1QN5A

Crystal structure of the g(-26) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tata box-binding protein (tbp)
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn5A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn5A02
3H1ZA 3HS9A 4ROEB 2VJ0A 1TBAB 5IYCP 1CDWA 2MJ7A 1QNBA 1W80A 2D0AA 2IV8A 2IV9A 3EIKA 3OC3C 4RODB 1NGMA 1D3UA 1TGHA 1KY6A 1VTOA 2D0BA 1B9KA 1TBPA 1QNCA 4WZSD 1QNAA 2D0CA 1C9BB 1QN8A 1QN4A 1YTBA 1KYUA 1PCZA 3OCIA 4ROCB 1QTPA 1KYDA 1MP9A 5IYDP 3ASMA 1NH2A 2G30A 2Z8UA 1RM1A 5IYBP 1QNEA 1KY7A 1QN3A 1QN6A 1VOKA 1QTSA 1AISA 1YTFA 4B0AA 1QN9A 1E42A 1NVPA 1QN7A 1R4XA 1VOLB 4PY5A 3HS8A 1VTLE 1JFIC 3VN5A 1KYFA 1PZDA 1QN5A
chains in the Genus database with same CATH superfamily
2VJ0A 1PVSA 1TBAB 4WX8A 1YQKA 3N89A 2MJ7A 3DPTA 4TPSA 4EALA 3SNSA 4D7QA 2HL9A 3OC3C 1MPGA 1KY6A 1VTOA 2QREA 1K2YX 3CVSA 2NOHA 1Q9UA 1TBPA 2XHIA 2H4LX 3IH7A 4EAIA 3I3WA 1C9BB 1DIZA 1KO9A 2Z0FA 1N3CA 1QN8A 4EJZA 3CWTA 1LWWA 1QN4A 2DKCA 3KTUA 5HSHA 3OCIA 3CWUA 1YQRA 2JOIA 3OH9A 5IYDP 3T4NA 2YA3A 3UW2A 2Z8UA 3I0WA 1QN6A 1KY7A 3ENCA 2JHJA 1YTFA 3C04A 3OH6A 3NA5A 1R4XA 1VOLB 2FUVA 1VTLE 1M3QA 1P5GX 2NOIA 2H5AX 2Y8LA 4QG5A 2JHNA 5BMNA 1P5DX 4ROEB 2NOBA 2OOXA 1LXTA 2NOLA 2V92A 2NOEA 2HZMA 2NWVA 4HJHA 5KL0A 1PCMX 2D0AA 2IV8A 2IV9A 4RODB 5F9CA 1HU0A 2HKPA 5EPCA 4DULA 3ENOC 3OSEA 1XSZA 1QNCA 3BKQX 4IL8A 4Q11A 2D0CA 1QNAA 1UT7A 3KRMA 1J3MA 1KFQA 1KYUA 1PCZA 1KYDA 1KFIA 3F10A 1V5SA 1RM1A 1T6AA 3CWSA 2QR1A 1N39A 1QTSA 1AISA 3OGDA 3TDHA 4B0AA 1UT4A 1QN9A 4BJUA 1N3AA 2FKFA 2V9JA 1LWVA 1WJWA 2NVMA 1KYFA 2PWWA 3VN5A 4EAKA 3CWAA 2DKDA 2FKMX 3H1ZA 3HS9A 4CFFA 2QRCA 2O3OA 1W80A 1D3UA 1TGHA 3EIKA 1YQMA 4MRQA 2D0BA 2EHBD 4D7RA 3F0ZA 3D4VA 1YTBA 1TUOA 4ROCB 1WQAA 4EJYA 2NLVA 3ASMA 1NH2A 2G30A 1C4GA 1QNEA 1QN3A 2I5WA 1EBMA 1EUVA 2HZSA 2ZFDB 1E42A 4I8OA 1VKLA 3RPJA 5JN5A 1NVPA 1JDYA 2R5XA 3OLPA 3PMGA 1JFIC 3CVTA 1QN5A 2FGTA 2NOZA 4WXAA 5IYCP 1YQLA 1CDWA 2OOYA 4EAJA 4EAGA 1UL7A 1QNBA 5AN4A 5JMVD 1PCJX 1NGMA 2HL8A 2Y8QA 1M5Q1 3ULXA 1B9KA 3OSMA 2NOFA 4WZSD 3D7QA 1K35A 3DPUA 3PDKA 1C47A 5BMPA 3TE5A 2V8QA 2LAEA 1FN7A 1QTPA 2QLVA 1MP9A 3RSMA 4PY5A 2YH5A 5IYBP 1LWYA 1VOKA 3EAYA 2JPIA 2F7LA 1QN7A 3I0XA 3HS8A 2QRDA 1M3HA 3CW7A 4C7PA 2MZ8A 2DKAA 3OSTA 1PZDA
chains in the Genus database with same CATH topology
2VJ0A 1TBAB 1YQKA 3N89A 2MJ7A 3DPTA 4TPSA 3SNSA 3OC3C 1KY6A 1VTOA 2NOHA 1TBPA 2XHIA 3IH7A 1C9BB 1QN8A 1KO9A 1N3CA 4EJZA 1LWWA 1QN4A 3KTUA 3OCIA 1YQRA 2JOIA 5IYDP 3I0WA 2Z8UA 1QN6A 1KY7A 1YTFA 1R4XA 1VOLB 1VTLE 1M3QA 2NOIA 4ROEB 2NOBA 2NOLA 2NOEA 2HZMA 2D0AA 2IV8A 2IV9A 4RODB 1HU0A 4DULA 1QNCA 4Q11A 2D0CA 1QNAA 1UT7A 3KRMA 1KYUA 1PCZA 1KYDA 3F10A 1RM1A 1N39A 1QTSA 1AISA 4B0AA 1UT4A 1QN9A 1N3AA 1LWVA 3VN5A 1KYFA 3H1ZA 3HS9A 2O3OA 1W80A 1D3UA 1TGHA 3EIKA 1YQMA 2D0BA 3F0ZA 1YTBA 4ROCB 4EJYA 3ASMA 1NH2A 2G30A 2I5WA 1QNEA 1QN3A 1EBMA 2HZSA 1E42A 4I8OA 1NVPA 3RPJA 1JFIC 1QN5A 2FGTA 2NOZA 5IYCP 1YQLA 1CDWA 1QNBA 5AN4A 1NGMA 3ULXA 1B9KA 3OSMA 2NOFA 4WZSD 3DPUA 2LAEA 1FN7A 1QTPA 1MP9A 4PY5A 2YH5A 5IYBP 1LWYA 1VOKA 1QN7A 3I0XA 3HS8A 1M3HA 2MZ8A 3OSTA 1PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1Z A;  3HS9 A;  4ROE B;  2VJ0 A;  1TBA B;  5IYC P;  1CDW A;  2MJ7 A;  1QNB A;  1W80 A;  2D0A A;  2IV8 A;  2IV9 A;  3EIK A;  3OC3 C;  4ROD B;  1NGM A;  1D3U A;  1TGH A;  1KY6 A;  1VTO A;  2D0B A;  1B9K A;  1TBP A;  1QNC A;  4WZS D;  1QNA A;  2D0C A;  1C9B B;  1QN8 A;  1QN4 A;  1YTB A;  1KYU A;  1PCZ A;  3OCI A;  4ROC B;  1QTP A;  1KYD A;  1MP9 A;  5IYD P;  3ASM A;  1NH2 A;  2G30 A;  2Z8U A;  1RM1 A;  5IYB P;  1QNE A;  1KY7 A;  1QN3 A;  1QN6 A;  1VOK A;  1QTS A;  1AIS A;  1YTF A;  4B0A A;  1QN9 A;  1E42 A;  1NVP A;  1QN7 A;  1R4X A;  1VOL B;  4PY5 A;  3HS8 A;  1VTL E;  1JFI C;  3VN5 A;  1KYF A;  1PZD A;  1QN5 A; 
#chains in the Genus database with same CATH topology
 2VJ0 A;  1PVS A;  1TBA B;  4WX8 A;  1YQK A;  3N89 A;  2MJ7 A;  3DPT A;  4TPS A;  4EAL A;  3SNS A;  4D7Q A;  2HL9 A;  3OC3 C;  1MPG A;  1KY6 A;  1VTO A;  2QRE A;  1K2Y X;  3CVS A;  2NOH A;  1Q9U A;  1TBP A;  2XHI A;  2H4L X;  3IH7 A;  4EAI A;  3I3W A;  1C9B B;  1DIZ A;  1KO9 A;  2Z0F A;  1N3C A;  1QN8 A;  4EJZ A;  3CWT A;  1LWW A;  1QN4 A;  2DKC A;  3KTU A;  5HSH A;  3OCI A;  3CWU A;  1YQR A;  2JOI A;  3OH9 A;  5IYD P;  3T4N A;  2YA3 A;  3UW2 A;  2Z8U A;  3I0W A;  1QN6 A;  1KY7 A;  3ENC A;  2JHJ A;  1YTF A;  3C04 A;  3OH6 A;  3NA5 A;  1R4X A;  1VOL B;  2FUV A;  1VTL E;  1M3Q A;  1P5G X;  2NOI A;  2H5A X;  2Y8L A;  4QG5 A;  2JHN A;  5BMN A;  1P5D X;  4ROE B;  2NOB A;  2OOX A;  1LXT A;  2NOL A;  2V92 A;  2NOE A;  2HZM A;  2NWV A;  4HJH A;  5KL0 A;  1PCM X;  2D0A A;  2IV8 A;  2IV9 A;  4ROD B;  5F9C A;  1HU0 A;  2HKP A;  5EPC A;  4DUL A;  3ENO C;  3OSE A;  1XSZ A;  1QNC A;  3BKQ X;  4IL8 A;  4Q11 A;  2D0C A;  1QNA A;  1UT7 A;  3KRM A;  1J3M A;  1KFQ A;  1KYU A;  1PCZ A;  1KYD A;  1KFI A;  3F10 A;  1V5S A;  1RM1 A;  1T6A A;  3CWS A;  2QR1 A;  1N39 A;  1QTS A;  1AIS A;  3OGD A;  3TDH A;  4B0A A;  1UT4 A;  1QN9 A;  4BJU A;  1N3A A;  2FKF A;  2V9J A;  1LWV A;  1WJW A;  2NVM A;  1KYF A;  2PWW A;  3VN5 A;  4EAK A;  3CWA A;  2DKD A;  2FKM X;  3H1Z A;  3HS9 A;  4CFF A;  2QRC A;  2O3O A;  1W80 A;  1D3U A;  1TGH A;  3EIK A;  1YQM A;  4MRQ A;  2D0B A;  2EHB D;  4D7R A;  3F0Z A;  3D4V A;  1YTB A;  1TUO A;  4ROC B;  1WQA A;  4EJY A;  2NLV A;  3ASM A;  1NH2 A;  2G30 A;  1C4G A;  1QNE A;  1QN3 A;  2I5W A;  1EBM A;  1EUV A;  2HZS A;  2ZFD B;  1E42 A;  4I8O A;  1VKL A;  3RPJ A;  5JN5 A;  1NVP A;  1JDY A;  2R5X A;  3OLP A;  3PMG A;  1JFI C;  3CVT A;  1QN5 A;  2FGT A;  2NOZ A;  4WXA A;  5IYC P;  1YQL A;  1CDW A;  2OOY A;  4EAJ A;  4EAG A;  1UL7 A;  1QNB A;  5AN4 A;  5JMV D;  1PCJ X;  1NGM A;  2HL8 A;  2Y8Q A;  1M5Q 1;  3ULX A;  1B9K A;  3OSM A;  2NOF A;  4WZS D;  3D7Q A;  1K35 A;  3DPU A;  3PDK A;  1C47 A;  5BMP A;  3TE5 A;  2V8Q A;  2LAE A;  1FN7 A;  1QTP A;  2QLV A;  1MP9 A;  3RSM A;  4PY5 A;  2YH5 A;  5IYB P;  1LWY A;  1VOK A;  3EAY A;  2JPI A;  2F7L A;  1QN7 A;  3I0X A;  3HS8 A;  2QRD A;  1M3H A;  3CW7 A;  4C7P A;  2MZ8 A;  2DKA A;  3OST A;  1PZD A; 
#chains in the Genus database with same CATH homology
 2VJ0 A;  1TBA B;  1YQK A;  3N89 A;  2MJ7 A;  3DPT A;  4TPS A;  3SNS A;  3OC3 C;  1KY6 A;  1VTO A;  2NOH A;  1TBP A;  2XHI A;  3IH7 A;  1C9B B;  1QN8 A;  1KO9 A;  1N3C A;  4EJZ A;  1LWW A;  1QN4 A;  3KTU A;  3OCI A;  1YQR A;  2JOI A;  5IYD P;  3I0W A;  2Z8U A;  1QN6 A;  1KY7 A;  1YTF A;  1R4X A;  1VOL B;  1VTL E;  1M3Q A;  2NOI A;  4ROE B;  2NOB A;  2NOL A;  2NOE A;  2HZM A;  2D0A A;  2IV8 A;  2IV9 A;  4ROD B;  1HU0 A;  4DUL A;  1QNC A;  4Q11 A;  2D0C A;  1QNA A;  1UT7 A;  3KRM A;  1KYU A;  1PCZ A;  1KYD A;  3F10 A;  1RM1 A;  1N39 A;  1QTS A;  1AIS A;  4B0A A;  1UT4 A;  1QN9 A;  1N3A A;  1LWV A;  3VN5 A;  1KYF A;  3H1Z A;  3HS9 A;  2O3O A;  1W80 A;  1D3U A;  1TGH A;  3EIK A;  1YQM A;  2D0B A;  3F0Z A;  1YTB A;  4ROC B;  4EJY A;  3ASM A;  1NH2 A;  2G30 A;  2I5W A;  1QNE A;  1QN3 A;  1EBM A;  2HZS A;  1E42 A;  4I8O A;  1NVP A;  3RPJ A;  1JFI C;  1QN5 A;  2FGT A;  2NOZ A;  5IYC P;  1YQL A;  1CDW A;  1QNB A;  5AN4 A;  1NGM A;  3ULX A;  1B9K A;  3OSM A;  2NOF A;  4WZS D;  3DPU A;  2LAE A;  1FN7 A;  1QTP A;  1MP9 A;  4PY5 A;  2YH5 A;  5IYB P;  1LWY A;  1VOK A;  1QN7 A;  3I0X A;  3HS8 A;  1M3H A;  2MZ8 A;  3OST A;  1PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...