1R4XA

Crystal structure analys of the gamma-copi appendage domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
274
structure length
273
Chain Sequence
MHHHHHHMTRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLYVPARSLPYNQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDTVTMQVTARSLEELPVDIILASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coatomer gamma subunit
publication title Gamma-COP appendage domain - structure and function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 64
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08752 COP-gamma_platf Coatomer gamma subunit appendage platform subdomain
A PF16381 Coatomer_g_Cpla Coatomer subunit gamma-1 C-terminal appendage platform
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1480 Mainly Beta Sandwich Immunoglobulin-like Coatomer, gamma subunit, appendage domain 1r4xA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1r4xA02
4B0AA 4WZSD 1TBAB 3ASMA 1R4XA 1PCZA 1W80A 4ROEB 3VN5A 1QN7A 1D3UA 1QN6A 1PZDA 1KY6A 1KYFA 1E42A 1B9KA 1JFIC 5IYCP 1VTOA 1CDWA 1KYUA 1NVPA 2D0BA 1NH2A 2MJ7A 1NGMA 1TGHA 1QN4A 1QTSA 1QNBA 5IYDP 1QN3A 2VJ0A 3OC3C 5IYBP 4ROCB 1VOLB 1VOKA 1VTLE 1RM1A 4PY5A 2IV8A 1QTPA 1QN9A 1QNCA 2IV9A 1KY7A 2G30A 2Z8UA 1TBPA 1QNAA 3EIKA 1QNEA 3HS9A 1C9BB 1QN8A 2D0AA 1YTFA 1MP9A 3HS8A 1YTBA 4RODB 1QN5A 1KYDA 3OCIA 2D0CA 3H1ZA 1AISA
chains in the Genus database with same CATH superfamily
1UURA 1BLNA 2WZ5A 1HL5A 1QBLL 4FEIA 1U8PB 4K3DH 3BUQA 4GS7C 3N0PB 5JZ7D 2G0LA 3NH7L 3Q8CA 1P4IH 2FJHA 3CWSA 4ZBJA 2AJVL 2X4SB 2BVTA 3QXTA 5INDB 2D4FA 1BDYA 2HJFA 3I6KB 5ICYA 3FTXA 1QLFB 1NMBH 1GZHC 2DS4A 3V5DA 3CLEL 3OKEB 43C9A 1EUVA 2HL9A 5GGRY 5A3IC 3R06B 2XQYK 4HDIA 4QTIL 4NAMA 4I0PD 2DKDA 3KLDA 2YBGA 4PUBH 3RWCB 3VGDA 2O26U 1K35A 5D7LA 2HX9A 4XH2B 4ANVA 1JWMB 3QDMD 4ZTPL 4H44C 2XT1B 1FA4A 1IGFH 4J3XA 3FQTB 1OGPA 3LCYA 1FNAA 4J1UA 3FJTA 4XCCH 1E9OB 5HTSA 2ZX6A 5I76B 1XGRA 4MKMA 4JQIH 4ES9A 4I0KA 4Y5YB 3KDMA 1TQUA 1WS8A 5E8PB 1ZSDB 4CL7A 3C5ZA 4PJIB 1SJHB 3GB7A 4N2BA 1KNOB 1D6EA 2P7TA 3G04A 4U3XA 5AAPA 3MUJA 4UQ2A 1ZHBA 1I8LA 2BOBA 4OJYA 2C26A 5CR8A 5IJKA 3SY0A 2B2XL 3KD4A 3GBEA 5TDOA 4L3AA 1D3UA 4MQXC 1KGYE 1XF3B 3PG2A 3E2HB 4WEMB 2BNUB 3H0TA 3PHOB 1UOVA 3VXSB 1G9MC 4TPSA 2PPFA 1MHPH 2XFGB 2AGJL 4JPVH 4D7RA 4Q4IA 2LVCA 5IVOA 1KEMH 2QQLL 1NUDA 2XWEA 3BO8B 3W9EB 3JV4A 3WTVA 1QFWL 3V0AC 1NOAA 2UX6A 2Z0UA 3WFHA 4LU5L 1KXTA 1TO5A 2OXGA 3FO2B 2Z31D 3QIBC 4B9YA 4G42B 2NMSA 2NT1A 4GIOA 4OGAC 3TV3H 1MI5E 2MOGA 4PJ7E 1W80A 5I6OA 1NCJA 2IQAB 3FUEA 1CGTA 3WIHL 5ADPL 2RFXA 1EEUA 2NY2D 4P5SA 2JTDA 3ZQXA 1MH5A 4NM8H 2X4NA 2VDMH 3K0WA 3UO1H 5FO9A 4AM0B 2UUDH 2DM2A 5BXFB 3ROOB 4EI5D 1AO7A 4ZFZB 4Q4EA 3GTNA 1TZAA 5EOQH 1UOLA 3GPEA 2TRHA 4KO9A 4MA1C 3OAUH 1AQMA 3PPEA 4P5TA 1H3XA 1H6TA 4WO0A 5KYXB 1U58B 3Q2NA 3LPFA 4RX4A 3C60A 2PTTB 1DSYA 1JV5B 3MZGB 5BZZA 3S0PA 3SKMB 4YDLB 4Y19B 3MLWH 2G75A 2MH4A 2X4RA 5J6HA 5FO7B 2H5UA 3IN2A 1ITCA 4N5UA 2DMHA 4P2QA 2VKWA 4TSBH 2L8AA 1NEZG 2N1KA 4R8WL 5F72S 5DJ6B 3RVVD 2AJUL 2QHRH 5EEYA 2Z65C 1G1CA 3ZTJG 2N01B 1DR9A 3HRZB 3RJQB 4JFWA 5EZIH 3N85H 2KDGA 3EYQC 3J2PA 4LRNH 5GGQL 2TRYA 3Q7JA 4NIKB 1FC2D 1OAQL 3F7LA 4QO1A 2CGYA 2MCPH 2NY5H 4LHJB 8FABB 1FO0L 5CHNB 1NAMH 2DQGL 3KCWA 5MERB 1XZ0A 1R3HA 1A14H 2AXJA 2LLNA 3S5LB 2E7HA 4TXVB 4DKFL 4GUQA 5PCYA 5I17A 5DYFA 1LO4H 3JWDL 1PGRB 4OLXL 3NDZE 1OF0A 2B5IB 4NHCH 1SEBA 1QQDA 3NK4A 5FDWB 4Y2OA 2A9ML 2EHBD 2VN4A 1NCDH 3RZWA 3DV4B 4HUKB 4PAZA 5C86A 4PJBB 1NCBH 3WY3A 4MAUH 1AOHA 3V0JA 1BQRA 1FLRH 1WFTA 2AQ1A 4R83A 4R0LC 4QRUB 5E4IA 3KXFB 5D7IE 1RZKL 5D9SA 3RDTA 1H3VA 1HHGA 4JQVC 3X1NA 3VXQA 4WJ5B 5DZNA 5HYSA 1GMIA 4K8RH 4I3GA 4WEEA 3OLPA 4U6HA 3EYSL 2EDKA 4IMLA 4C7PA 4AWJC 4WI9A 4GKSB 4R4FL 1QBML 3QRLA 5J9PB 1MLBA 3KGUA 5C0ND 4F8TA 4AIEA 2NLVA 5C1MB 1RIVL 4Y2DA 2ZG3A 2FX9L 2J4WH 4JY4A 2X6BA 5DHXB 3ZDZE 3NFNB 4EI6A 4AENB 3ZDXB 1AQDB 3CU1A 3K8MA 1QNAA 3HZVB 1LWWA 2VLLA 2ZWKA 3WY4A 1I8MA 4GXFA 4FA8A 2J55A 5IT2H 4XVUD 3RG1C 1IGCL 2KPWA 3VDBA 1YDPA 2AS5M 4TL4A 4IBYA 3HMWH 3CSPA 2WINA 3OAWA 5C09D 1I8IB 1DJSA 2EC9U 3MX0B 2BRQA 3B9KB 1NBYA 4U1JB 5BRZD 3HB3B 2AJZA 3QQ4B 3TT3H 3FUKA 2X53A 2ICWA 4HUXA 2VXTH 4N87A 4MGXA 4EIGB 1VOLB 3T09A 1G9EA 2X28A 5D70L 4Y2LA 1BJMA 3ES6B 4EAEA 2CK0H 3IFLH 5C07B 3V0HA 2V4LA 1T6BX 3NAAL 5JXAL 2F8OA 2J43A 5DURD 2WXQA 1WJWA 3QG7H 2OQJB 4NP4H 4TNFA 2RACA 5DD0L 3ZGIA 3BW9A 3KBEA 4X4ME 2GEEA 2KZKA 4E9XA 1AVAA 4MDIA 1FG2A 2AQQA 3F7RA 4L8DB 4NQQA 1UTDA 1CLCA 4A7GA 3BSZH 2CXGA 4BHUI 3L3OA 2N59A 4AT6B 2EADA 4PP2B 1BBDH 4AYDC 3QW9A 4YK4B 1CR9H 4KKQA 4J3WA 4TSCH 4M7LT 4J3SA 3FUNA 3LXAA 1F3RB 1RIHL 3MV8B 4IBZA 4ONHB 4Y4KB 4L3EB 4LPTA 5FUCE 2LAEA 2GIXA 1E50A 2EDBA 1TUOA 3V4VB 2CHXA 3UYPA 4PJDF 4ZDHA 3RVTD 2X9XA 5JNYB 3NEOA 4PYHA 4LSUL 4BCYA 3QWOA 4K2UL 1EAOA 1JFQH 2GKIA 3CXHK 3WL9A 3DA0A 5E6IB 1SJEA 1LK3L 4Z5RB 5DDHB 5AAMC 5BZDA 2P5PA 5EH1A 2ZYHA 3C5JB 1VEMA 2W60A 2BNQE 3MOQA 2M2DA 3L3IB 1SOSA 4M8QB 2QRDA 3D3VB 3OHXB 1E6JL 2CR3A 3GLZA 3QQ9C 1F3JB 4QXWA 3OGCA 4OM0H 1TFPA 3O6FC 4UV4L 5KSBE 1JN6A 2OR7A 1HTYA 2M26A 3TIDB 3MUUA 2BC4A 3L5WB 1UATA 3MODH 3BZFB 4BRJA 1WD8A 4I77L 1OOAA 1BWMA 1I3RA 3TCTA 4J8RB 4XCYA 4PLKC 4AEIH 1G7HB 1WAAE 3P02A 2YPVL 1YUHB 1LWRA 2BHUA 3MRBB 4MJ5B 2EDYA 4Z3FA 3H9SE 4MA8H 1AIFB 3HI5H 2EXTA 4NGHH 5FWQA 3S37L 3DURA 5FF6A 4RGNB 4H8VA 3ZRSA 5EU7C 3IDIB 3VGAC 3V6FA 2WXMA 3GSNH 4YOKA 5EU5B 4E5XG 5I0DA 4ZD3L 4BH8A 1JV2B 1I9RH 2WXFA 4P2RA 2XKUA 4R7LA 1EEQA 3AAZB 1AYRA 3SO3C 3PJLA 4HPHA 1ZVYA 5J3HC 2WKGA 5ACZB 3IDNB 4J23A 5GZNA 1PD0A 4ODTH 3IAGC 3EUUA 3O0RH 4AUYA 2JIXD 4XP1H 3WIIL 5EUOB 1U8MA 4LKCA 3RWFA 5LWYL 4WKXA 1QA9B 3ELQA 4PV8B 3VWJA 2WWMD 1NWOA 4R7XA 1UD5A 3GJFA 1P84J 3UDWA 1QSVA 3ZKXB 1LXMA 1OCWL 4ODWA 5GJTH 1WE5A 1YN7A 4KK9D 3D08A 2QV4A 4N2GA 4YL4A 3QS3A 2R2BB 3GLEA 3BAEL 5AG9A 2YBRA 2UZYB 4PLNC 1PZ2A 4W4NA 5BV7H 4ENED 2VLME 4AC4A 1RIUL 5C08A 1QAWA 4XP4H 2A4ZA 2JXMA 1VCAA 5LVEA 1B2WL 4I3RL 1MDTA 1NFDE 1P2CA 5IR1B 4JFEE 3HFFA 1GOFA 3VD9A 4HX1B 3A5VA 2CJUL 3QCVH 1CUOA 1H8NA 1MHEB 3UC0L 4WU5B 1KTBA 3F7PC 4OIAA 3FUDA 4B9PA 1FYTB 1RUQL 2H3KA 4YZFF 5F1NA 3BKML 1MRDL 3QDJE 4M9PA 3P77A 3MRIA 4TL5A 1QMUA 3I75B 5EU6B 1UXLA 4JMNA 4AV5A 2R1WA 5KBKA 2PYED 1GS8A 3TCXA 2ENJA 2EEBA 3MNWB 3UO8B 2VLRE 1CTNA 5SWZA 3VE0B 2IFFL 2DQIH 4KRPB 4YXHH 1NGWA 2G3ZA 1NIAA 2V2TB 4W9CC 1YG9A 4JY5L 2TSBA 3QZOA 4NZJA 2WMPA 2BSTA 2VRQA 2PWGA 1UA6H 1ZLVH 4KQ0A 5GXBB 4PY5A 3EHBC 4KKCD 3LIUA 2GJ6A 1CLYL 3BGMA 5F88B 3HNSH 3NQKA 3O41B 1FL5B 1A25A 1S7VB 3LKQA 1M71A 1M7XA 4GKNB 4F92B 1O7DE 5C0BE 1DVYA 2ODIA 1TKWA 2HH0H 3QHFL 3BUDA 5CEXB 3BHBB 4IBTA 4KFZC 4XBEH 1ZLSL 4RWYH 4NT6B 4L23A 4AVJA 4I7ZC 5KVEH 2WLLB 4N20A 2MHAB 3Q1SL 5CJQH 3BJ91 1S78C 3OGDA 2A5UA 3B3IB 1IKFL 1FPTH 4M48L 3MV9A 2LVEA 1YEGH 5GRVL 1ZS8B 2HN7A 2CU9A 2XG4B 1UFUA 3IVKB 3Q6GH 4GKZA 1VZHA 1VACA 1LMIA 4W81A 5C9KA 4IEFB 2FJHB 1RZPA 4FNPA 1FNGA 1KLFA 3IBEA 2HJFB 1UM6H 4Y16C 3BN9C 4GRLB 2N0MA 4NAJA 3K2MC 4OTXL 3QJSB 3E6HB 3MXVH 4FFZL 3BQVA 4NN7B 2X4QB 1F8TH 1J8RA 2ZG2A 3JTSA 2JCCE 5JIIA 5LQBH 1KB5A 2F54B 1HZHL 1A7RH 3L54A 4FD0A 4PB9H 4F8PA 1CC3A 2EXSA 1IIKA 5MP6L 3O2DA 1SEQL 3HC3H 4AL8L 1HT6A 4X80L 1D6VL 2V9RA 3KYKH 3OAZH 3PIQB 4JDZA 3O3DA 1D5BA 3QO1A 4KKRA 3I6LE 4X9YA 5TJWK 2Q6WA 4OF0A 5KVDE 1JZ5A 4ZSOA 1TCMA 5T5FH 2AEQL 3BH9B 3IWUA 4YHNA 1I7TA 3SDXB 4MQTB 2F15A 2A6IB 3MV7B 1E5AA 4KZCA 4UQ2B 1ZHBB 3VFNB 1HKLL 4RA0C 4BSVA 2AVGA 2BERA 2BOBB 1A4KA 1JWSA 5CP7A 3ZT5A 5D4HA 3SY0B 3DI3B 2ZUTA 1Y1DA 1DQJA 2JB6B 2H8PA 2DQUL 1XXFC 2ARJQ 3TWYA 1NAMA 5ANME 4XWOD 1G7MA 3GSVB 4ZMPA 2YUXA 5K9OB 3VFRA 2QVMA 2E9WA 3H0TB 1ODAA 3LNEA 2H9GA 3Q2LA 3V5HB 1QW9A 1H6EA 3QH3B 4KPHH 3US1A 4K9EL 5I2IB 3OMNB 3H9HA 1KIRB 3LS5L 3OGOE 5HDWA 3PF2A 4IGBC 3N89A 2I24N 3D8MA 5CILH 3MRJA 2WBKA 4IW4C 2DBLH 3AUWB 1QN6A 2ZF9A 2DD8H 2C3XA 4LCUA 3SY6A 2G60H 4IIZA 2HLAB 5DMGC 1S9XB 1DE4B 4FNSA 1ZOXA 1G6RB 2IAND 4J3OC 3NSCA 1AHWC 2NY7H 3KYAA 4V33A 3K4ZA 2VZVA 3RYMA 2KERA 2BP8A 4QRRE 3JZYA 2W0LA 3ATFA 4YSPA 5EZLA 2FKMX 3V0DA 3F62A 1DBKL 1A6PA 4B0MM 3MU3A 1M7DA 3WTWA 4QRPD 4A63A 2Z1KA 4CVXB 2C9XA 4XMXA 4G6FB 3U4EB 3II1A 2X2HA 5KS9A 1KBKA 3DIVA 4V1DE 1LDPH 5J6HB 2G75B 4GSXA 4P23C 4HIPA 2WTOA 3ULVH 1X5HA 4F7CA 1C5DB 3OD3A 4KXDA 1AFVL 2WO4A 5HD8D 2D7MA 5A2IH 3NABL 3LZOA 2FL5B 4FADA 1R3JA 1C9SA 2F6AA 4RSVA 3TH4T 1U41A 4Y1AE 3RGVD 4B50A 4PGDA 1M9SA 4WEBL 3EAYA 2BO0A 3F3HA 5LB1A 1TTFA 3O3UN 3QQ3B 4P2OC 4ZOAA 3QORA 3HAEG 1PZUB 3JSSA 3QAQA 3DXAB 4L1BA 1R3HB 4D0DA 2DQDL 3BVNA 3CVCA 3LNFA 5C3IA 5I17B 2DL9A 2BS71 2IO5A 3SCMD 2OMXB 2VDPB 1A6VL 3ETBF 5F6HJ 2OCFD 1IAOA 4LEXH 5EORL 3GXFA 4PRDB 4Y2OB 2Y8QA 1DL7H 1IC0A 3BSZA 4KZEL 3HS0B 1N6VA 1PAZA 3SBWC 5FA3A 3NN8A 4JG1H 3VFMA 4FG4A 1FRGH 2AMGA 3VI3E 2B77A 3GS0A 1KCVH 3AREC 4P3DB 5D9SB 5CSBA 1T2JA 4YBLC 2OW7A 4J39A 4NBYB 5HYSB 2WANA 4ZW7A 3TBYA 2EH8L 4OZFG 2OI9B 1MCOL 3KPRE 2QQNH 5HY9A 3K46A 2I07A 4HSQA 4X98B 3UAFA 1AGBA 2QV2A 3FC8A 3N1MC 2ZYRA 4CA4A 1LP9F 5F3HB 4JZOA 1EHAA 3FQXB 4PY7B 5D1ZD 2CHZA 4E0RA 2OP4L 2Y7OA 2NQDA 1NINA 4Y4HA 1UA7A 3HPJB 3OX8A 3TJEL 5CKGA 2DQMA 2XJKA 3ASMA 1UG9A 4LOFA 3JYBA 1GGBH 1Y18B 4JFFE 1J0ZA 2ED7A 5D4IA 3C09C 3U6XA 3CVHA 2A4CA 2GHWB 3REVB 1M3IA 2IALB 2WINB 5JW4Q 2AQ3A 1LEIA 4B3VA 1ETB1 2Z31C 3BLBA 4GUOA 3D1MC 5AL0A 4XZ4A 1B0GA 2AJZB 4DUVA 1LK2A 3HC4H 4YDVB 2DQCH 1GOHA 2EINB 2ICWB 1DQQB 2N7AA 2OCJA 4FG6D 4HUXB 1HNGA 5EBLB 2OZNA 4LQFH 3RU8H 3IGKA 1C16A 1B90A 1XF5A 4K5LA 4P46A 3WCYA 3AB0B 1KENH 1P7HL 3FDWA 3GM0A 4I8DA 3GJEB 3GSNA 3KPTA 1BBJB 3BPLC 3BW9B 3U7WH 5KBLA 4MDIB 5DGQA 5EA0L 4Q8BA 1AACA 4WI0A 2V8QA 5AW7B 5DMJB 4UDTB 2K8QA 2IGLA 4LIQE 1ND0A 3ZE0F 3TN0C 3L3OB 4Y89A 4LLDB 4WWOA 3BKYH 5FHAH 4HXBL 3ZDZB 4A66A 4NQSA 2M1KA 4GMTH 3BUYB 3JVFC 1MPAL 4UB0H 4IKIA 4UUJB 1A7QH 4KKNA 5HHMB 2IF7A 4PRBB 4K94C 3UYPB 3IYLW 2PP8A 1J10A 1Q94A 3K2UH 2AJSL 2Z64C 1ZLEA 2DH3A 3QEQD 5CGMA 3GKZA 4UT9H 3WL9B 3BDXA 4ZRGA 1GHFH 2N1TE 3WTUA 1V3KA 3CFJB 5HHVL 1O9ZA 2WM0A 3IB4A 1SLXA 4ZT1A 3ETSA 5IIEA 4N9GA 2W60B 4I4WA 3U46A 1I7ZA 1QTYT 3O9WD 4M4RB 4U1KA 3ZIYA 4E9LA 5IHUL 3WN5A 4FNUA 1BQSA 4Y9FA 1INDL 1H3TA 1N18A 5DS2A 1JN6B 4J4PC 4K5MA 2BC4B 2ICEA 4U1SB 4Z77B 5IOPA 4TNGA 1ACYH 3DX8B 2JI3A 3N5AA 1I3RB 4NDMA 5DQDL 2YR3A 3FU6A 4GUCA 2BM3A 2EO7A 4W9KC 1UKSA 3G6AB 3RIKA 1UB6A 4B9CA 4BFKA 1H6UA 4PJDE 5G5DA 3RWDA 1TTCA 2W9EH 3VVWA 3O6KH 5I15H 2BSCA 1EHNA 2WSPA 4F8LA 3R4DA 5AALA 3T4YB 1CT8B 1QASA 1XB3A 3PQYA 3V6OA 1IUZA 3UROR 1TENA 4G6ML 3FRPA 4GSRA 1PL3A 3SPVA 2Z4QB 2R27A 4U3SB 1UM4H 1P4IL 5E08H 2AFNA 1GZPA 4TNWK 4OQTH 5HGDB 1ILUA 1NMBL 5TQ0H 3QEHA 5LG6A 1W6WA 3MYZA 2Y8LA 3RUGA 3QPQD 4ZMLA 1ADWA 1GMEA 1YJDL 4PUBL 2BNQB 2G3XA 2W38A 3L4VA 3VXRE 4DIXA 2D0FA 4W6YB 1A3LL 4EN2A 1BQLH 4QY8B 2WXJA 1FZJA 3WIAA 4OZIF 3RX7A 3FB5A 1UGNA 4TUOA 2X40A 1YQMA 5KSBB 2IH8A 5E5LA 1OTTC 1R1CA 4KXAA 3Q9QA 4QOKA 4YHLL 3KZ8A 4FTVA 4NXKA 2ZUXA 2YPLE 3QZPA 4ZXBD 4PGBB 2HWZL 5M94B 4QHKJ 4WK0B 5DQJB 4Y4FA 5DJXB 1E2WA 2XV2A 5T1KA 3P40A 2B16A 3ECWA 3QIUA 5HPMB 3UOAB 3FH5A 3L95A 3NJMA 2O1AA 3DPUA 2WCPA 5DHVH 2YARA 2HTLD 1E90A 1JZ8A 1NKRA 2HRPH 3AWGA 3Q8BA 2RALA 2ZXDA 4UQAA 2CPUA 1TZGH 2ZCHH 5E4EB 2VH5H 2VWEE 3BPCA 4LEEA 2E86A 5JIQA 4FNLL 2Y7NA 3WXVH 1O7SA 5B1JA 1DQLL 2DB8A 3ILDA 2WWKT 3M6DA 3T6QC 4BFFA 3L3JB 1A1NA 3G5YA 3JXAA 1RJCA 5EEVA 2XNAA 3UYRH 3S8GB 3RWEA 4LLUB 4TQ8A 3RHWF 5SWZB 4ONFH 2O6DA 4LKXA 1DJYA 3VFGL 43CAB 5JMVD 1EA9C 2WNKA 4ZOEA 2B1OA 1JI1A 2CRZA 3ARGB 2WMPB 3KWWA 3NCWA 5AZUA 2FJFA 1M5Q1 5K9KA 2JCWA 5FV2A 4YHIB 4GQRA 4PI0A 4LLMB 1JXJA 3BGMB 4P8QA 4I18C 5HHOA 3TZVC 1X44A 4F93B 4W70A 4YZFE 3KVDD 4HHGA 1MW2A 4Z18A 1M71B 3C5SA 3TBVA 4JCWA 4JY6A 4WJKB 4IBSA 2MCAA 2Q8AH 3O2WH 3RVUC 4BSWA 4JCMA 4WI7A 4YGVA 4Z7VB 1NFDB 4XXCC 1U8CB 5F7EL 3W82A 3WG7B 1KB5L 2O5XL 4IBQA 1NCCH 4L9DA 5E8EA 2IFGA 3QRGH 2R7EA 3KYOB 1JNLH 4U1NB 1PJ9A 3X13A 1ORQA 2VXVH 4G8IA 2CSPA 2HN7B 3MA9H 4WNJA 2NY3B 3O2DL 5AVZB 3U9UB 5I6KA 5A2AA 3RY4A 3HBGA 1EPFA 3H7BB 3ATEA 3BEWA 4NKOA 1KLFB 2OTUB 3P4MB 5LDUA 3PAVA 1SHMA 5E8DH 2CO2A 2RJMA 5I8OH 4UBDD 1OGAA 4DPAX 1U33A 4X5XB 2AEOA 2H3NA 4PS4L 3GIVB 4GYBA 2BX5A 1UM5H 4UM9A 1MPGA 1KGJA 4IRJC 1S9YB 2PWHA 3E3QC 4MHHI 1WD9A 5C0CD 2EQDA 1A1MA 2VLRB 5A16B 4DP7X 2DTMH 5CCJA 1KB5B 5AOJA 2MCPL 2NY5L 1U93A 4PJHA 1A14L 3O3AA 4ABQA 3C6LC 4JS7A 5JPNA 3I3EA 2DWSA 4X4XB 1LO4L 4F24A 3QO1B 3TCLA 1T5WB 5IJDC 5D72H 2D7TL 1JG9A 1MCCA 4G1MB 3RL1A 2WWMC 1BYPA 2Y3NA 3FT4B 1OB0A 4LNRA 1A8ZA 3L7EA 4NZ8A 5IB2A 4EIZC 5AAWA 5D7LD 4KI5F 4KK9C 4NQVB 1A4KB 1FFRA 5BVJB 2X4OB 1QUNA 2P8PA 1DQJB 1JHTB 1FLRL 3DVGA 5TH2A 1EHLL 2P26A 1AGEA 5IESL 1FH5L 2EJ1A 1A65A 4XOAA 1N0LA 3VFRB 1DLHA 4LCVA 1RQ5A 2PO6A 2UWEA 1X4YA 2H9GB 1MP9A 4YHML 3C5ZD 1E7UA 4GAYA 2N7SA 3ZKMC 5AVYB 2VL4A 2YQ2A 4UCFA 2WQRA 4NZRL 5AG8A 3K4AA 4A2DA 1G4RA 5HHXH 1PZDA 1DVXA 1B9KA 4HJSA 1P69B 3T4AC 4L05A 1OIOA 2J4WL 3NIFB 4HEME 2J20A 3ABMB 4DGWC 5AW9B 1SF5A 4OLUL 2VXUH 4S11A 4U1MB 3VGBA 3GLDA 3GO1L 1CDUA 2X4UB 3RZCD 4L29A 2F58H 4HIIA 2C3VA 1AJ7H 3SQBA 5IT2L 1BD2A 3HMWL 1ZV9A 4KVNL 1DO5A 2UY7B 4LOUD 3PL6C 2H4EA 5DJAA 3VD2A 1MG2C 1IFRA 1MCEA 4G8GE 1N2RB 3BPOC 1DTUA 5ETUB 3F64A 3GMLB 4ZOCA 4WCYH 5EZLB 2DMCA 1CFVH 4OLWH 4ZS6D 4NQDB 1CIDA 3SNSA 2WP3T 4MFHA 2X87A 5EF0A 4XXDA 5AYUH 3T6WA 3TPUA 3LNDA 2ADGB 2ZIDA 1WFNA 3FS9A 3GUTA 2WK2A 1UQSA 1E6OL 1B0RA 3H3PL 4AVIA 1N3CA 3HHSA 1K4DA 1EBAA 1OT1A 1RZJC 1OCRB 1T5XA 1UC6A 2D9QB 1MZZA 4FXGC 2NW3B 1JGIA 3IKKA 3VXUE 3ZSSA 3GINA 1YTBA 3B83A 3CQFA 4AQ1B 1XIWA 2V5TA 1NGXB 1WIOA 4PRPA 3M17A 4QDGA 3BSZL 1AO7D 1JCVA 3HBZA 4WW2A 1R3JB 1WZAA 1NEZB 1RD6A 2X5PA 2BIIA 3MRNB 2EVHA 3BWSA 2E4TA 2P44B 1KJMA 2XBZA 3LB6D 3PGFL 4G6JH 5E23A 1DN0A 4P5TD 4WO4A 3G6DL 4ISVB 4RX4D 3C60D 4TSCL 5E00A 3T0EB 4ROCB 2X6CA 4KY1H 4PLJD 5C0GA 4P2QD 1YEFH 4W68A 1V27A 1IAOB 2FQGA 3HOGA 3LVEA 3IJSA 5D7HA 1ZK9A 3WHXA 2J7LA 4BWTA 4NI3A 1XF2B 3PXJA 2JJSA 5GS1A 5GGSA 1JFQL 5EWIH 3ZN6A 1MIML 4IK7A 4YMPA 1WBYA 3TX4A 4A55A 4MD5B 4B0MB 1KTLB 4LK4A 1YMMA 4JB9H 5FA3B 2NY1D 4LDLB 5EBMA 3J27A 2CUIA 5B1AB 3FSVA 5JQ6H 3OB8A 1MY5A 5D96C 4BFBD 2L7QA 2QMJA 3NRQA 2ILLA 3IT8D 4U33A 3QZNA 1ET5A 3CVHL 5C0AA 5FYLE 4L4VB 1CFNA 4PR5A 2GABA 4WZ9A 3UADA 1IAII 3EFFA 1AGBB 3ARBA 3QJTB 3IN0A 4UT9A 5JHDE 4N2HA 3WYRA 2ZX8A 1HU0A 1NIBA 3BOVA 4KRNA 1A3ZA 4KJQC 2XDHA 5JW4R 1X5ZA 4E0RB 1HILB 4MA8L 1Z9SB 2ADIA 3HI5L 2GY7B 3LKNA 4LOEA 3RDTD 2WO2B 1ZLVK 5F6IC 2OMYA 5J89A 3EJPA 1WWAX 5L6YH 3MXWL 5AFAA 4MZ3A 2DICA 3V55A 2GYSA 1PLCA 2W65B 3IAPA 3O8XA 5I9QB 3QS2A 1H5BB 3JWNC 3N1QC 3OVUB 3BVDB 2XN9A 4JPWH 1U6AH 3QUML 4KZDL 1QVOB 4V2CB 2FR4B 2VDPH 4Y2DD 3MJ8B 5E2UL 5H35B 1BSIA 2A0LC 4P5MA 4UIKH 1LK2B 1UD2A 1WVZA 3OKMB 2EDEA 3D30A 1LP9E 1C16B 1TMCB 1C7TA 2WZ6A 2O5YH 4P46B 4ELKA 4NNYA 1IQDB 4OCWL 1E7VA 4OF8A 4QTHB 1FNEA 3D2UA 3F7KA 3BUPA 3BVUA 4TQEH 3BKQX 4LDEB 3L17A 2MQCA 1XD0A 4GAJH 3QUMB 4GRWF 4I2XA 3RVXC 3B5HA 3KPRB 4IOSA 3ZE2F 5BV7L 4X99B 4M5YL 4WY7H 3D51A 1N6QL 1KTKE 4KBPA 1Z9OA 2Y7MA 1YYMH 1G7QB 4MNGE 2E46A 1FJ1A 1O6SB 4ZNCD 2Y7QB 4NPKA 3DLQR 4JFHE 5E4AA 4A7TA 1QN7A 2APWA 3QCVL 4JFUA 4NQSB 1QEXA 3V8OA 4LVOC 1CBVH 4HKBA 1RPUA 2LTQC 2R0WL 1XB6A 1RU9L 3UTSE 3R1GH 3ZVVA 3TDHA 2DEYX 3SYCA 4AYID 5GGVY 4JFFB 4XNUL 3ZMRA 7TAAA 4HOZA 2C1OA 3LH2H 1JK9B 3US9A 4GAFB 4LCIH 5AVRB 1IFHL 3AROA 4NERA 4F3FA 2OTWA 5J8OA 4M6OH 5MEPB 3TBSA 2J1KA 3VO0A 1GOGA 5IEHB 2CRIA 3SCMC 4GW1A 2OZ4H 2FWOA 2VC2H 3U46B 5F9OL 4GUPA 1CLOH 4PJAB 1WEJL 3L9RB 4JL2A 4QHLB 5JW3L 5MI0B 1J3MA 3UBHA 5ISZE 1UA6L 2XVGA 3TNNA 4NO3A 4Y1SA 1XHHA 4N5EC 2PW2B 3GMMA 4QNPF 2GY5A 5F70A 1GC1H 1CO1A 4G6AD 1IBGL 4JO8A 4Y88A 1YC8A 4X7CC 1JFHA 1IB5A 1SJMA 5G5DB 4I1RA 1KB3A 4JKPL 4NWTH 4LMQE 3MROB 2J1XA 5CJQL 1GYCA 2P43B 1J5DA 5ABAA 3CH8A 4NO2A 4QRQA 1YEGL 3ILPB 4E9QA 3H2PA 5D5MF 3Q6GL 2V7NA 3IPBA 4OI7A 2L7JA 3EDEA 1NAKL 2R4RH 5I1EL 4N26A 6FABH 1UM6L 4EJZA 3K6OA 1NCWH 3EOTL 3OXRA 4UI2A 5AYTA 1BQ5A 1KPUB 3RUGB 3U30C 1QFUH 4IDJL 2YIHA 4DO6A 4IIQA 4H88H 1AHMA 2YGOA 4MCYA 3PP4H 4XVTL 1SZNA 4O2CA 1NH6A 3F01A 2EYSB 4PB9L 5TE7H 3VXPB 3WHE0 4BJLA 4ZMYA 5IVZA 2QR1A 2EKJA 3MRQA 1PF3A 2FIRT 3JV0A 3WGUB 2E7LA 4FG6C 1CFTA 4P2RD 4QOKB 4ERSL 3EOBB 3F65A 2APSA 5GZND 4L4TB 1D3CA 4YBQD 1HXYB 3NTCL 2WXHA 4Y4FB 4U1IB 1R33A 2WBWB 1USQA 4UTCA 3VWJD 2NY4D 1A7NH 2J88H 3LKRB 3EJRA 3B1UA 3D0AA 3TT1H 3RGBA 2OK0L 1A7OH 5FYJL 4F2MA 4U6YB 3KPMA 3UTTD 3TNMA 5ERWA 1FGVL 1MWAB 1RK7A 3P0YH 4OZIE 1QPKA 4HT1L 3QUZC 5EO0A 5C08D 3PV6B 4F91B 4KPHL 3QI9B 4RMTA 4HOMA 2MFNA 4CC0A 3ULXA 3STBA 1VF5C 5FCSH 5FUOH 1E4WL 3KPSA 1JXGA 1T20B 1T0PB 4C56B 3MC0A 4YR6A 1MFDH 4OD2A 5SWSA 4GSUA 3M8OH 3L45A 1A7PH 2AABH 4YSTA 4G5AA 3QULA 4JDEA 3CXHJ 3LNIA 4CILA 2E59A 3RE0A 5IB5B 2DLHA 1HINL 5JPMA 5C97A 1VIWA 1LEKB 1N0XH 2G60L 2MQGA 2VUOA 2GK2A 4JMXA 4LARL 5CD5C 5HYJE 5JDSB 3BZ5A 2WGXA 1BMWA 2WTRA 3CFEA 3LHPH 3UMTA 4AIZA 2HT3D 5KSVB 4LCYB 4LSQL 3TBVB 4LL1A 5SWZD 4TUUA 2N7BA 4WX8A 4JY6B 3HC2A 4OGQC 1YEHH 3OH9A 4QXVA 4QHMB 2G9HA 4N90D 1KC5L 3ECBA 1P5GX 2A9BA 2V8LA 4G8IB 3MKKA 5GZOC 5L0QB 4JM4H 1IKNC 2GJ6D 5F21B 5DWPA 4HWUA 3IXAA 3ZUCA 4A2MA 4EQ2A 1I7UA 4NKOB 1LDPL 4A6YH 4ALAC 2VDNH 1LWVA 2C4FT 4OT1H 5I1IH 4YDIL 4L9LA 2D7PA 1VFUA 2FJGA 3SQRA 5CINH 5I1GH 3MPCA 5BOZG 1HQRA 1P5UC 5FOBA 3Q5YA 2ZSVB 3MV9D 5HHQB 4D0BB 3WS3A 3OXSB 4AVKA 5EFIA 4DSYA 3T08A 4GEJA 2ZWYA 2J25A 3QPQC 2KLTA 3RX5A 4JZJA 3ZIMA 1ZVHA 2DQFA 4TN9A 3O2VH 3FCSA 4GFTB 4LGRB 4NJ9L 1KXVC 2EXYC 2OJEB 5B3NA 1XSJA 2DQJL 3RL1B 3FO0L 3OC5A 4LFHG 3HZ3A 5F96L 3ZR5A 3H3BC 4Z7NF 3O0LA 5CEZH 5IB2B 1X6NA 4OI8A 4PVMA 4O2FB 4X6DF 3VB9A 5T1MA 4ETQA 5J11C 3GSWB 3PWLA 4CU8A 1CDYA 1QUNB 2P8PB 3PWJB 3EO1A 1QR1B 1MUJB 5JIPA 2CR0A 1LE9A 1PZSA 4RAVA 1UZ8A 2IADA 3RDJA 3CHOA 1JHKH 2PCFA 1DLHB 1KPRA 4BQ9A 2NX5E 4CMHC 2HTLC 4GAYB 2IXQA 4WTZA 5F44A 3CSGA 3UZEC 2ZTBA 5I1DA 5TQ2H 4UYPA 1BZ7B 4WFHD 3ARDC 4ZO7A 3QXAB 3CFKB 2ESVE 3OR6A 5ALCH 4JW3A 1F6LL 3RPBA 4JM2A 2J2ZA 4B9GA 2HPOA 4BHUA 4KI5E 3DRQB 2EYRB 2DMKA 4L29B 2Z0FA 3SQBB 4OFYA 5F6HI 2CDEA 5B1KA 2WCGA 3WEOA 2ZKHL 1HHIB 4Q6IC 3D69A 1NGZA 2E6JA 5E2WL 3ARQA 3DSNA 3BP5A 2UZIL 1WP6A 2EE6A 3V8CA 4XI5C 5A6IA 2HT2C 1MCDA 4AGQA 3HC4L 2R23B 1G7PB 4ZO9A 3D39D 2DQCL 5F0MB 2J8UB 3MRDB 4NQCA 3B7RL 1HU8A 4LQFL 2H6PA 3RU8L 1DQKA 4K73A 4CW1A 3GUTB 2F61A 3H6JA 1HJCA 1KENL 5C6WH 5C0JB 2VYRE 3CV5A 4YVUA 1B0RB 4ADIA 1YTFA 4K8RD 4EJYA 1FC1A 1FAIH 2ORBL 3FO9A 3MREB 1J5IA 5IOKA 1K4DB 1T5XB 3BVXA 4UM8B 3TA3B 5GS0H 3U7WL 4ESKA 4K3JL 2K1MA 3B7UX 3NJIA 1MI5A 4N0FB 5C71A 4PJEF 1C8PA 4Y5XB 2CCVA 5KYUA 3F7VA 3AABA 3G6JF 1EGJL 4L8CB 4ZAKB 1HSBA 5HI4D 3BKYL 4M3HA 3S9DB 1KJMB 2OYLA 4WO4B 1AR1C 3I6GA 1LWJA 3TE5A 3DJZA 2PMZA 1RUAH 2PN5A 3CN2A 3QA3B 4OVVA 3ALPA 2TSAA 4ZZFA 1P5DX 2EIBA 3K8KA 3LD8B 3NSXA 4GG6F 1A9VA 4XCNB 1R5WA 3IJSB 3K2UL 1OOWA 5E56A 3WHXB 5JIDA 2OMWA 3IXTB 3LH8A 4UT9L 2OYPA 3FK3A 3EDJA 4YL9A 4OGYH 3QIWD 6PCYA 5KVDH 1BYOA 3IWVA 3MLRH 4MRQA 4BK5A 3QORD 2XWJA 3HW7A 1TVDA 4FQ1L 2WN3A 4PRIA 3RNQA 3FU9A 2EIKB 3MBED 3GRBA 1PFCA 5FK9A 4PMEA 4OAWB 1BV8A 1S7SA 4UU9A 4F7EA 1NM4A 4P99A 3T6XA 4MXQC 5I28A 3DO7A 1RFDL 3CFQA 5FYKE 3BEVB 4FXKC 1SOQA 1IBFA 2DYSB 1RJLB 2GBUA 3EFFB 5EOCL 1GPOH 1XAKA 5E03A 4Z7WF 3EH3B 3RPJA 1XH3A 1Q0XH 4EEEA 2EIMB 5I30H 4B27A 2R1XA 3WEAA 3C5ZC 3O6KL 4JM0A 1A4JA 5KOVC 1QNZH 1NC2B 25C8L 2F7OA 4HFWB 2FBJH 3ZTJH 5GRJH 5FA4B 4APXA 5IJKC 2QQKL 2WCSA 2X4TB 3DROA 1UM4L 4JO5A 3QNZA 4FXLA 4J3TA 5D7IA 2AXGB 5DYOB 1G9MH 3UZQB 5EV7A 1IL1B 4HJ1A 4YWGL 1B6UA 2XG5B 4KROB 3MMEB 1T04B 5TQ0L 3H56A 3PJNA 1QYGH 2Z93A 2QR0A 3B2MA 5K33A 3RZCC 3WJLA 3LNGA 3EJJX 3RFZC 5FIEA 2CLRA 4MA3B 1AE6H 4Y4HD 4JREC 1HFUA 1BHGA 5E1HB 5GJSL 2UV3A 3N6YA 5E1QA 4JNXA 1T0OA 1OP3H 3GXPA 3LZQA 4NPJA 3QZMA 1G9NH 4XBGA 5IBLD 3M1BA 2WXKA 2YGVA 1E4KA 1WHOA 3D2UB 2QKIC 2CH8A 4C59B 3PFUA 2ITDA 4MWFB 3BUTA 1PG7W 1AGDA 4I2XB 4UQDA 4TUKL 4HJIA 1ZWIA 3BAXA 1WWWX 4M1DH 2R2EB 5E5UB 3KH3A 3IDUA 3KWUA 4HK3J 4YO0A 3ESNA 3O6MH 4G71B 4H1LA 4MYPA 4HG4J 1ZHNB 4J3UA 2E76C 4HAGA 1F1AA 3PREA 2DQEL 4ZW5A 1W0VA 4QHNA 5T8IA 4ZMZA 1TZGL 2ZCHL 4YXLH 4GP5B 1L9TA 3JT0A 1CD0A 3WY1A 2QSCH 5B21A 3IDGA 3SOBH 1NEPA 2WVVA 4N6RB 2EDRA 2Y5QA 4IK6A 1U3YA 3MZTA 4FQHB 5HVHC 3LS4L 4Y1TA 1EAPA 3T2LA 4RRPG 4X4MA 3UYRL 3TFKC 2H0JA 5JYMA 3ZE2E 3BIAX 2HKHH 4ONFL 4Z3EA 1QRKA 1DEEA 3ELAT 3IAQA 2BIQA 4GUPB 4KQ4L 5E5MA 4GSDL 4NAQA 4NEHB 1VFOA 4JGUA 3QZWG 4MMXA 1LP9B 5AB9A 1CICB 5K9JL 4ACPA 5JLZA 4CJ1A 1U8OA 2CO3A 2IDQA 4XGZA 2Q2EB 2G2RA 3CCHA 4NO3B 5F1SA 4WU7B 3KPLB 2B4CC 1NGYA 1IKOP 2JI1A 3H7LA 3IJEA 3SGKA 2F18A 1HYRC 4ZUTA 2ZYSA 3TBBA 4PS7A 3VN5A 1KOAA 9PCYA 1YNTF 4UAOC 4X7DC 3U9WA 1KT2A 3TPKA 1IQWH 4ZTEA 3QRGL 2P5WA 3L5HA 4NO2B 4IDLA 4QRQB 3BPNC 5C3LD 4XZUA 2VXVL 3U6RA 2V7NB 4CFFA 2ZCKL 3CPLB 3KLKA 4W9FC 1QUPA 3B6SA 2Q76A 2QFPA 5E8DL 4HULB 5I8OL 5IWLA 3PDOB 1XAUA 1S5HB 1AISA 3S88H 4KMLB 1DVFC 3V79C 1FL6A 2R1YB 2XKSA 1QW8A 1DANT 1WAAA 4EDXB 3PQYD 1D5XA 2FX7L 2XCMC 4O2CB 4B5ZA 5JOEA 1S9VA 3SDCB 4DCQA 1N67A 2XY2A 4KHXH 4AGLA 4HLEA 1KGCE 1N12A 2NTSP 2DM3A 3H9SA 4PGZA 2CO7A 2AV1A 5DS8A 5IVZB 3ZE0B 1MVFA 1QZNA 4MDJA 4KKZA 3IEAA 2D2CC 4AZ8B 4F7MA 1IGTB 2ZUQB 1OF2A 5ISZB 4P49A 4LLQA 4A6YA 4FQLL 3VI4E 2RD0A 2WJ5A 3CZFB 5D5ME 1U8IB 2GSIA 3BKJH 2AEIT 4X9BA 3F05A 2FH8A 5KVFE 1X5GA 1YAIA 3FCGA 2E7DA 4FQQA 4KAQL 2XTJD 4LIQH 5I1CH 2GC4C 2H47C 1KBBA 2JLLA 1OY3B 4MVBC 4F2MB 3LZFH 4QWWD 2BOCA 4WFED 3H55A 4FTVD 2V7HB 2BFGA 3AJ7A 4XC3H 1NQBA 5ERWB 4AV0A 3QP3A 3CH1A 3PNWA 1UWGH 2ZXAA 5EO0B 3LKPB 4XHJD 5T1KD 3QIUD 3CZEA 4RETB 5CD3B 4FQ2H 2XV0A 2XX0A 3LMJH 3B5GA 4R2GC 1EMTH 5KSAC 3VM5A 4FJZA 3QYNA 2QDWA 3P3YA 2APFA 4TQPA 3TTYA 1Q9WA 3FRUA 5F1IB 3ARTA 2EIZB 1R0AL 3RIAK 1ED3A 5E2VL 2YD8A 5DMIH 2IWEA 4KQ3H 4APQA 5CBAA 4JFEA 2CGRH 2PF6A 4TLSA 4X6CF 1ZA6A 4BFNA 4MXWL 4L37B 3QNFA 4BH7B 1AJ7L 4MNQE 3GMPA 4XNXH 1TZHB 3AQYA 4G7QB 5EO1A 4HJ0D 3QDJA 2QLVB 5J13C 12E8H 3M86A 4XO3A 1D9KA 4JGNA 4FQPA 3W5MA 4QGYA 1WC7B 3AC0A 4FKEA 1N68A 1CFVL 4KJYA 5DZAA 1OT4A 4OLWL 2XWBA 3I9PA 5F9WB 1HE7A 1RURH 4ZPVA 1R3KB 1KIPA 1OB1B 1BXXA 5GSRA 4P9HC 3MLZH 3NJFA 3CC5B 3MFFA 1S5IL 5HHOD 3ULUF 1QTSA 2BSRA 5CFHA 4TULH 2D3VA 5MHSE 3UBXI 3HZMB 5EBWA 3WJJA 1LO5A 4AX3A 2ZXGA 4JX0A 2J8HA 2QT6A 3PWPD 4TUJB 4U1LA 4YE4H 1U8JB 3WKYA 3O3EA 4WSJA 2BMKB 1ZVSA 1HQRB 5FOBB 3QYMA 4OBSA 1UZGA 5C0BA 4WJG3 2NDGA 5DJ2A 5IMMB 2EIEA 3ALXA 5EFIB 4M7LH 5FGBA 3CK0L 4WW1A 1GGYA 2Y7SA 1MCFA 1BXAA 4A2GA 3WNNA 4P4RB 1B4JH 4P4KC 2ZNXA 4DVBA 3FCSB 4NWUH 1OGAD 4JRYE 2NYYD 3ZHKA 3NJKA 3L1OH 4UM9D 4YGAB 1X6LA 3HPLA 2H4LX 3GHBL 4HV8A 3N2JA 1UCBH 2UVFA 2VLJE 3S4SA 3E9UA 3OZ9H 1ZGLP 4JB9L 2AHIA 1ILSA 1WBXA 4LLVB 1AR2A 2P24A 4YBQC 1YC7A 3FUMA 1Y6NR 2PCPB 2JCCA 3ULSB 2DI8A 1CVRA 2OTPA 2X4PA 4EZKA 4Z9KB 1UZ8B 4FHBD 1VADA 2IADB 1OW0C 4WK2B 1G7LA 3ULVD 2R51A 1AIZA 3FB7B 4OFPA 2DV6A 4N1EA 1GZHA 4ABWA 1ZT7B 4KXBA 4M43L 4TVPL 1VPOH 5HDBF 4C4BA 5FLUA 2AK4A 3EIKA 1T66D 3M07A 1RI8A 1IC5L 4JRXD 3OR6B 3HE6C 1YPZF 4P9MH 1PG7X 4AMWA 5CZXC 1E9PB 2AK1H 3QDGA 5MEQB 1PVSA 2FO4A 4X6DE 3AU1A 2PO6D 3DC0A 3FU3A 5F97E 5AZEL 3UEQA 2CDEB 2F1EA 2OSLA 4IKNA 4JPWL 2NYKA 3OKLA 1NBVL 2Q3ZA 4M5ZH 4NKMA 1NGZB 3S2CA 4FHKA 1Z2KA 4X6BA 5SWQB 5BZWB 1P1ZA 1UT7A 4EIUA 5G4NA 2PPCA 2XIBA 5TF1H 4MB3A 4XBMA 4DUWA 4MS6A 3HKZA 2GC7C 5DRWB 4TRPH 2W1NA 1FFPA 1UACH 2XN1A 2HT3C 4HGMA 5KZCD 2H6PB 4QXUH 2F74A 3RA7L 1BJ8A 1HH6A 3DX2A 2O5YL 5IHBA 5ICXA 1AXTH 1MELA 5HYFA 1BD2D 3L2NA 3ET9F 4KUCD 2W88A 4TQEL 5CS7A 5GGVH 3TF7C 5K9QI 2K4AA 1FWXA 2IOIA 4GAJL 4BE6A 2D3LA 1QR4A 1L7TH 5CSZA 3TASA 4E68A 1K6QH 1WZLA 1ZJAA 3UBGA 2DI9A 1MOEA 3NSDA 3RTQC 4XTRD 2YQGA 3DX6B 1UEMA 2CHDA 4MCZA 4NO5A 2OOYA 3F6IA 5KYWB 4LAJH 4QRRA 4WTWA 3NUKA 2D0CA 1YQVL 3I6GB 3QIBA 1I3UA 3VGFA 1CBVL 3MUHL 2N0KA 5B7EA 1A2YB 2Z7UA 4YQXL 3Q8FA 2X10A 4D9RD 3TVMC 3VNYA 3BCFA 4G43A 1XIWD 1XX9C 1MRCL 3OG6B 1G1YA 3LH2L 3FT2A 4PRPD 1NDMA 2OMWB 4A04A 5AW5B 4V1DA 5DVOA 1ZLUH 3ZPDA 5L4IA 3FSOA 4A1RA 5AOIA 5H37G 3C8DA 3LRMA 3WTYA 4FQXB 3FH8A 2C9QA 4PJEE 5I75B 1DJWA 3VJ6A 1U8NA 2ZYIA 3G6JE 5JO5B 3PP3H 3CFDA 3SZ6A 2IDCA 2NW2A 4Y1AA 4UTBH 5MENB 1JNHA 2FO1A 4LSTH 3ZMNA 4XCEA 4EE2A 1KYUA 3MLUH 2XRAH 3FCTB 4FXTA 2EVIA 2YGQA 1GC1L 3TO4C 3MRRA 4TYUA 3V4UH 2Y36L 4X8GA 3EGSA 4N2AA 5C6TL 4GG6E 1YMMD 3P3SA 4YHKL 1ULVA 2DLTA 4NWTL 3DX7A 5E9DE 1KYOK 3ECUA 1RK1B 2KZBA 3PWVB 3STZA 4MX7B 1LEGA 1SBSL 2IH9A 3VI3A 2WWKO 2Z91B 5C0AD 5KG9B 1UH4A 4UWQB 3V52H 2R4RL 5C0EA 5L88H 3HAEH 4ABUA 4Y2NA 3SDYH 3ARBD 5D71H 1A4CA 4JO2L 1Q9KA 3LN5A 4XPFH 3N3EA 4RISL 3FTVA 1WBZA 2WUBH 2Z93B 1M1XB 1CXKA 4XPHL 5E7BA 4A2EA 3S96A 1ZHLB 1I8KA 1UUSA 4JFYA 2PXYC 4RRPM 4H88L 3K5RA 4Z7WE 2WSDA 1FNSH 3ZT7A 3ZL4H 4R0LA 5AQ0A 4PV9B 3JV6A 3LEVH 3M1BB 3O8XD 3Q3GB 4PJXE 4JQVA 2HL8A 2OYMA 5LXVA 4C47A 2XN9D 4MMZC 4KTYA 1HIMH 5DHMC 2WUCH 5DLLA 1K4CB 2EE2A 2Y1AA 2CALA 1AGDB 5DZ9A 4KTEH 1ZWIB 4LLAA 1SF3A 3PE9A 2O5ZH 1AG6A 4K8RC 1FNFA 4OZFH 4QYAA 5HI5D 1J0JA 3Q44A 3B9AA 3C5XA 4N8CL 2J88L 4H1LB 4B3EA 3QG6B 3D25A 4M5SA 3HUJF 4PJ9B 4BQCA 4F20A 3TT1L 1KO9A 3LRSB 3DDGA 1DJHA 2ZXQA 1W0VB 5DJ8A 1WG3A 1T7ZA 3PMGA 2GITA 5ITFB 2AV7B 3ARSA 5KVMC 3PY9A 2XFXA 1CDHA 3FTSA 2Y1VA 1UGKA 3TYFB 4G7SB 4UT6H 5FUOL 2NLJA 4DN4L 3CFCH 3ESOA 3WUWA 1A7PL 1PFOA 2AABL 1VTLE 4LCWD 3SYQA 5E5MB 1MEXH 1FYHB 2E6PA 1ZEAH 4JFXB 1EFXD 3Q43A 4I3SL 1VKXA 3DNKA 3QIWC 3QZLA 2XHIA 2G2RB 5DI8A 2CCLA 3DMMC 1NBZA 4DKTA 1LQBC 2W8CA 2VABA 4OLEA 4LO9A 1NGYB 1KN4L 1SBBA 4NNPH 1N26A 4G80A 3LQZB 1MCWM 3MBEC 4EAGA 5FYLH 4ZUTB 3NJHA 2K4WA 3T2QA 4WV1B 4CRPA 3EO9L 3D0VA 4BXVA 1NJ9A 1YEHL 3AZUA 1FAKT 1I4FB 3G7TA 4FNRA 1K5NA 2YD1A 3CSYA 2IAMB 3FB8B 1OAXH 1J1OL 2P5WB 5D1QB 2CKBH 1FE8L 3EZJB 1FUNA 1NGQL 4LCCB 3U6RB 2E0PA 5EIIA 2QTVA 5FX3A 1QN8A 3MCG1 5BW7C 4A6YL 5IB1A 2NXZC 3KW8A 4A2HA 1X9LA 4UV7L 3CWGA 3OKKA 3IJHB 2Q76B 3NA9H 3VXOB 1JDAA 1T1ZB 4LSVH 7CGTA 2PP9A 2GTZB 2BVPB 2NY6B 1N70A 4GRWB 1FL6B 5IBTH 1JF1A 3L3GA 5IJCC 4N2OA 5D1XB 1CG9B 4RFNB 3CFBA 1Q8MA 2C3GA 1TT6A 3GFUA 4DCQB 1LLAA 4ZI8A 2O61A 4HA1A 4XB7A 3NMEA 3Q2VA 3BDYH 5DS8B 5A6MA 1ZV2A 2DWEA 1RZGA 1D2OA 1OAYH 3MJ7A 4C4UA 3HA0A 4WDIA 1QLEH 2DYPB 1GYWA 3PS6A 4TTDC 4LESA 1DQDL 1BPVA 4GINA 3WAKA 1QKZL 1N7ML 3L1EA 1JXDA 4GT0A 4YSQA 1YN6B 2OMUA 5EO9A 2O93L 1F90H 2H2SD 2MPVA 1HCZA 5CEZL 5KWYC 3GBNL 4NN6C 4E41E 3OZLA 2WQUA 3ZZLA 2GUYA 2VJ0A 4R4ND 1JUFB 1FORL 1GYAA 4O02H 3SDAC 1JF5A 4EZLA 2N3JA 1HHKB 5CCKL 2CQVA 4Y5VC 15C8H 4FF9A 3SYOA 3VXRA 4XNQA 3PNWB 1EZVX 1L6ZA 5JIKA 4ZMAT 2CDGB 3FO1A 5IW1A 2EO9A 4NOFA 1BM7A 2D4DA 2JF1A 3UZVA 2DKCA 4QT5A 3ERXA 4R5XA 2YPLA 4DUXA 2ID5A 3SE9L 4ZPTA 5DEGB 5HP5A 1FLTX 1ZAGA 3FRUB 1IAIM 3S34L 4CC4A 4KO5A 1HL9A 2VZUA 2ARWA 3JTTA 3LDBC 3TEWA 4LXFA 2GIMA 4JFSA 2C3WA 3SJVB 3NQIA 4F9PC 3VG0L 4JPKH 4N68A 3IGLA 4XC1L 2DN7A 1FGNL 5C2BH 1QSEE 4K94H 3GMPB 2A6JA 2DRUA 3GT6A 5F7AA 1ZJBA 1WDAA 5EO1B 2VXSL 3QJFA 3KPSD 32C2A 4YDJB 1ZSHA 1UJ3B 4JUSA 5D5MB 5E8NA 4BV1A 1UD4A 1DQVA 3CUPB 5SWSD 5J0BA 3GKWH 2NOIA 1NUGA 2H32H 4NZTH 3WJMB 4AH2A 3VCLA 1VGKA 2XWBB 2AQTA 4ZPVB 1UYWH 3M1OA 2IMNA 4RAUA 1FFOA 1KIPB 4B7LA 4K3EH 5IQ9B 2WW8A 4M6ML 2Y9RT 3FPXA 3C6SB 3MFFB 1RJZA 2BSRB 2P8MA 4UYQA 2C7FA 1OM3H 4F1SA 2I5WA 4GQQA 3LQMA 2RQEA 3VMPA 1XBRA 3LAFA 4X6CE 5D93B 4U1LB 5ALBH 4LT7A 1U3HC 1MW0A 4IKKA 5AOZA 2JKNA 4WUUA 4AVHA 4L1TA 3IRPX 3O3EB 4M4PA 4XPAH 2BVQA 1D5MA 3PHSA 3N50A 1GTFA 1BVKB 1OP3K 1KXHA 4RBPK 5GSVB 5LCVA 4BWWA 3I74A 3F6LA 1Q72L 2VMJA 1JRHH 2FHFA 2XN2A 3CSTA 5AOLA 5L2KD 3BFWA 3GI9H 3IFNH 5E6YA 4BUHA 1BP3B 4PJ8C 1G9HA 2IDFA 3SHSA 5KYYB 2NSQA 4MNQB 5E94A 2OR8A 4JJ5A 3W1ZA 1SYVB 3ULUE 5I74C 1EAJA 5DRZB 4OGYL 5GGTA 4LLWA 3MCLH 5KVDL 4BSJA 2NOEA 1IE4A 3NJJA 3MLRL 1J8HA 5IHWA 4YIQB 5D8JH 1QG3A 4N3TA 1MN4A 2XWTA 4HIJB 3HI1A 1FHGA 1HNYA 4GS7B 4MTMA 1T22A 4KK6D 4NPYA 1VADB 3KCPA 4QUOA 5LXGH 3BD5A 3A6OA 1RZ7H 5D2NB 3SGEH 3MQIA 4M8UA 3VFWB 1IMHC 4Y16A 3P54A 1N4XH 3C87A 3QWRA 4X7SL 3KBPA 3MR9A 4XAWH 1JPST 1EDQA 4FE9A 2XIDA 3T77B 1Q0XL 4PJ5E 4DULA 1ZE3C 2CRYA 3APCA 1E4XH 4OKDA 4NUMA 1AS8A 3HI6H 1MIEH 1TQCC 1S7XA 3QDGB 4JL1A 5KSUA 3CWUA 5C92A 1MFEL 4LPCA 3AU1B 5AWNH 5F9AC 5FO8B 5KBDA 5IJVA 1GL4B 4HUVB 4HCRH 1G9ML 3ZTNL 5DC2A 2OL3A 3P9MB 4PW3A 1P1ZB 3LRHA 4QCIB 2VDRH 5CZVH 5CJBA 2A9DA 4GIAA 1P4UA 5CUSH 2BCKA 1F5WA 2VLJB 1ID2A 2XACC 4JM2D 1OE3A 3O3BA 3DUHA 3KJ4C 2F74B 4HJ0C 4ODBD 1HH6B 1ERNA 5ICXB 4OZ4B 4GAGH 4OFYD 3V9FA 4HEMA 1YPZE 3OF6A 1S7RB 4HGWB 1SY6A 4XN1A 2VQ1B 3SEPA 3MLSL 5T3ZE 3HAEA 3MRGB 2QPFA 1RY7B 1KEGL 1AKJB 2WLYA 2G5UA 4XCFL 3KLAB 3S36L 3IMVA 1L9RA 4GXVH 3C6EA 4IGBA 4P06A 3RQ3A 1CMOA 1Z6JT 4AYSA 1F2QA 1QFOA 4NQCD 4YSRA 2IH3B 5FCUH 2E3VA 4MCZB 4BZYA 1U4FA 1R3LA 3G5ZA 4B9IA 3LRGA 4G8GA 4PJCF 2YAFA 5IUCA 3QPKA 4U6VH 4FZ8H 4Z7NB 3OLGA 4ODVL 5TDNB 7FABH 5K1NA 1YEJH 2VITA 1PS3A 3AMKA 3BQUB 1YNLH 4KFMA 1MI5D 5AVXB 1VOKA 5DD6A 3L1FA 3QDME 5DZJA 1AHWA 3AQXA 3MKGA 5IM7B 4PJIF 3E8UL 3EJCA 3FQNA 3QCUH 4K9JA 1KCUH 1D5IH 4NSKA 4Q6KA 1KGUA 4AYFA 1ZA3A 4OZFA 1F00I 2EECA 1DDHA 1T1XA 2JKLA 4FCHA 4JFQA 4U6TA 3HNVH 3BXNA 3GSXB 2NYYC 2UX7A 3MRHA 4FKKA 2WXLA 1WCBB 2KLSA 4Y5YC 2BW4A 3P9WB 4D3CL 3LSOA 1E4HA 4IMKC 1L5GB 3T3PF 1NCNA 3U9PH 1R24A 4AQAA 5LN8A 4Z3HA 5I71C 2GHZA 1JNHB 1O7VA 3EZ8A 1JPFA 4AW4A 2VM3A 3LV3B 4ZUUA 4MRCA 3H4FA 4NQEB 4PWHA 4UT6A 5ICZA 3FPYA 3WNPA 4BFJA 1W15A 3DRTA 1RULH 1Z0NA 3VDCA 2ZAHA 3ULVC 3E2HC 5L8KB 2VQ4A 3DX7B 3W11C 3P73A 2KLRA 4PRID 4ZUVA 4P2OA 1CN4A 3U82B 3VD0A 1DBBL 2WB7A 2JJWA 2D0GA 1PKQA 2R0ZL 5T33L 4MJ2A 1MFCH 2WYHA 4OW6A 1TFHA 3FTGB 4DK6A 1ZKAA 3LYRA 3CDYA 3MFGB 4HIEA 2DWDB 4ZS7L 3T5WA 5EC1A 4H0HB 1N59B 4HIQA 3S35L 2X6AA 4OZHA 4NFDA 4JO1H 4ODSH 4O58H 1K8DB 3QAZB 3H85A 4Z76A 4X7TA 1U95B 1TTRA 2KDYA 3MVSA 3SBWA 1ECYA 5F3BB 2AXFA 3S96B 5I8EA 2GUOA 4JFYB 1AD0A 3MNDA 1HQ4A 3N9GH 5JHDA 2EIDA 2H26A 2ZSWA 3POCA 3AREA 4R0LB 2HKPA 3KVPA 3JV6B 4PTTA 1TJIL 3VXTA 4QXGL 4KHXL 4FQJH 2V37A 1PZ5B 1IARB 3CFMA 4Z3GA 1EXUB 4JN2B 1GA2A 2P52A 3P9LB 2W9DH 2QVFB 2JELL 4LSSH 4I1PA 4KVCL 1VA9A 5BQ7B 1J1PL 3EH4B 1Z0MA 5DWUH 4GG6B 4YDLC 1IX2A 5DTFA 2XYBA 3OLEA 5I18H 1JNNH 2BZCA 3LRKA 5IKCA 1VFMA 2VR5A 3WDIA 3MO1A 4NCDA 1A0QH 1C08B 3RJOA 4EN3B 1XGQB 1N3AA 5EN3A 4XTRC 1IM3D 3QFJB 2GITB 4B53A 2FWUA 3MRMA 5LGYA 1SHSA 3HRZC 5J7CC 4FFWC 5B38G 4HISA 4N28A 1UXMA 2PYFA 2Z31A 4IS6B 3FTWA 5IW6A 1T80A 3LMJL 4ZZKA 1IE5A 2HG0A 5HSHA 3BZ4B 4F2EA 1WGOA 3UPCA 2B5IC 1MRFL 5DMIL 4MNGA 3F85A 4O02A 4N8VA 4YHPA 3ARFB 5C0DA 2R69A 3MI6A 5I0VA 2X44D 2VDOH 1UVQA 4XNXL 4R97B 2VABB 3CZUB 2G3NA 4LHUA 4PGEA 3WFDL 3HE7B 3IMUA 4ADJA 3UTSA 2P49B 4N22A 1H6FA 2XN0A 4FRWA 4PYGA 3IDYB 4PRAA 3IU4H 2GFBB 3TN0A 1SLVA 3D0VB 3CDZB 3ZDXF 4WKZB 2LAGB 5FHBH 2Z7ZA 1Q9LA 1W0WA 2VCOA 1K5NB 5GS1C 1JVLA 3WLWD 4YAQA 4BFIB 5BS0B 5FR3A 4G8FB 4R6UA 2XTLA 3MN8A 4R7NB 4W9ZA 3MNZA 1C4GA 2HFEA 4Z78A 4OV5A 3T65B 2VN7A 1JGEA 4G3YH 3U0PA 1HXKA 2H32A 2R0LH 1UXSB 3RVWD 3EYFA 3UAAA 1I8AA 5D2LF 1KCRH 1NC4D 3P4NA 1DLFH 1JF1B 1Z5YD 5AW2B 2LHAA 3B2VH 1FQ9C 4GBXD 1FIGH 3IKCA 2WQAA 2X9WA 3HR5A 2OX5B 4DQOL 3O6FB 2HZSA 3QJZA 2Q7YA 1BIIA 4DTGH 4M7LL 4L0PB 4J4PA 3HB3C 3KTUA 3B4NA 2CIKB 1RZGB 3S5LG 3JWNH 5DJCB 2I27N 4ELMA 1B4JL 3MJ7B 5AW6B 1HN1A 4NWUL 2R2HB 4KMQA 1XF1A 2GJPA 1S3KH 3OB0H 1BZDA 1NIFA 2KI6A 3L1OL 1E40A 1CF8H 1J0HA 2JH2A 3BT2H 5AVVB 3X12A 5ITBH 2J6EA 1N64L 1UCBL 2Y06H 3NP4A 4OFIA 4OFKA 5CBEB 4QYOA 5EUKB 2VW7A 2YD3A 4X5WA 3GSOB 3H9SD 4X9FA 1I9EA 4DERA 2CO1A 3SPGA 5FPIA 1J05A 4Y8AA 4IOFD 1PEWA 3SKUD 1V7MH 5I19L 3L5IA 3U6XS 4LASH 1CLZH 4J6IA 1P1VA 1TQTA 4MZ2A 1JD9A 5AW3B 2GT9A 1XFPA 1FP5A 2H0EA 1ZLUK 3FO1B 3LKSB 1T89C 1TR7A 3QR1A 1H15A 2IPUK 4H25B 1NANH 5IW1B 2VW4A 4H0IA 3UZVB 1KCKA 2ZUSA 1URZA 3D12B 4YK4C 5FGSA 2IGFH 2F19L 4M8VA 3V5KA 3D85A 3EGDA 2V8MA 3JTTB 3DOSA 4ZW8A 3P2TA 2AK1L 3OKDA 4J12A 3GBLA 2C8NA 1D5ZA 1YNTB 5IGXH 2NRDA 1CFMA 1YA5A 5J6GB 1X9QA 5D7JB 2BP0B 1W6LA 3PLYA 3S37X 5IQLA 4XP9L 3QJFB 3OHXC 1E27A 1HSAA 4I5BB 5CEZD 3CZNA 4OZIA 1F3DH 3U2SB 4MASA 1DJGA 2IH1B 5HJGA 3TO2B 2CLVA 1IAIL 4TRPL 4OM1H 4APQD 1EEYB 1UACL 1LD9A 2E27H 1CU4L 1Q0YH 4JFED 5LCVL 2ZX5A 2NOHA 1AXTL 2VE6B 4NFCA 4WWID 4B6ZA 3EFOA 3MLTA 2WBXA 3EG9A 1QHPA 5GGVL 3D07A 3QDJD 4ZX5A 1K2DA 1DCLA 2MCG1 5C8JB 4HCRA 4G5ZH 1D9KD 2A73B 2FD6L 2R83A 3CGTA 4UT7H 5HYJA 4FFYH 4RGNC 1MJUL 2ZONA 4TQIA 4P59H 2BRRH 1L7TL 1TVHB 2BVQB 4F7TB 1RXLA 5GGTL 2YAMA 4R96A 3S8WA 5EUOF 1IVTA 4DO5A 4GQ9H 4H20H 1RM1A 2WO3B 1T21A 3BC9A 3L4CA 3VWKD 1QN9A 3RIFF 3JYCA 2ICES 3WFEL 3PGDA 3LTVA 4CN6A 1HZKA 5CLTA 3OJVC 1V3LA 4I18A 1E28B 1QSEB 1QHOA 1ZDQA 2A6DA 5K39B 3TZVA 4RDQF 4OB5H 4OJFH 2ZWNA 4Z8FL 1M1SA 2VAJA 4EUPB 2R39A 5JQIB 2YXFA 4M02A 3VYPA 1OPOA 2MJ7A 4M7KH 2ROXA 4OF6A 5HVGB 5C0BD 2KQMA 3X3FH 1HH9A 4H2AA 4XXCA 1J8HB 3FOLB 1R9FA 3NZ8B 5KVFH 3ME0A 1IM9A 1QWUA 2A99A 3RWJA 2OMVA 1NLBL 5L7XL 1T22B 1XR8A 5IK3B 1TF4A 5GS0D 1A6AA 2D31A 2WIIB 4JBSA 1H0DA 4YSUA 1JK8A 4UOJA 2XZCL 2XRAL 2OL3L 1XCQA 4X6CB 3MR9B 1T03L 2E7LC 2NXYB 2AQRA 2YD0A 4L1SA 2Q5BA 3X3GL 4IRJA 4MSWA 4KH9A 4QI3A 3PJSB 5TTRA 2B59A 2VSKB 4XPGH 5JIHA 1HXMB 1U92B 2YAPA 3UABA 3VG9B 3D4CA 1MNUL 2PWFA 3DJSA 1S7XB 3IE4A 4UZGA 4XNMA 5E1IA 3WGVB 2DYRB 1HL4A 2VLKB 4HEPG 3PV7A 3C6LA 3VFPA 2JIXA 3AY4C 2V17L 4NKQB 2BFVH 4RESB 4EIBA 5IJVB 2YZ8A 4JKLA 1SY6L 3SKOA 3HLAB 2R0KL 4KRPC 5F89B 5D71L 4H26A 4XPFL 2AK4D 5GRYA 2B1HL 2XV6B 2BSDA 4XPTH 4ZMOA 2WNGA 2OSXA 2EVFA 1P4BH 1NGPL 2BCKB 4S1RH 4PBVC 1O5PA 4DH2A 3MNVB 1H3PH 1CXHA 1BREA 2DM7A 3O3BB 3QDGD 1WAEA 5DD1H 2HFGH 3V4PH 2ENYA 2ESVA 2P5EB 4AGNA 2YN5A 3SPCA 3FONA 1WITA 5HYQB 5EU4A 4LLYA 3T8VA 4F57L 3D52A 4JGJA 4KTEL 4RDQG 4IGBB 3K6IA 3L16A 5I6NA 2FGTA 3NZHH 4DGYL 2ZOLA 2QQQA 3K81A 3T4AA 5BQDA 1UT2A 1W72L 3CMOH 1NCOA 2FB4H 2HLEB 1HZLA 3F12A 3KPPA 5JTWA 1I1FA 1A3QA 4MQXD 2JOIA 1JDDA 3GK8L 1VB9A 4GRLC 2XPYA 1FVEB 3B7SA 2E7CA 3O4LA 5DUBA 3LN4A 4IRSD 4ALAH 1P7KB 3HIZA 1V10A 3PL6A 2D03L 5ELIA 3GZPA 2OMBA 4FLSA 4L1LA 3SDXF 4AYFB 4NSKB 5H94A 4MZIA 1J9SA 1ZA3B 4OD1L 2DIEA 1W72B 3CFCL 4W1TA 4QRRD 4OH2A 2J12B 2O6EA 3II3A 3QIBD 4I1NB 9CGTA 2XXMB 4OGAD 1ZVNA 5HDBB 4I13B 4WHYG 3PWUB 1ZEAL 2YSSA 3DIFB 1TYEB 2HVJA 3RPKA 3PGCB 3OKNB 2Z8UA 4RVBA 2GTQA 1IT9H 4P23B 1JPFB 2A83A 4FXGA 4QIRA 3UC2A 5FWRA 3L4ZA 1RMFH 2FSEA 4V1DD 2WPGA 4NNPL 3X1GA 4YLBA 1GW0A 4ZFGH 1H9DA 1MLCA 3QUKA 5HYIA 3NESA 1RZFL 1TBAB 3LH9A 4KK6C 1L9PA 2VTFA 5ICZB 1T1WA 1A7BA 5FYLL 4OLZH 3UJTH 5E99H 4PJIE 5BOPA 1TQSA 2NNCA 3DUSA 1BAGA 1QSFA 3L1GA 1AQHA 3P73B 4Q58C 3IJYA 4Y1AD 4H8WC 4DKEH 1PKQB 1OZUA 1UWXH 4F7PB 5IEKA 3BP4B 3GRWA 4PRNA 2QPSA 2OJZH 4I0PB 3I3BA 4NRZA 1KDIA 1OPGH 4DZBA 4FZEL 1ECZA 3QDMB 4GQZA 4L8SB 5AVQB 4HGKC 3UPRA 5HHNA 3NA9L 1PCJX 3T1FB 1J1XH 3VXSE 3IRCA 3QXWA 3MLXH 1M7IA 3GSUA 3QJHB 4W9JC 3EYQD 5JHAA 2O3OA 5IBTL 4KDVA 1O5DT 1KJ3L 1HQ4B 1UD6A 4CN1A 4JPSA 1BOGB 2Q8BH 1T2QH 1CBJA 3KPQA 4YC2C 3FOMA 3OSMA 2OM5A 2QPDB 3D18B 2O30A 4XE5B 5AOKA 2GJZB 1HOCA 4OLVL 5BRQA 4HZLA 5D7EA 3UJIL 4BZ1L 4HAFA 4TKWA 2Y23A 1IGIH 1T2XA 1YEKH 3IJ9A 1OP9A 1SYSA 3OM3B 2V2XA 3GSQA 5DTFB 1QHQA 4JFDA 3DPBA 1RLWA 4F8QA 2MKLC 3EO0A 2H3XC 2PTVA 2A3TA 3PHQA 4R4BB 4AE1A 2ZAIA 3SIKA 1QFWM 2R69L 4DZ8B 2EDWA 2BNRA 1MHHA 2W80C 1EBPA 4KUZL 3HG5A 2Y6TE 5GRXG 1MF2H 3QHZL 4QG5A 1MCHA 2FZ3A 2Z31B 3BESR 4PSPA 4Y19E 3SDDD 5GRUL 1DZ0A 3IK2A 3UBXA 1X5FA 2XZAL 4PRHA 3KLQA 4UIMA 4Z95H 3SE3C 5ECGA 1IEAA 2IANA 5BMFH 1L6PA 2AI0L 5JORA 5D55A 3DSFH 2H6OA 3Q8AA 1XGZA 1S6NA 2NY2B 3PRZA 1NDGB 1J9QA 3DHPA 4K23H 4OQ1A 1I9JH 1LO2H 4BXSV 4N8VB 1EUUA 4JPKL 4YHPB 3VA6A 2G5BB 5A2JH 4XMKH 3T2NH 4EI5B 3B56A 4K94L 1UVQB 1T7VA 3E6FA 4JDVB 2BY2A 1ONQA 4PGEB 4L8BA 4FMVA 5IHZA 1EZVY 4JHAH 1F2XK 5MEOB 3F7QA 1VEOA 2YLKA 1U8LB 3GKWL 4C58B 5EEUA 2VRAA 5I6XC 4WHTA 3W9DA 1W0WB 2OI9C 1IVLA 1UYWL 5TE6H 4JO3L 4Z7OB 4PMFA 4PJBE 5CMAA 1P7QA 4NKIH 4K3EL 3C2AL 4FMFA 5EEWA 1PD6A 4EN3C 3B2UC 3BX7C 3MNZB 3KXFE 3V0GA 2B39A 2HFEB 4G8EA 4Z78B 1NSNH 4UF7C 5ID0B 5I5JA 1T0MA 2VMDA 4WWPA 2P4AB 1MCLA 3ZT6A 1K8IA 2FUTA 2G0KA 5ALBL 2APBA 2YRZA 3EYFB 5DC4B 2J6EL 3SCMA 5GS2H 5J57B 1RUKH 1CI3M 4AGPA 1OAJA 1XF4A 3JBG7 3IKCB 3HR5B 3DO3A 5L8LB 4DN3L 5KN5A 3ZDXE 2Q7YB 1BIIB 3RHWK 5JW4N 1FBIH 5CM1A 1AAJA 2GBTA 2XQYA 4W4OC 1LILA 2ATPB 4HJJH 5I1JH 3HUJB 1NCAL 4X5QA 1IZJA 2IV8A 3GGWB 3RWHA 1G5AA 2QPUA 4A7GF 3MA7A 2D7QA 3GMRB 1ZCRA 2YD5A 3L13A 1KTDA 1O9WA 3QQ9D 5T5NF 3I02A 4FLRA 4XR8C 3QO0A 1WRFA 1I53A 2BLFA 1S9WA 5CEYA 1F6FB 5D2LE 3RPIA 2SEBA 2WKOA 5B39A 5C07E 4LSRL 4MNHA 1KZQA 1RZ7L 4G1EA 5BMNA 4PLKD 5HYSG 3GMQB 4X4KA 5E6RB 4OCXH 4NUJA 2ZCLH 1HCVA 4H8PA 4XWGL 4FOMA 4QF1A 3VI4A 1C1EH 3GF8A 3DBXA 1BW8A 4JHWL 5DT1L 5C09B 5BJTA 5T3XE 3HI6L 2YGNA 5BRZB 3VXRD 3US0A 1WTGT 1RP8A 1I82A 4JHZA 3MLPA 4E9TA 5AWNL 3ATBA 4BZ2H 1LE5A 3U7AA 4OV6F 1Q90A 3JTBA 3MV8E 5J3HD 4R5TA 4L3EE 1OAZL 2ZQKA 2YPLD 4HUNB 1RJYA 4OCYH 3QGVA 1OM9A 1UB5B 5DURB 3BIKA 1OARL 3ZW3A 3KYNB 5CZVL 3ROLA 3ZX1A 4U6XA 3TP4A 2HMID 1II4E 1I7RB 2CLVB 1GZQA 4G6KH 4XO9A 1EIBA 5CEZE 2Z92A 4YLQT 1IFGA 3DYOA 1GSMA 3I9GH 4JO4L 2X1QA 5F93C 5ECJE 5KAQF 1E43A 1IGYA 4WWKD 3D3VE 4ZFFB 1NOLA 3GBML 2F53A 1U36A 3NFPA 4U1HA 3VQ1C 3EG9B 2NUTA 5DO8A 2Z7WA 3QUZA 3BP6A 2Q7NA 1UKTA 3VM7A 1P4LA 3WLWC 2C1PA 1A02N 4G9FA 4FABH 3ESPA 1A3RH 5E2JA 1A9BA 4PJFA 3BDBA 5IFAL 5FUCC 4ELDA 2K9UA 1DHKA 1GGIL 3QEQA 3CBKB 1FVDA 4RODB 4XOEA 2APVA 5LUMA 1CD1A 3KNBA 5T5NG 3HMXA 4Q9RH 4FZ8L 4O9HH 1KIUB 3V4PA 3WIFA 3MRKA 3ABLB 4HUWA 3PGDB 4MD0B 4MMYA 4OZGB 4HWEL 4YDNA 4RGNE 1AZCA 7FABL 3W0WA 2WXGA 1AC6A 2A6DB 5FKPA 1EEZA 1YNLL 4GBXC 2COVD 3AGWA 3NFSL 1A6ZB 3KGRA 3MCYA 1OAUL 4UILL 4WUUD 4M1GH 4B41A 4IU2A 4IRZH 1T4KA 1D5IL 2Y5TA 1EO5A 2EYTA 1X4XA 3L6FA 2MEJB 2YD7A 1B88A 2XPGB 4W6WB 1QNEA 4GG8B 4HMDA 1XMEB 3HNVL 1WH0A 5DEFA 5HGBB 3EXLA 4WNQB 5GZOA 5EUOE 3EHBD 5F0LB 1IKNA 3FAWA 1XR8B 1DUYB 2A1WL 3U0WH 3REWB 4BDVB 1A6AB 2W91A 1SMDA 4UQEA 1BIHA 3IPFA 3DX9B 4M3JA 5CIPH 3WSQL 1ITBB 4S1SH 4BYHA 2UXFA 3UPAA 3OMAB 5DSCA 4AI7A 4D9LH 3PNRB 1S78D 4JRYA 1P5UA 1PQZB 4FFVC 5E4EC 3AW5A 2FIKA 2ROYA 4R90H 1GS6X 1L6XA 5LLIC 2X70B 1XL4A 2X05A 3UYOD 3H8NA 4DK3A 1JXKA 5I23A 4MXVF 4DHLA 3KYMB 2QVTA 3QPXL 3P30L 4N2DA 2JIXB 5H2BB 4Y16D 1FZMB 3BN9D 1UL7A 1F4WH 4QLRA 1B9ZA 1MZYA 1FYTE 4EMZA 5KAQG 3SKOB 5HHPA 1KXVA 4DFHA 4E36A 3TWCL 2WQVA 5IMLA 2WBJD 4H26B 3MRLA 3RKDD 2R8SL 2B3RA 3ARGC 1MCQA 1RUPL 3RWIB 3SD2A 5EU6E 3HZKB 3PCYA 4POZD 4YFLI 1RZQA 4Z7VF 4XMLL 3I2CH 4XHQA 4IL8A 1KB9K 4MDRA 3WXWL 2X0VA 1BVLA 2BY3A 3CHSA 3OJ2C 5DVLA 5C7ZA 4ZJ9A 1NL0H 3HG0A 3ZHFA 5F8RC 5BRPA 4OUUA 3APMA 1T0NA 3FONB 1U8HB 2V3FA 2GI7A 3MACL 1FN4A 4YUEH 1ET7A 4XB3A 5JMRA 5DK2A 2V2WA 2JK5B 4X6DA 5A2CA 2ZOKA 1W8OA 1MKFA 2VDLB 2W9DL 4HKZA 5KANG 3UZEA 4LSSL 4YHYC 2ENSA 1NBCA 2BP5M 2ZOTA 3BAYA 1L3NA 5E1AB 2ZOLB 2NY3C 3ZYOA 4ZTOH 3ARDA 3T4AB 5DWUL 5I1HH 4XNBA 4OIBA 1G5GA 3F12B 3KPPB 5KJRL 1M2VA 2K78A 3EYVA 5I18L 3VXMA 4A37A 1UZ6F 2PYEB 4ONGH 2BWIA 3QEUA 1A0QL 4P9HH 3OF6D 2YMXL 5DUBB 1YQKA 1KJ2B 3OB0K 1N5AA 1EJ8A 1RZJL 1G7IA 2QLYA 5T1LA 4ROEB 3IU3B 4Q6IA 1NLDH 1MQKH 3VWKC 2XQ0A 3PUUA 3MUGA 2PPDA 2F7LA 3OBAA 1AI1H 4EPSA 4R7DA 1EX0A 1YUKB 1QPPA 3OHMB 3QR2A 3DX4A 4HD9A 4HS6A 1MFAL 2H41A 3T0XA 2XWCA 3T6VA 2K7PA 4G8GD 5I0YA 3ULUH 2JFCA 4L48A 2I69A 1U42A 2WZ0A 2NOFA 2OV0A 4HK0A 4WTXA 4HXAH 3CSBA 4FI6A 5DMGD 2VRKA 1QFHA 1F11B 2F54E 3VACA 3I3DA 2HVJB 1DQML 4WXAA 3GRWL 1U9KA 1O7DC 2WVUA 2YEZA 4B9ZA 3LIZA 2DLEA 3FQWB 3SGDH 3R7RA 2FSEB 1KCSH 3FH7A 3CD4A 3ZL2A 3FFDB 3OJDB 3VXUD 3CWTA 4IHOB 2RCSH 3G5VA 1OTUC 3NIFF 4N9OB 1EZUA 3IU4L 3SDXE 3EIFA 1R75A 3GC3A 1T3FB 3MV7E 5DUML 5CCHE 4EDWL 2R29L 1BGXH 1G7JA 1TU2A 4JPIB 3WEXA 3UCRA 4PRNB 2R15A 3HR6A 5C0CA 5GHWH 2A6KA 3VGHA 3G6JA 3ZQWA 3VFTA 3HVDA 1Q9OB 5IG7A 3KPNB 4DZBB 4E42B 5I6MA 1F41A 2N56A 1WA2X 5CN1A 5HHNB 2X2YA 3BAWA 5IY5B 2R0LL 2IBZY 3CHPA 4PREA 4P2OD 4XMPH 1DLFL 1F4YH 1CGSH 3B2VL 1A5FL 1PX4A 4FQCL 2WD0A 1FDLH 1NCGA 5DLML 4AGMA 3A4DA 3EYOA 5KS9F 3A67H 3KPQB 3V9CA 2Y24A 4R3SA 3WFBL 4JUTA 1WLHA 4NRXA 3A47A 2Y6SD 3M7OA 1IC4H 1N6UA 2YJQA 4PJCB 1HKFA 1THAA 4LBEB 1HOCB 3OSEA 5SX4H 2EDOA 4FXKA 3K7UA 3ENEA 2B9BA 4E2OA 5FYLD 5T3ZH 2V2XB 5JHDD 2GAZA 1QEWB 3KJ6L 2YUVA 2Y06L 3ARED 4JAMB 1MAKA 3EO0B 4HKXB 5DJYB 4DP1X 4IU3A 1AO7E 3ARUA 5E2TH 5K69A 4AQ1C 4TPRH 4YDKH 1BJ1H 1WFUA 1VGEL 2XX1A 3S98A 4Z7WA 1PTZA 3GZOA 3OZKA 4YEFA 1AGCB 2O5NA 2A74C 1LO3H 2IWGA 1EHKB 2KKQA 3OLIA 4PJXA 5DR5H 3T3PB 4OFQA 2IG2L 3QNYA 2GTWA 3S3BB 4DGVL 5B38B 3RZCA 4X4YA 6PAZA 4OF5A 3T0EC 2IGFL 3RFZA 4P2QE 2ITCA 4Y9BA 4IRSC 3QJRB 2IANB 4ILDA 5JORB 2APXA 2JTYA 1L0QA 3S3CB 1IZKA 5JUEH 2P45B 3C8KA 4RMUA 3ZYZA 5GGUB 3KPOA 5I16A 5IFHH 3EYUL 5JR1L 5J6SA 3L4TA 4N0UB 1G43A 1DZBA 1YHPA 2K3HA 2QKIA 3H54A 2B3IA 3N42B 5CGBA 3BVWA 3S3JA 3HTLX 3LZNA 1ES0A 3RRQA 5HPOA 1YNKH 4HPYL 2ISDA 3E7JA 3DXAE 4RLDA 4QRTA 4QRPB 1ZT4A 3K6SB 1YQ2A 1G9NC 3R8BB 5IHZB 3L48A 1F58L 4ZMVA 3NCYP 5LGJB 1TUPA 2CAKA 3AG4B 4FP8H 4NUGL 2PTUA 3PWNB 1JFIC 4NZUH 1R17A 4ODXA 1BQUA 3L3KA 1XBDA 4WHTB 1MFVA 1SM3H 2XVBA 5FECA 4OM1L 4RGMB 1XR9B 1Q0YL 4S1QL 4XVJH 1RZ8B 3GM8A 4JFHD 4KMTL 5D6CA 1KTRL 5G4MA 3AFLA 3Q6FA 1Z3GL 4LHUD 5FB8B 1Z1WA 3RGVB 3IGFA 2DY2A 3STLB 1N3NA 1UT1A 3UTSD 3UXFA 1DFXA 4HWZA 4RFOH 5I66B 2BHZA 4WI5A 5SX5H 1RVFH 4OGXH 3TN0D 2BRRL 4XMTA 4C4KT 3F6JA 2Q86B 3H42L 4JE0A 3SCMB 3QRFM 5F2FA 3OKYA 1H5BC 3THML 3WEBA 4H20L 5EU3A 5F3FA 1ACZA 3AXLB 1PDKA 2CCWA 4JFOB 5C0FA 1M42A 3ZOAA 1PSKH 3VTTA 1WZ1H 4XP5H 3WOVA 5DEZA 3HN5A 1I9IH 3FB6A 3VFVA 3ZL1A 4OJCA 4JFPA 4C83A 2ZJSL 4C8XA 4AQOA 3CX5K 1JTPA 5F7WC 4YHOL 1LYQA 4WI3A 2LAAA 3IETB 4CVZA 5IQOA 5IQ7H 4OCNC 3WE6A 4LPXA 5I6PA 4M7KL 3LJ3A 4ADGA 1VRSA 3J7HA 5DS1A 1VFBA 1UT4A 5DRNB 2NQCA 3ZYJA 4BK8A 3QO0B 3INUH 2VERA