1QN6A

Crystal structure of the t(-26) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
SKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tata box-binding protein (tbp)
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 46
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn6A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn6A02
1B9KA 1QN5A 2D0CA 1QNEA 1QN3A 1TBAB 1KY7A 3H1ZA 1KYFA 1YTFA 3VN5A 5IYCP 4WZSD 1KY6A 1NVPA 4PY5A 2G30A 1JFIC 1CDWA 1QNAA 5IYDP 2Z8UA 4ROEB 1MP9A 1VTOA 3ASMA 1W80A 5IYBP 1NH2A 1PCZA 1TGHA 2D0AA 1QTPA 1R4XA 2MJ7A 1C9BB 1D3UA 1KYDA 1RM1A 1QNBA 1QN4A 2D0BA 1QNCA 2VJ0A 1QN6A 2IV9A 1AISA 3OCIA 1E42A 3HS8A 3HS9A 1QN9A 1VTLE 1VOKA 3EIKA 2IV8A 1QN7A 1YTBA 1NGMA 1PZDA 4B0AA 1KYUA 1QTSA 4RODB 1QN8A 1VOLB 1TBPA 4ROCB 3OC3C
chains in the Genus database with same CATH superfamily
1B9KA 4C7PA 3UW2A 1KYFA 1UL7A 4WZSD 2DKCA 1QNAA 1CDWA 1M5Q1 1KFQA 1C4GA 1VTOA 1NH2A 1PCZA 4EALA 1C47A 2YH5A 3ULXA 3SNSA 2H5AX 1KYDA 1K35A 5BMNA 3I3WA 5JN5A 3CVSA 2Y8QA 1M3HA 2HKPA 3C04A 2NOLA 2QR1A 3PDKA 1QN9A 4QG5A 1QN7A 3OSEA 4EJZA 1NGMA 4MRQA 1QTSA 2XHIA 1J3MA 4ROCB 3NA5A 2NOIA 2HL8A 1QN5A 2D0CA 3CWTA 1KY7A 2NOHA 1N3AA 3VN5A 5IYCP 3OH6A 3D4VA 1LWWA 1JFIC 5IYDP 3I0XA 2FKFA 4EAGA 1XSZA 1UT4A 1LXTA 1MP9A 2NLVA 4IL8A 1R4XA 2JPIA 1EUVA 1P5DX 2HZSA 2V8QA 2NOFA 2MZ8A 1K2YX 3OSMA 1KO9A 2IV9A 2H4LX 1E42A 3HS8A 4HJHA 3OLPA 3KRMA 3OC3C 4EAIA 3KTUA 3ENCA 3HS9A 4D7QA 3CVTA 3EIKA 1UT7A 2JHNA 2ZFDB 3OSTA 3OH9A 1PZDA 4CFFA 1YQLA 4B0AA 2JOIA 2V92A 4WX8A 1QN8A 1VOLB 1PVSA 1AISA 3F0ZA 2Y8LA 3F10A 2JHJA 2O3OA 3D7QA 4Q11A 1TBAB 1MPGA 3H1ZA 1YTFA 2LAEA 2QRCA 1PCMX 4PY5A 2EHBD 5F9CA 1Q9UA 3RPJA 4D7RA 3CWSA 2OOXA 5JMVD 2NOZA 3ASMA 1WJWA 1W80A 3ENOC 1DIZA 1C9BB 3TE5A 4DULA 2QREA 3DPUA 3I0WA 1RM1A 2NOEA 2QRDA 2VJ0A 2NWVA 4TPSA 3IH7A 1HU0A 2NOBA 3RSMA 1TUOA 2HZMA 1YQMA 2FKMX 3DPTA 4I8OA 1YQRA 3EAYA 1VOKA 1YTBA 2IV8A 2DKAA 3CWAA 2PWWA 1KYUA 2R5XA 1TBPA 1V5SA 2OOYA 2QLVA 1QNEA 1QN3A 3CWUA 2I5WA 1LWVA 1NVPA 1KY6A 2Z0FA 2G30A 5AN4A 3N89A 1EBMA 1LWYA 2Z8UA 4WXAA 1T6AA 4ROEB 2HL9A 1PCJX 5HSHA 5IYBP 2YA3A 1TGHA 2V9JA 2D0AA 2FGTA 1QTPA 2DKDA 2FUVA 2MJ7A 5BMPA 4EAKA 2NVMA 5EPCA 1YQKA 5KL0A 1D3UA 1QNBA 1WQAA 3TDHA 1QN4A 2D0BA 1FN7A 1QNCA 1QN6A 1P5GX 3PMGA 3OCIA 4BJUA 3T4NA 4EAJA 3OGDA 1JDYA 1VTLE 1M3QA 1VKLA 3CW7A 1N39A 4EJYA 1N3CA 3BKQX 4RODB 1KFIA 2F7LA
chains in the Genus database with same CATH topology
1B9KA 1KYFA 4WZSD 1QNAA 1CDWA 1VTOA 1NH2A 1PCZA 2YH5A 3ULXA 3SNSA 1KYDA 1M3HA 2NOLA 1QN9A 1QN7A 4EJZA 1NGMA 1QTSA 2XHIA 4ROCB 2NOIA 1QN5A 2D0CA 1KY7A 2NOHA 1N3AA 3VN5A 5IYCP 1LWWA 1JFIC 5IYDP 3I0XA 1UT4A 1MP9A 1R4XA 2HZSA 2NOFA 2MZ8A 3OSMA 1KO9A 2IV9A 1E42A 3HS8A 3KRMA 3KTUA 3HS9A 3EIKA 1UT7A 3OSTA 1PZDA 1YQLA 4B0AA 2JOIA 1QN8A 1VOLB 1AISA 3F0ZA 3F10A 2O3OA 4Q11A 1TBAB 3H1ZA 1YTFA 2LAEA 4PY5A 3RPJA 2NOZA 3ASMA 1W80A 1C9BB 4DULA 3DPUA 3I0WA 1RM1A 2NOEA 2VJ0A 4TPSA 3IH7A 1HU0A 2NOBA 2HZMA 1YQMA 3DPTA 4I8OA 1YQRA 1VOKA 1YTBA 2IV8A 1KYUA 1TBPA 1QNEA 1QN3A 2I5WA 1LWVA 1NVPA 1KY6A 2G30A 5AN4A 3N89A 1EBMA 1LWYA 2Z8UA 4ROEB 5IYBP 1TGHA 2D0AA 2FGTA 1QTPA 2MJ7A 1YQKA 1D3UA 1QNBA 1QN4A 1QNCA 1QN6A 2D0BA 1FN7A 3OCIA 1VTLE 1M3QA 1N39A 4EJYA 1N3CA 4RODB 3OC3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9K A;  1QN5 A;  2D0C A;  1QNE A;  1QN3 A;  1TBA B;  1KY7 A;  3H1Z A;  1KYF A;  1YTF A;  3VN5 A;  5IYC P;  4WZS D;  1KY6 A;  1NVP A;  4PY5 A;  2G30 A;  1JFI C;  1CDW A;  1QNA A;  5IYD P;  2Z8U A;  4ROE B;  1MP9 A;  1VTO A;  3ASM A;  1W80 A;  5IYB P;  1NH2 A;  1PCZ A;  1TGH A;  2D0A A;  1QTP A;  1R4X A;  2MJ7 A;  1C9B B;  1D3U A;  1KYD A;  1RM1 A;  1QNB A;  1QN4 A;  2D0B A;  1QNC A;  2VJ0 A;  1QN6 A;  2IV9 A;  1AIS A;  3OCI A;  1E42 A;  3HS8 A;  3HS9 A;  1QN9 A;  1VTL E;  1VOK A;  3EIK A;  2IV8 A;  1QN7 A;  1YTB A;  1NGM A;  1PZD A;  4B0A A;  1KYU A;  1QTS A;  4ROD B;  1QN8 A;  1VOL B;  1TBP A;  4ROC B;  3OC3 C; 
#chains in the Genus database with same CATH topology
 1B9K A;  4C7P A;  3UW2 A;  1KYF A;  1UL7 A;  4WZS D;  2DKC A;  1QNA A;  1CDW A;  1M5Q 1;  1KFQ A;  1C4G A;  1VTO A;  1NH2 A;  1PCZ A;  4EAL A;  1C47 A;  2YH5 A;  3ULX A;  3SNS A;  2H5A X;  1KYD A;  1K35 A;  5BMN A;  3I3W A;  5JN5 A;  3CVS A;  2Y8Q A;  1M3H A;  2HKP A;  3C04 A;  2NOL A;  2QR1 A;  3PDK A;  1QN9 A;  4QG5 A;  1QN7 A;  3OSE A;  4EJZ A;  1NGM A;  4MRQ A;  1QTS A;  2XHI A;  1J3M A;  4ROC B;  3NA5 A;  2NOI A;  2HL8 A;  1QN5 A;  2D0C A;  3CWT A;  1KY7 A;  2NOH A;  1N3A A;  3VN5 A;  5IYC P;  3OH6 A;  3D4V A;  1LWW A;  1JFI C;  5IYD P;  3I0X A;  2FKF A;  4EAG A;  1XSZ A;  1UT4 A;  1LXT A;  1MP9 A;  2NLV A;  4IL8 A;  1R4X A;  2JPI A;  1EUV A;  1P5D X;  2HZS A;  2V8Q A;  2NOF A;  2MZ8 A;  1K2Y X;  3OSM A;  1KO9 A;  2IV9 A;  2H4L X;  1E42 A;  3HS8 A;  4HJH A;  3OLP A;  3KRM A;  3OC3 C;  4EAI A;  3KTU A;  3ENC A;  3HS9 A;  4D7Q A;  3CVT A;  3EIK A;  1UT7 A;  2JHN A;  2ZFD B;  3OST A;  3OH9 A;  1PZD A;  4CFF A;  1YQL A;  4B0A A;  2JOI A;  2V92 A;  4WX8 A;  1QN8 A;  1VOL B;  1PVS A;  1AIS A;  3F0Z A;  2Y8L A;  3F10 A;  2JHJ A;  2O3O A;  3D7Q A;  4Q11 A;  1TBA B;  1MPG A;  3H1Z A;  1YTF A;  2LAE A;  2QRC A;  1PCM X;  4PY5 A;  2EHB D;  5F9C A;  1Q9U A;  3RPJ A;  4D7R A;  3CWS A;  2OOX A;  5JMV D;  2NOZ A;  3ASM A;  1WJW A;  1W80 A;  3ENO C;  1DIZ A;  1C9B B;  3TE5 A;  4DUL A;  2QRE A;  3DPU A;  3I0W A;  1RM1 A;  2NOE A;  2QRD A;  2VJ0 A;  2NWV A;  4TPS A;  3IH7 A;  1HU0 A;  2NOB A;  3RSM A;  1TUO A;  2HZM A;  1YQM A;  2FKM X;  3DPT A;  4I8O A;  1YQR A;  3EAY A;  1VOK A;  1YTB A;  2IV8 A;  2DKA A;  3CWA A;  2PWW A;  1KYU A;  2R5X A;  1TBP A;  1V5S A;  2OOY A;  2QLV A;  1QNE A;  1QN3 A;  3CWU A;  2I5W A;  1LWV A;  1NVP A;  1KY6 A;  2Z0F A;  2G30 A;  5AN4 A;  3N89 A;  1EBM A;  1LWY A;  2Z8U A;  4WXA A;  1T6A A;  4ROE B;  2HL9 A;  1PCJ X;  5HSH A;  5IYB P;  2YA3 A;  1TGH A;  2V9J A;  2D0A A;  2FGT A;  1QTP A;  2DKD A;  2FUV A;  2MJ7 A;  5BMP A;  4EAK A;  2NVM A;  5EPC A;  1YQK A;  5KL0 A;  1D3U A;  1QNB A;  1WQA A;  3TDH A;  1QN4 A;  2D0B A;  1FN7 A;  1QNC A;  1QN6 A;  1P5G X;  3PMG A;  3OCI A;  4BJU A;  3T4N A;  4EAJ A;  3OGD A;  1JDY A;  1VTL E;  1M3Q A;  1VKL A;  3CW7 A;  1N39 A;  4EJY A;  1N3C A;  3BKQ X;  4ROD B;  1KFI A;  2F7L A; 
#chains in the Genus database with same CATH homology
 1B9K A;  1KYF A;  4WZS D;  1QNA A;  1CDW A;  1VTO A;  1NH2 A;  1PCZ A;  2YH5 A;  3ULX A;  3SNS A;  1KYD A;  1M3H A;  2NOL A;  1QN9 A;  1QN7 A;  4EJZ A;  1NGM A;  1QTS A;  2XHI A;  4ROC B;  2NOI A;  1QN5 A;  2D0C A;  1KY7 A;  2NOH A;  1N3A A;  3VN5 A;  5IYC P;  1LWW A;  1JFI C;  5IYD P;  3I0X A;  1UT4 A;  1MP9 A;  1R4X A;  2HZS A;  2NOF A;  2MZ8 A;  3OSM A;  1KO9 A;  2IV9 A;  1E42 A;  3HS8 A;  3KRM A;  3KTU A;  3HS9 A;  3EIK A;  1UT7 A;  3OST A;  1PZD A;  1YQL A;  4B0A A;  2JOI A;  1QN8 A;  1VOL B;  1AIS A;  3F0Z A;  3F10 A;  2O3O A;  4Q11 A;  1TBA B;  3H1Z A;  1YTF A;  2LAE A;  4PY5 A;  3RPJ A;  2NOZ A;  3ASM A;  1W80 A;  1C9B B;  4DUL A;  3DPU A;  3I0W A;  1RM1 A;  2NOE A;  2VJ0 A;  4TPS A;  3IH7 A;  1HU0 A;  2NOB A;  2HZM A;  1YQM A;  3DPT A;  4I8O A;  1YQR A;  1VOK A;  1YTB A;  2IV8 A;  1KYU A;  1TBP A;  1QNE A;  1QN3 A;  2I5W A;  1LWV A;  1NVP A;  1KY6 A;  2G30 A;  5AN4 A;  3N89 A;  1EBM A;  1LWY A;  2Z8U A;  4ROE B;  5IYB P;  1TGH A;  2D0A A;  2FGT A;  1QTP A;  2MJ7 A;  1YQK A;  1D3U A;  1QNB A;  1QN4 A;  1QNC A;  1QN6 A;  2D0B A;  1FN7 A;  3OCI A;  1VTL E;  1M3Q A;  1N39 A;  4EJY A;  1N3C A;  4ROD B;  3OC3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...