYH 4YBQC 4ICXA 1ZHNA 4JVPA 2J72A 5GGTA 2OP4H 2RJMA 3L1OH 4PRIA 4Z7NB 1AGFB 3J7HA 3HLKA 4X5XB 3BQUA 2JJSA 5CGMA 1CXHA 3FB6B 4ODXB 1BD2E 5AZUA 3VI3A 4CSZA 5IY5B 4XMKL 5IBUG 1M6OA 2YC1A 1J1PH 5J8OA 5FO8A 3P0YH 4NGHH 3VRLF 3PIQB 1EO8L 4K3HA 3C8DA 1T4KB 4WHTA 4DO6A 5IJKC 1IQDA 1ASQA 2XG4A 4OY9A 1BJ1J 4NI6A 1S7QA 4X8JA 1XF3A 2JIXD 1E3XA 3FU7A 3BIKB 4HUKB 1I4FA 1KPVA 1HL5A 3NFNB 2MCAA 1NM4A 5J6HA 5BOZG 4UMGA 3RWDB 3MXWH 4GW5A 4YDMA 4Z78A 1IBFA 1M6UA 2BIIA 2XPGB 2J8UA 2FKMX 2VW7A 4PREA 2EC9U 3AXHA 3DSNB 4PWGA 4AM0B 4PWIA 4FHBD 5H37H 3NOIA 1G9MC 5I16A 3BKMH 5INCA 1CG9A 5CF3A 3BUTA 1KLFA 4YEEA 5LNEA 4P2RA 5DHVA 4P5RA 4NI3A 4P9HH 4DTGH 4L8SC 4PJ5E 1S9YA 1EMTL 3VMPA 4NWTL 2OZNA 5J89A 5KJ7E 4A6YA 3BRFA 1KGIA 1BXUA 3LV3B 4Z76A 1CE1L 4U6HA 4O00A 1AHWC 2EXYD 3V7AG 3DVFA 1DIZA 4IW4C 4WAFA 1N6VA 5AOZA 3EYQC 3HC3H 4OCSH 4OJAA 4YDJA 4AEHH 1HL4A 4LLQB 3Q5OA 3W0WE 2QELA 3V79C 2XV0A 1DJXA 1N0LB 1XFPA 2F8IA 3MXVH 2W65A 1YNLH 5LCVL 3X12A 4ZYKB 3BWAB 4K5NA 4CMHC 2IQAA 1CICA 1TPXB 2XVGA 5I8EA 4QMEA 4B97A 2V2WA 4JLRB 2E7DA 3RGVC 4P3CL 1KN2H 1S78C 4H1LH 2JTYA 2E9JA 3VTTA 1L9PA 5IESH 2D7MA 3C5ZB 3RZCD 4P2RE 3QJSB 1H8NA 4EXPX 3KWVA 2JCCA 4GKLA 3QPQD 3SOBL 3T8XA 4UM9B 1G9ML 3FFCA 5D7SH 1YJDL 3MNZA 1VSCA 1QNCA 4RMWA 1IX2A 2YD1A 3M8OH 4DOHB 2C1OB 4O02A 4U6VL 5BQ7A 4NAJA 3VRIB 1H3XA 2EDDA 5HHQA 4Y19B 3WFHB 1N3AA 3G5YB 3S88L 2ADJB 3QIBD 2NZ1A 3EYSL 4L0PB 1QWNA 5D6CB 2LOEA 5I1LB 2ICCA 1MW3A 4G6FD 4W6YB 5MERA 4LEXL 3OKOA 1P7HL 4HXAL 3VMOA 3IAGC 1EGJA 2ZX9A 4MB5A 1I7UA 3IFLH 5CEZL 3HC0B 3LKQB 5IQMA 3X1GA 4KKAD 2P8MB 4RZCB 2AMGA 3VI3E 5I73C 1RLWA 1WFNA 4FNRA 3B6SA 4EJ1C 1WBYA 4JFYA 1A3QA 2PPAA 3VB9A 5LKNA 3RL2B 4L9DA 5AVQB 4PJ7F 4XNMB 2KQMA 3BLPX 4NHUB 4Y1AA 3C6LD 4UIMA 1S7QB 3N41B 3S0PA 3HS8A 4EZLA 3BVTA 3DO7A 4HT1H 2GK0B 4OGXH 1P1ZA 2WBJB 4OB5H 5F7DA 1MHHB 4PRPA 1YPZA 1TFPA 3JWDL 2ZKWA 1V3MA 4XHJD 4BSJA 3QZMA 3S88H 2MTPA 5JHAA 4FQ2L 3MLRH 2V3EA 4HIQA 3BZFA 4WI5A 3QDJD 2D0GA 3JTBA 4Z7WF 3TJPA 3VNZA 2X1QA 1T7WA 5D7IB 5D7SL 3CU7A 3NK4A 1WE5A 5DMGD 5GS1C 3IWUA 3IBOA 4JL1A 4OFKA 3SQRA 1URZA 4JM4L 1TJXA 4QXTB 2L04A 4AGLA 4N2GA 4OUOA 1UUNA 5D7EA 2B20A 3D30A 5ERWA 4Z5RB 3CVCA 2QR1A 4EDWL 4CN4A 4FHJA 3ENOC 1DVFA 1MCPH 2P8MA 1J8RA 1WZMA 4UU9A 4H2AA 1E6JH 1KYFA 2PXYC 2X4UB 5D2LA 3HZMB 2ROXA 3VSTA 2LQRA 3TH3T 4EXKA 4IMLA 4LRIA 1CDYA 3P4OB 4R4BB 3Q2LA 3FXIC 5DTFB 3MOBL 4P07A 4WI0A 2GY7B 2DJSA 3EO0B 1GS8A 4P5TA 4PRHD 4D9QE 1XSKA 3WFHA 1JXDA 5BCAA 3ZGIA 3QJHA 1JWMB 3H9SA 1PIFA 1TEFA 2CPCA 1TQTA 5AVWB 4Z0XB 4PTTB 2GJ6B 4EVNA 4FMFA 1U8KB 3KLHC 1IEHA 3G08B 2CUMA 1TNMA 5HD8C 4DKEL 1AZBA 2Z8WC 1GGBL 4ZMVA 3HG2A 4N0CC 1CF1A 1JRHL 4N1HB 3HG5A 3MRRA 5KSBF 1M3HA 3TA3B 1P9MC 2KPNA 2WB1A 3QDMB 3KHQA 2NXYD 4ZPVB 1MPGA 4Z7VE 3DO3A 3IDIA 4AENB 3LXCA 5L2JA 2IQAB 5B1JC 2PCPA 4QLWA 1C5DA 4L9LC 4AWJC 5ICZB 4ZD3H 2UXVA 3CVHB 4YAQB 1MLBB 3FUDA 2I5WA 1PAZA 5JZ7C 1M42A 2P8PB 1CK0L 4IS6A 4Y5VA 4FA8A 4FXKB 2WY3B 4U1MA 1WCBB 3MRJB 5AW7B 1KBVA 3FSZA 2F7RA 5F0MB 3K8LA 4JHAL 4M6AA 1TYEB 1QKZH 4NO0D 1N5YL 4XX1E 2G3NA 1HSBA 1DE4B 1PAMA 2ARJQ 4DN3L 3ATEA 4FLRA 4HYTB 5CZXD 5G4OA 4B9GA 3P1VA 3TV3L 5DHVB 1T04B 1JRHH 1ECZA 2Y1VA 4Q9RL 3BEVA 4MJ6B 4NQVB 3DOIA 2IAND 3O6FD 4NWUL 1DVFC 3Q2VA 2CO6B 3OSKA 5D7IF 3SDAD 1CDUA 4UT9L 3VXTA 1JZDC 2I85A 1RZJC 3IMRA 1UXSA 2CGZA 1XQ4A 2ZUXA 4MQSB 1HEZB 3DX8B 4JO2L 3K2IA 3VFMB 3B2MA 3RAJH 4A04A 5JQ6L 3GC3A 1KELH 15C8L 4OM0H 2JE8A 3KZ8A 1INQB 3N6YA 1CK0H 1NFDB 4OF0A 3SDCA 3TJHC 2DTML 3V9CA 4ZJ9A 2Z93A 2H5UA 2VDNL 1QR1A 4MBOA 1F00I 1BAFL 5E5LA 4HCIA 4YR6A 4NSKA 4PWHA 3CDGA 3EDJA 1R5WA 1I7RA 2VRQA 4LP8A 1FWXA 3ETBJ 2XJKA 3C6EA 2H5AX 4J5VA 5F1NB 1KCUL 1AKPA 3A21A 2HLEB 2BXZA 4AW7A 1GKOA 3AWGA 3BQUB 3MUZ1 5IEHB 3QUGA 4OGAD 1A3RL 2WVVB 2FWLB 2G2PA 4WY7H 3KXFE 3B7YA 1JV2B 2A6KB 1ND0A 2LFEA 2PETA 2AQ3A 3VXRB 1ZE3C 9CGTA 2RD0A 1XSZA 1FBIL 1VACA 4GS7C 3GJEB 5A3ID 5DK2B 4WI4A 2CK0H 3FYIB 4OJCA 4DN4H 5C0JA 5ICXA 1GSKA 5FO7A 2KZKA 2UVEA 2EEAA 2FZ3A 1U8JA 2Q1EA 4N5EC 1N3NA 1KCLA 1MKFA 4ORGA 3UBXB 2QSCL 3S37H 3EGDB 5KVDH 3U30C 3RAJL 4EUPA 3ZXAC 1SJHB 4O5LL 4N2IA 2QQKL 1IC7H 3D39E 2Z65C 3WOVA 2B1AL 4WUUB 2X6UA 4JPIB 4H1LB 2BSTB 3OMZA 2OYKA 3V0IA 2N56A 2HTLC 2AQ2A 3VO0A 2W9LA 1HHKB 5FWRA 3S8WA 4BH8A 3QFJB 2PXYD 3QAQA 5GRXG 5D2LF 2LVCA 3WHE1 5HHNB 1P4BH 2YEVB 4BKLA 3UYRL 5JO5A 3LEXB 2EDJA 4V1DE 5FO9A 5BUPA 4X9IA 4A7GA 1A7RL 1RUPL 1FG2B 5T1JA 4EI6A 2J56A 1AXSA 2G5BB 1T1WB 5FHBH 3PAZA 4XXWC 1SJHA 1NFDF 3FQUB 1E5BA 4JFDA 4LRNL 3WDJA 1KLGA 4QRAA 2IG2L 4O51B 2WNKA 4JCWA 3KJ4C 1UM6H 3VFNA 1MFNA 1WIPA 1RHHA 1TXKA 3EFFB 1CFNA 1I8LA 3PV6B 5CP3H 4LSUL 4OBRA 1S7TA 3CHPA 1HAWA 1U93A 2P8LA 2QQNH 3IRPX 3Q5TA 2QMKA 3TJEL 3D0VB 5DUML 5E1GA 4L4VA 1EXGA 2RQEA 4Y89A 4BSWB 1MJUL 4NCDA 2GI0A 4P46A 4PG2A 5C07D 4F8OA 1PG7W 1EXHA 1MQKL 3QYCA 2O72A 4KTYA 2VUKA 3FQYA 3SDXA 3SHSA 4O4YH 3PGDB 3K74B 1FFRA 3ZR6A 4NZTL 5IB5A 3C75A 2VSCA 4WV1A 1J9QA 2JXMB 4LSRH 4G80B 4F15B 3GUTA 4F92B 4BYHA 2BNRE 2X6VA 2H4LX 2IH3B 2X9WA 2A9NL 3ULAB 4CRPA 2EE3A 2OSXA 1OP3H 2DWXA 1YAIA 4KQ4H 4UANA 5GZNC 5IHZB 2WXRA 1XTMA 1H8LA 4BIKA 3MLUL 5JHDB 2ESVA 3WDIA 1QYGL 1MW2A 5AFAA 3HPLA 4HUUB 4JFUA 2G30A 3TZVA 3ZE0F 1ZEAL 4PP2A 3UBXI 7FABH 3AGVA 4GKSA 4Y9FA 3PABB 4OI9A 2QBWA 3LB6C 4YDIL 1KTRL 3VA6A 4I1NB 1VFBA 2XNAA 4N2CA 3K3QA 1A7NH 4I3SH 4BFEA 3GUTB 1NOAA 1JWSA 1ZIBA 3H54A 4LLUA 2FX7H 5LAXA 4NBYB 2N7BA 3D08A 4JZJA 5J12C 2IH8A 5TPWL 1XGUB 4G1EA 1N39A 1VFMA 4P2QD 1BGXL 3MLRL 3OAUL 3OLIA 4MJIA 4PJCE 2ORBH 3SPJA 5CBEB 1NH2A 2XA8L 3SYCA 2IDQA 8FABA 1BLNA 3TEZA 3RUGA 2HP4A 5I23A 1OKEA 3HEIB 2A6DB 3DTXA 3QUZA 4M43L 3ARTA 1XD1A 1U9KA 2ZE0A 3QCUH 4RGNB 3GZOA 3V7MA 1LM8V 3GSRA 5EUOB 5IJCC 4NAQA 4R5VA 5JW5B 4K7PL 1RPKA 3N1QC 1I85A 5KSBA 1YMMD 3WIFA 1RZ8A 1IJ9A 4HCRH 4YDIH 2X4PA 1RFDL 4JJHA 3VX1A 2XIDA 1XBRA 4F7TB 5FHAL 4LLYB 3T0ED 4XBGA 3AG2B 2ZOTA 5JO5B 4C59B 1SPDA 2Y7QA 4NKMA 4YLCA 2EVJA 4CADB 4R7NA 2BVPA 5IG7A 1T03L 1MVYA 2N3JA 1AIFB 5IZ7A 4JRYE 2LU7A 4JGJA 1JMZA 4G2AA 5LDSA 5F1KC 2EH8H 3PXLA 1USQA 3QIUA 3KLAB 5FWQA 4DGYL 4S2SB 1RZGA 4OLWH 2I7SA 1F1GA 4ICWA 2LLLA 1U8PB 5DHVH 3BZEA 3DVGB 5SWZB 3BMWA 5SWQA 5I1HL 4M00A 5FGBC 1UKSA 3FULA 3TO2A 3ROOB 1GH7A 1XDTT 2QTVA 1JNLL 2NY4C 2WIMA 4K8RC 4XHQA 2MFNA 2VXVL 2NRDA 4EN3A 2QKSA 2Y36L 2UUDH 4GMSL 1UWEH 3ZL1A 1XZ0A 4LHJB 3FPXA 2ZUUA 1NC4B 1QI4A 1Y07A 5FHAH 1M1SA 1B0IA 2GJ6D 4A2MA 3PABA 2VLJB 1VKLA 1DLHA 2D3VA 5F0JB 3QNYB 4CBZA 1L5GB 2WSKA 5FYLD 4U1JA 4WI9A 4KMTH 3IDUA 4YSPA 2CKBA 4F2MA 1MCKA 1UXMA 2CDFB 3FU6A 4OJEH 1QNZL 4EZKA 1XT5A 4A7UA 1CL7H 1JI1A 3BE1H 3LRSA 3AUVA 4UBDC 5TDNA 4KXDA 4F57H 2OM5A 4K9JA 4MNQB 2CBQA 4AJYV 2BK8A 2OTWB 3M1BA 3RWJB 1E4WH 5BMFH 5CJXA 4Y0GA 1TG8A 1XIWD 2Q6WA 4K8RL 5L9DL 3IJYB 3UTZB 4BE5A 2VKXA 4H44C 2GTZB 2EH8L 2EIDA 4YLBA 2ZCHL 1YY8B 1I8KB 2ZOOA 3SE3A 5JLZA 2FDBP 4H26A 4XZUB 4K2UH 2ZUTA 3T0WA 4UDUB 4IM8A 1JPSL 3UO1L 4AC2A 2OYMA 3FQRA 3FSWA 4WHCA 4KMTL 5EU6B 4ZK8A 3ZYIA 1CXKA 3E9TA 4AVJA 4PB0H 5KSVA 3LIZH 1RUAH 5I1GH 3VFOA 1OAZH 1OSYA 1KEGL 5E7BA 1TSRA 1I7UB 2B08A 3O0RL 4PRNA 4XO8A 3RKPA 1ACYL 2P24B 4FQHA 1H3VA 1XB3A 2BMKA 1R33A 1A6AA 1ZVSB 4AKQA 3HZVB 4QY8A 2WXLA 5D7JB 2V5TA 4JHBA 2UZYA 1ICTA 5F7NC 3JV4A 3V8OA 4JQXC 1GHFH 4NQXB 6TAAA 4Z0BH 4NM4L 3BCDA 5C09A 3MV7A 2NSMA 1CGTA 1KPRA 1NGWA 3I3EA 4APXB 3RFZB 3LN5B 4OFVA 5BQ7B 4OLYH 5E9DE 4QXVA 5JHLH 1Y7VA 4ZXBD 1TCRA 4MD5B 3ELQA 3HI1B 4J2QA 4FXKA 3MJWA 1LO2H 3L95B 3WIHH 4F8LA 4E9QA 4MS8D 1QNBA 1C47A 2XRAL 3NYKA 4ZO6A 1WO2A 4LDCA 4ZFZA 1WK0A 3NJHA 3Q9PA 4ZUWA 3HNSL 2DWDA 3B5GA 5I66A 4XP6L 3CFIC 3MRLA 1NKOA 3NK3A 3UERA 3W82A 1UVQA 5C07B 4W9JC 2H32H 3HW7A 3QDMA 4XP4H 5MEND 1OVZA 4PGDA 4Y2DC 2VN6A 4PG2C 3TVMD 1GHFL 3L2LA 4N0CD 1ET7A 4YDVA 1EUVA 4BEIA 1FGVH 4LEOA 2VDLL 5IT2L 5AVYB 3D2UD 4AQ8A 3SODB 2YSSB 4XGZA 4G8IB 4BHUI 1ML0A 3MV9B 4PCKA 1J5IA 2I5YL 3PJNA 2C3VA 3QEUB 2XZCL 5IFJA 1G9NH 2JLLA 4RESB 5TDPB 4KXCA 1FFNB 3ZL4H 1MHCA 1ZHBB 4I3RH 4IKLA 3KJ6L 1FQ9C 2Z1KA 1F6AA 4LSSL 4XN1A 2D4DA 5F9JB 1I7RB 3HNVL 3UCRA 1DQQA 3PWUA 3FB5B 2VZ1A 4PJ9A 4NNPH 1LO3H 2KZWA 1IB5A 2EO7A 3ULVH 4JFTA 4M3JA 1AR2A 4EI0A 2NNXA 1NDGB 3CSYA 4LNRA 3RVVD 3GBNL 2NNAB 4S1QL 3CLEL 2UUDK 4HOZA 1J0KA 2YXVA 4U3XA 4CDGC 1OZUA 2O61B 4CGTA 2OYLA 1ADWA 4M7LH 1UEYA 3BYYA 2APTA 5IFHL 5J1SC 3WTYA 6FABL 3L4UA 4E42A 1PLAA 3FMGH 1WCQA 4UZSA 5CXPA 2ZF9A 4GAGL 3QQNA 3DETC 4XR8C 5ISZA 1OE3A 2FEDD 4W70A 1J87A 2Z31C 1BVKA 3PQYB 4OD3H 4I87A 3VJ6B 2HYMA 4DGVL 2JF1A 3L3OB 3V4PL 2V5YA 3FFOA 2ODHA 2R29L 4XP9H 2B39A 1U8HB 1C7TA 2YAOA 1FZKA 1SHWA 1S7UA 4NQDA 2GTWB 3LVTA 2R8SL 1JBJA 1NCUA 5CUSH 4QG5A 2VN5A 3HE7D 4HDIB 4WK0B 1MCSA 3OL2A 4JY5L 5IOPB 3MAWA 1J5OH 1K3ZA 5BZZA 4QRBA 2X2IA 4CSTA 2R1YB 2MQ3A 3TPUB 4WEMB 4FG0A 2H9GA 5K9QG 4AZ8A 2IAMD 1BG9A 3IT8D 1RJYA 4QGTA 1TETL 5AAWA 2F19L 1BQLL 2J4WH 1QABA 2QSTA 1YEKL 3P0VL 3ZTCC 3RPIA 2FGZA 4UZUA 4R90L 3AABA 3MNZB 2EIEA 3PWPD 3AU0A 3L3JA 2DKUA 5HI3C 4H26B 1R1CA 1P5VB 4K3DL 3QR1A 4TRPH 3BFOA 1XVSA 1NLBH 3ISYA 2PW1A 1KXHA 1Z32X 4G6KH 3WTUA 3OKEA 3VFTA 2P44B 3QEGL 4XP1H 3EOTL 1QO3A 3GSVA 3SDDC 3ASMA 1RUQL 1KMGA 3L2NA 3OB0H 1A6ZA 5FYJL 3I75A 1P7QA 4ONFH 1JHLH 4MDIB 1YTBA 1JD9A 2BSED 3HMXA 4FERA 3OLDA 1B4JH 3Q05A 5AKRA 5KVGL 1JFQH 2G4EA 1PEZA 5IFAH 1I1AB 1YYLL 4ETYA 1J1OH 4LKXB 4XMKH 4FZ8H 1DBJL 3OKDB 3SPVB 1WQVT 2UY6A 5KWYC 1O7DC 5F9DC 5IWLC 1QRKA 2VE6B 4TPSA 3R0MA 5JIQA 4P2RB 1WS8A 4D3CH 1GYCA 2FUQA 3BPLC 4BFNA 2C3HA 1I3RA 3KWTA 1B6UA 5LNDA 2IOMA 5JIPA 1MG3C 1E2ZA 4OLEA 4MJID 3MRHA 3U25A 5AVSB 4RGMC 1QUNA 2H2PC 1PCJX 4TTDD 5IV2B 2TRHA 4A2GA 4NP9A 2IGFL 4I0PC 3UPRB 3BPNB 3LNFA 1RD6A 3GSXB 4TUJA 4ZUVA 3IPBA 5F72S 2D03H 4TSAL 1EX0A 1YPZB 3FTGA 3F7QA 2QGEA 1N6QL 5FOJA 3V6ZA 2EVFA 1CT8B 2G2NA 3NA9H 1N59B 3G6JB 1KB5H 4Q14A 2RFXB 4WO4A 3LPOA 5K39A 3TA3D 1YYLH 3BH9A 3D3VE 2DQDL 2FR4B 3TNNB 2DBLH 2ZQKA 1OPGH 5AD0B 4G8FB 1AZNA 1JZEA 4K5OA 4S0SD 4E5XG 3C04A 3S4SB 1PZ2A 2ATKA 2YZ1A 1Q1JH 3RJQB 3UROR 4AMKL 2NLJA 3U6RA 4K9EH 1MVUB 2FGTA 2QPDB 2HFEA 3UTOA 4AEHL 1CUOA 1T5XB 3IK2A 4TQHA 2X6AA 4PJAF 5I8OH 4BV1A 5D5ME 1GAFH 3VXRE 3PYCA 1JGVH 1GMEA 1D6VH 1QTYT 2VN7A 1KZQA 1TU2A 4XC3L 1DBAL 1EZVX 2CLVA 5MI0B 4PJGE 4H5SB 2NY6B 4YHIA 3OX8A 1XAKA 2WQAA 4ACPA 3UDWA 3T0EC 1TJMA 5BMFL 1I3VA 5DFVD 2C1OA 2WBWB 4O02B 4HP5A 1O0VA 4KDWA 4NRZB 1R3KB 4RQQA 2A7BA 3NJGA 5KVGE 2DJ4A 4WENB 4IOSA 2BHYA 3BUDA 1VGEL 3FCUB 3MLZL 4P4KC 3OLPA 3NACL 2Q0ZX 4LXFA 4GEJA 4FYQA 1DDTA 1OW0C 1T1XB 5GGRB 3WNLA 1WTGT 3LMJH 2ZZUT 3PNWB 4H20L 2WC7A 2PWHA 3LHAA 4M62H 1JCVA 5C71A 3ARBB 5CD5C 3SZKC 4Q0XH 3WEXB 2K70A 4PJDA 3D05A 2AEQL 4G3YH 4JM2D 4Y4HC 1A4BA 2AC0A 1DCLA 1GC1C 3FQWA 3UAEA 1SYSA 2WXMA 1FFOA 1RZQA 2APVA 4KJWC 4FADA 1BOGB 1J7VR 4CVZA 5B7FA 2PR9A 4X0NA 4XCCH 4HK0B 2Q8AH 1KXVC 4F9PA 2NY3C 3O3UN 5CILH 1Z66A 5AAMC 3TGXA 4FQ2H 3VGAB 4XVUD 3GXFA 2OSLA 4PJCB 5KG9A 5FOBA 4HK3J 1X5KA 1GSMA 1PQZA 1S9YB 3MGOB 4HSQA 1T1ZA 2DQUL 4GQ9L 2ZOKB 5LB1A 4FQJH 3LRMA 3WS3B 2OL3B 2XHIA 2EEBA 3LPPA 3BUPA 1ZA3B 1BF5A 2VSMB 1E5ZA