1R4XA

Crystal structure analys of the gamma-copi appendage domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
274
structure length
273
Chain Sequence
MHHHHHHMTRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLYVPARSLPYNQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDTVTMQVTARSLEELPVDIILASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Coatomer gamma subunit
publication title Gamma-COP appendage domain - structure and function
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08752 COP-gamma_platf Coatomer gamma subunit appendage platform subdomain
A PF16381 Coatomer_g_Cpla Coatomer subunit gamma-1 C-terminal appendage platform
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1480 Mainly Beta Sandwich Immunoglobulin-like Coatomer, gamma subunit, appendage domain 1r4xA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1r4xA02
1W80A 1KYUA 1QNCA 2G30A 1CDWA 1QN3A 1KYFA 1TBPA 1QNBA 3EIKA 4B0AA 1VOKA 4ROEB 1YTFA 4ROCB 1YTBA 5IYDP 5IYCP 3ASMA 1QN7A 1KY7A 1R4XA 1NVPA 1NH2A 2IV9A 2D0BA 2MJ7A 1QN5A 2Z8UA 1TBAB 1PCZA 1AISA 1JFIC 1B9KA 4RODB 3VN5A 1QN6A 3OC3C 1D3UA 1QNEA 3OCIA 2VJ0A 2D0AA 1QTSA 4WZSD 1NGMA 1TGHA 1VTLE 1PZDA 3H1ZA 1VTOA 3HS8A 1QN4A 2IV8A 1VOLB 1RM1A 5IYBP 1QN9A 1MP9A 1QTPA 1QNAA 1KY6A 1QN8A 1C9BB 1E42A 4PY5A 1KYDA 2D0CA 3HS9A
chains in the Genus database with same CATH superfamily
2VZVA 1H15A 3B1TA 3OH9A 4PCKA 3SHSA 2ED7A 4AQAA 3SKJL 2ENSA 2YKLH 7FABH 3TU6A 2L7EA 3GBNL 1FL3B 4AT6A 2Z8RA 3VGHA 1D5MA 3WKML 4FDWA 1BZ8A 3ULVF 4DO5A 3AGVA 1FIEA 2D73A 3D69B 4Z0XA 1UH3A 5EBLA 4BQCA 5DA4A 3NABL 1LHZA 1M7IB 2AERT 3IMSA 1CB4A 4HIHA 1ROCA 3FB7A 3TM6A 3CH8A 1MAMH 4IBVA 2H7WA 3EAYA 4P2QD 4JFYB 1I75A 4W9CC 3NIDF 1OGTA 5EZOH 4F2ME 1UATA 4S1RL 3WL9A 2YJLA 4KKBC 3RG1C 2ZXQA 5PAZA 3FCBA 4XP1H 5CEZL 4Q56A 1UB6A 3APMA 3RVTC 3SKUD 2DS4A 1K2DA 2GBVA 3KLQA 5EUOE 5GGTA 2V8LA 5D6CA 3WE6B 4KJPD 4FXKA 4IBWA 4WI9A 2IV8A 1HQ4B 5JQ6L 3S88H 3QJHA 3QA3A 3B43A 1YNKH 2X4OA 3HC3L 5JW5A 4OZIF 1KWGA 2H2PC 5C2BH 1C5DB 1F58L 4ZMVA 3UJTL 1VCBC 3WIIH 1R3KA 4JY4B 4AW4A 1D7CA 4RGNE 4DQAA 3F0ZA 5BOPA 4KTDL 3RWIA 3TA3C 1OM9A 2W0FB 2WXQA 1VACA 2P5WE 1DQDH 2VQ1A 3F6LA 3KPQB 4JKPL 3TFKC 4LHJB 3MV9D 4M1DH 4JFPB 4AUYA 4URTB 2GBUA 3DMMC 1ZK9A 2H0EA 2HKFH 4OBRA 4UT9H 4P8QA 4KRNA 1D9KD 3MLUH 3V5DB 3QXDB 5JQHC 5MI0B 4DPAX 5K69A 2DWDA 1BZ9B 1B9ZA 5GS2H 3IJYB 4GKNB 2I5YL 1OV8A 2AJYL 4WI6A 5I6XC 5DMGC 4NQEE 1UWEH 1SDYA 1FE8L 5F97E 4NN5C 3VI3A 2FUTA 4OZGE 2X6BA 3QQDB 4QMEA 1Q94A 3MRRA 5HYJA 1SXNA 3FT4A 4UOW0 3CK0H 3US1A 3RVUD 6PCYA 5E24E 3FU9A 1NCOA 3NT0A 3PP4H 2X0VA 5D4IA 4BK5C 5C0RL 2CIKB 4GLRH 2AEIT 3FQXA 4I3RH 2IH8A 5DJAA 3DK0A 5J6GB 4IKKA 5F8QC 3VACA 5IVXE 1N26A 3E2HB 2IXQA 3FN0L 5ANMA 2FGTA 1U8IA 2KZBA 1TFPA 5L8KB 5T1JA 1T5XB 2APTA 5FKAB 2IPKA 4NQUA 4ZO7A 1L5GB 2YMXH 3F7YB 5IB5B 3ELAT 3P0YH 5DZJA 3V6OC 1NC2B 4Z3FA 2QRDA 2NY3C 2WYIA 5C07B 1EMTL 1ZK5A 4UQDA 4BKSC 3H2PA 1SY6L 4L4JA 4BSWA 1TJHH 2VLJA 3II3A 3ETSA 4RFEA 5JXAH 4YHNB 5FYJD 5BJTB 2HN7B 1JK8A 1ITBB 3B5GA 3FTSA 3T5WA 4ADJA 1QPPA 4QTFA 1IM3B 1NLBL 2XOTA 3QDJD 2QHLA 1GMEA 2EDTA 3VFGH 1CXLA 5FAAA 1CGUA 4JHBA 2O5XL 3ILQC 3MXVL 2R2HA 4FNQA 5FUOL 3V8OA 1UENA 4JPSA 2H3XC 3FCSA 5I1KH 1QO3B 2DMKA 4YSSA 3D0VB 1BYNA 3CFNA 4I89A 4JFUA 4WZ9A 1A3QA 4M6AA 4R7XA 4DK5A 1TDQA 1AGDA 5FW8A 3BQUA 3CWGA 4KJWD 5G4OA 3CZGA 4BKLB 3WNMA 1L7TL 3B9KC 5DF0A 2X9ZA 2DLFH 2GABA 2VLLB 1YPZB 1J1PL 1K8IB 4L9LA 1CDHA 1NOLA 2DWYA 4HMCA 1U36A 4XCEB 3UTQB 1SXCA 1RZJH 2YEZA 1CLCA 2ZX9A 3Q5OA 4ELMA 3CQFA 1R47A 2NY0C 4LNRB 5E0QA 4IJ3B 3QQ4B 2KZKA 2VMFA 5C7ZA 4NI3A 3WGUB 1GGTA 5B8CA 1DTUA 3O8XD 1H0DA 2ZUVA 1MF2H 2IC2A 4TNEA 2CLVB 3MRLB 3QIUD 2KS0A 3ZT5A 5K9QI 3FQ4A 4KQ0A 4GUCA 5M95B 3N40P 5KJRH 2K45A 4Y2OB 3U4KA 4ENZA 1PF3A 4HUXA 4FOMA 4A63A 3GI8H 1YO4A 4FZEH 3GB7B 3GSXA 3CSBA 3PXHA 5AL8A 5J9PB 4KKCD 3OAZK 4Y4HA 3A67L 1J0YA 3QT2A 4PJHA 4LEEA 3IXTA 5FR3A 3A4EA 1DLFL 1S7UB 2XZZA 5JTWA 3K8MA 2ENPA 2R4RH 2H8PB 2J8UF 3BVWA 5FO8A 5IJBC 2BNRB 4ZS7H 3JWNE 5B22A 3HG1D 3EJSA 3B9AA 3U25A 3VCLB 1LO2H 2C3HA 3QCVH 1BXXA 4L4TB 4C55A 1A1MB 1F02I 4HWNA 1MVYA 3FZUD 1EEZB 4JPWL 1E27A 2YFOA 4OCXL 3CBRA 5LNGA 3DOIA 1OAXL 2XA8H 4NQDE 2JQAA 3CZKA 5SWZD 3PF2A 1OD9A 2WKGA 4N0YL 5AVRB 3RJDA 4B7IA 3HFMH 1S9XA 4IKIA 3STBA 3MFFA 3S0PA 3EOYG 3Q2WA 5AVYB 3S48A 4XP5L 1QI3A 4W9GC 3HC4L 5IFHL 4OF3A 2DKAA 4PRNB 5HTSA 4LSPH 1SLVA 4E9VA 4N2DA 2Z91B 3C6SB 1J5OH 2R69L 4G7SB 5DLMH 1NBZA 2WY3B 4ERSL 2FHCA 4W9LC 4UINH 3ALPA 5IT2L 1F4YH 3NFSL 1F13A 1MELA 2NXZB 3QQNA 1KJMB 2XQBH 5AB2A 4ANWA 1MHPH 4HBCL 1GCFA 1TU2A 1U41A 3IK2A 3LS5H 5B1AB 1K35A 1RZ8B 3SDYL 3LKNB 3GUFA 2DQFB 4M43H 4ZJ9A 1OB0A 1RLBA 1X5YA 2UZXB 3GEFA 3ZUNC 5JW4N 3IGKA 2R0LL 3VXQA 4MJIA 4U6YA 1NKGA 5EORH 2W59A 2ZYRA 1ZEAL 4XNQB 5D96C 5KVFH 2P3YA 4IOSA 1TJGL 4ZFQA 3SDXE 3S35H 3A22A 3QXAA 5DLLA 4OJDH 3QHZL 3W39A 3FTWA 3Q8CA 3S3BB 3DX6A 3C60C 3U2IA 2Q8BH 2C9QA 4PGEB 4CVXA 2PWEA 4A2MA 5AUMB 4KXZI 3F10A 1CF8L 1YEFH 2VABB 4QRRD 5GGRY 4JM2B 4ZAKB 1ZT1A 5CWSB 1TUOA 3KDMA 1A7OH 3KH4A 2ZTBA 3RFZB 2XVKA 1E4WH 4JREC 1FGVH 3GLEA 3FRPB 2X6MA 2AK4B 5IK3B 2OCCB 4DEWA 4JFED 4U0RC 5D7JD 2CK0L 3PMGA 4WW2A 1QNCA 4GAYB 25C8L 1RJCA 1ZLEA 4HUKB 2BXYA 1F3DJ 5D2NE 4Y5XA 4F37K 4Z7NF 2EP6A 2ZNXA 1OTUD 3ZRCC 4KDTA 4PLNC 4TUOB 5C0AB 3C5JB 1BAGA 3AQXA 4ZUUA 1SXBA 5TE6L 1JFIC 2XWTA 5FO7B 4NO0B 5DUPH 2D3VA 2IWFA 5T1KA 2OZ4A 1DE4A 4ZW3A 4X83A 3UTTB 1RUPH 1I7ZB 4G6FB 1T1WB 2EIJB 3NRFA 4XBMA 4F1SA 2PPCA 5I15L 4WSKA 4QRTA 5FYJE 1MW3A 4J1UB 3QUYC 1HWGB 3VU1A 4HV8B 4JG9A 4TF4A 1OAQL 1HNGA 3PREA 3QI9C 1S7SA 1PKQB 2XN9D 2OMVA 3QDJE 4FNLL 1SM3L 4M1CC 3OSTA 4TUKL 5FLVA 2YD1A 3D4YA 1ZTMA 3T0EB 3AS1A 2E6QA 4JQVC 5EFIA 2YIHA 1U8LA 4U1GC 2D7PA 4YDLB 2OJZH 5BS0B 3LV3A 3FQNB 3ARYA 2XNAA 4CC1A 3II2A 2YXVA 4RCAA 1YG9A 4LCWE 3MV11 5DGQA 2P42B 4LPCA 4OLWH 3STLA 2ESVD 4AM0A 4Z7OB 5LGYA 1SQMA 4L4VD 5F7DA 4PRHA 4PWIA 2G9HB 3NJJA 3HEIB 4CC4C 2GT9A 2BFGA 3DGCR 1M3QA 2JXMB 5C3TA 3OKOB 1P2CA 1N3NB 4NT6B 1MQKL 4G8FA 4U1KB 1LO5B 1NBYB 1PSKH 2L3BA 5E6UB 3WMQA 5BQ7A 3VI4F 5E1AA 3Q3GB 3K2UL 3HI5H 2DW5A 3INOA 4I1NB 1PMYA 2IAMB 3UXFA 4YPJA 3V0EA 3ZTCC 4FP8L 3VXSD 4NWTH 3EDJA 4HT1H 4PY7A 3OXRB 3H9ZA 4I77H 1MFCL 4IMLA 4QAWA 2IBGA 2X4NB 2AJSL 2BVTA 5AVTB 3TPKA 2MOQA 4DP5X 2VDQH 2I7SA 4RRPG 4DQOL 1ESOA 3GSWA 4KO9A 4NZ8A 1DUZA 3P2BA 4OQTL 4JZOA 4XMPH 1Q9WA 4QGTA 1GC1C 3H9HA 1KBBA 4UT7H 2CDGB 1MNNA 4F57H 1RJZA 3PWPD 2XV2A 1K4CA 3EGXA 4DTGH 2FYVA 5A2BA 1RZGA 3C8HA 1HEJC 1X5LA 3K74B 4NOBA 5I8KL 3HG1E 3PWUA 5DRZA 3UC2A 3OQRA 3TNMA 2XZQH 5KN5B 1H15B 5DZPA 5HGAA 4MYWB 4AQAB 4OGYH 3K4AA 2VO5A 3H7BA 1RAMA 2FVNA 3HUJE 1VADA 4TVUA 3W38A 1OANA 2XBTA 5H37A 5SWZE 4XPBH 2BOBA 4AT6B 1D5MB 1ZE3C 2DLGA 4M61A 1ICTA 1NGZA 4OM0H 4PB0H 3WY4A 4NP4H 4PHXA 1M71B 3PAZA 2EDRA 4Z0XB 4RWHA 3TBCA 5EBLB 1AXIB 4HJTA 3EO0A 4JFVA 2LU5A 4AVJA 2GJ6A 4HIHB 1EO8L 1FO0A 4R0LC 4Z7VF 1IAKA 2R9HD 1W8EA 2NOYA 3FB7B 2A3TA 2FQEA 2XU9A 4ODUA 1H3PL 4GEIA 2KDGA 4P4KC 2BVYA 4E2OA 2YD2A 3ZPDA 1OGTB 4LFHD 3D9AH 3WL9B 2FYYA 4HUNB 2NSXA 2FD6H 1CE6B 1MDAA 3LH2H 3UYPA 4ZFFA 5IF0A 1B6UA 2CBOA 1UB6B 4UF7C 3JV5A 5F7LB 2QVTA 1K2DB 2FUQA 4JS7A 1M7UA 3LXBA 4DO4A 5A3IC 4LPUA 4JRLA 5D6CB 1SFHA 5FYJL 3FFCB 4FXKB 1IAMA 3QA3B 4OSUL 5A2FA 2X4OB 3KS0J 4XT1C 5JW5B 2UZIL 2LOEA 3S34H 5A2IH 1DQVA 3GXMA 4QJ3B 5EU5B 3J8F7 4MMZB 4H8WL 4DF9A 4Z76B 1A0QL 1DSFL 2IMMA 3L2MA 4JJ5A 1DQMH 1R3KB 1XH3B 3LHPH 3QQ9D 5KYXA 4K8RD 4NC0B 1P5GX 3FU7A 4BELD 2UV3A 3RKDC 5K1JA 1XIWA 1F1AA 1VACB 5C09A 4QRRE 2BM3A 4MNQA 2QSVA 2X41A 4JRXA 3BKYL 3MV7A 3WS6C 2DWDB 3B83A 3H0TB 2K7PA 4F9LA 3OQ3B 4K23L 2WKOF 1A9VA 3FTXA 3BVTA 3FYEB 2HH0L 4BK8A 3BVDB 3V0FA 1B9KA 1QABA 1ZVNA 3KGUA 1KPRA 5FGBA 4D7QA 5GRWA 3WDJA 1DFXA 5AZUA 4K3DH 1Q94B 3MRRB 3ZSTA 5HYJB 4JUSA 3FT4B 1CI5A 4F7PA 4OT1H 2FE0A 35C8L 1PW3A 5DD5L 1V3KA 3E3QC 3ZDZE 2OZ4H 3FQXB 1TTAA 5H4YA 1QBLL 5DJAB 5E0FA 4JMXA 5JHBA 3CIQA 1ANUA 5FLUA 3X13A 3IFNH 3KNBA 2IXQB 4XVUC 5ANMB 1HKFA 4U1LA 1U8IB 3VX1A 1I1YA 2XA3A 2IPKB 4ODWA 3KPPB 5JHAA 3DO3A 3SE8H 1D5XA 4QXGL 2DQHH 4K5PA 4PBWD 5C0ND 3WLBA 1A02N 1EXHA 1MCFA 5C86A 3JYBA 5I23A 1ZTXL 1QFWI 1HX0A 3PWVB 3MA9H 4HIQA 4CA4A 1CLOH 5TQ0L 3MJ9L 5CP7A 3VM5A 3OAUH 4PCSA 4BSWB 2X05A 4TOYL 2VLJB 1G9MH 4RFEB 2A9ML 1DL7H 2ZT9C 1T1ZA 2WLMA 1JK8B 1KCSL 5GGVY 1XAKA 1B2WH 1QD0A 2OCJA 3MUJA 3TT3L 1AR1D 2ESVE 3KHQA 5L7XL 5M7QA 1X6NA 1HXYB 4G7VH 3C5XA 4JFDA 4S0SD 4I48A 1JJUA 3TBSA 1NGPH 1PX8A 2WVUA 3CZJA 4FQJH 4MFHA 4AQEA 5CGBA 1ZA6B 2R2HB 3VNYA 1PS3A 3PE9A 5FW7A 4BH8B 3L3IA 1VFBA 3FCSB 3IRPX 1I7RA 2A4EA 4OFQA 1ET7A 4WRLA 5FOBB 2G75A 4RGNC 1QLRA 4I0PD 4GPVA 5D6DA 3BQUB 3TF4A 4IM8A 3CVCA 2PTTA 3VXSE 4ODXA 4M7LL 3PIQA 1XMWA 2ZUWA 4P2CG 4X9IA 4XGZA 2XRAL 2V2TA 2VRQA 3A23A 5DFAA 1CXEA 2B9BA 4Q14A 5ICXA 4QHPA 2ICES 2BNUA 2P80D 2X1WL 2YEZB 2JK5A 1IAIL 5I6PA 1XBRA 1ZHNA 3LYRA 4ELMB 1DP0A 4XVJL 2I07B 3H7LA 3BPNC 3COOA 1GOFA 2APBA 5B8CB 4KITB 3EJJX 1I8MA 3L3DA 1C8QA 4S1DD 4WK2B 4I5BA 2GHZA 2H0PA 4IS6A 5DUML 1CK0H 3PWPE 1JNLH 1XGPA 4EXKA 5IHZA 2VDQB 5SWSE 1HSBA 3IDJA 4LLUA 3UYOD 5TDOA 2XTLA 1V5JA 5E4EB 3FT9A 4HUXB 3FOLA 1XHHA 4K5OA 3GSXB 3G08A 3TPUA 4UQAA 2J72A 2Y7QA 4F80A 4JCWA 1DVXA 3F6IA 4ZI8A 2EQDA 3OLIA 4Y4HB 1KC5H 2WQXA 4U1HB 3SDDD 3P30H 3OC3C 3N44B 1TPXC 2JKNA 3IXTB 2VR3A 3MAWA 2FJGA 4NXSA 3LIZL 4PS3A 2PPFA 4AQ1C 3MXWH 2CALA 1ACCA 4EZMA 5CJBA 5FO8B 1NCBH 3KLKA 1RXLA 4BINA 1P4LA 1YLBB 1JIBA 1G7LA 4GRLC 4L3FA 3TV8A 4ZDHA 1FRGL 4XP9H 2E86A 1C1EL 4J8QA 3TTSA 1FFRA 5CF3A 1TSRA 1KTDA 1F3JA 1Q9OB 3GM8A 3BDBA 3SE6A 3N5AA 4G5ZH 5AFAA 1E27B 4KKAC 1X5IA 2L7QA 2F53E 3IFOB 1L4IA 3SGJA 4N8VA 5JHLA 1RVFH 4HLJA 4ENEC 4NFBA 1FVEA 3ZO9A 1XXFC 2QKIC 4AEIL 1KBGH 5KANI 3BDYH 2FATH 3VD0A 1S9XB 1TO4A 1C4GA 3SCMB 3MFFB 1PFCA 5L0QC 1JRHL 2FT8A 3Q6GL 4M93B 3H3BC 4JQIA 3TBVB 2LW3A 4Z7UA 3SGEH 1A7NL 4AV0A 1IGCH 1NBZB 2NXYD 5ALCH 4PD4K 2FB4H 3AADB 2B1OA 3LPWA 2CRZA 1T7YA 1NL0L 1QSED 2N1KA 5J6SA 4EBQH 4ELDA 3LXUX 4F8NA 4N2CA 1TU2B 2FT6A 1KXQE 4I0CC 3SPGA 5HJGA 3Q1SL 4LDOB 2WXJA 4RISL 1U8OB 2AJXH 1KLFA 3RVXC 5CJOL 4XAKD 3K6NA 4FULA 5INCA 5CBEB 1QN8A 1OPOA 2QQKH 1O7DE 3ET9F 3HI6H 3ZDYB 2JFCA 3VXQB 4MJIB 1T83A 3RB5A 3EOAA 3FQYA 1A7PH 5DS8B 2FX8L 2MCMA 4L05A 3T0BA 3MRGB 4MD0A 4KX8A 2A74A 5AB0A 3QUXB 3JV6A 3DX6B 5DFVD 4BHUI 1KB9J 3ZBMA 3QFGA 4FQPA 3BUPA 1HAUA 4NC2B 4R97B 4WVRA 5C0FA 1P4IH 3MLZH 1ZT1B 4WGWB 1MWAL 3KDMB 2NYYD 4PUBL 2KDYA 4AK1A 5IJKA 1I8LC 1G4MA 1PY0A 3RWEA 4ZTOL 2X3CA 4XCCH 1OP9A 1U58A 1FG9C 3LDBC 5E6SB 5ABZA 2R0ZL 5DT1L 4ESKA 1EZSA 1X5HA 1N3AA 3EYVA 1ID5I 3KPOB 1LO3L 4WW2B 5EU7C 1MJ7H 3LVTA 4X5PA 3JWNC 5B38G 1EUVA 2OL3L 3CFCL 4Y5XB 1PCZA 1NQBA 1T03L 4IK6A 1BF2A 5I8EB 4HJSA 2DQIL 4A39A 4LSDA 5FX3A 3KYMA 4P04A 4OLUH 4X9BA 3WN5C 2AK1L 1YQRA 1ACZA 4Y4KA 4PV9A 5T1KB 1FH5H 2FJFA 2AJVH 3R0NA 3G5ZA 1PTZA 2BSTA 3NJLA 3AY4C 4MNGA 2QVKA 4HOXA 2BHFA 3EG9A 4QRTB 1T20A 4UTBL 3VW3L 3HB3C 1HS6A 2DWXA 2HMID 1XR9A 2RAMA 1XF4A 4LU5L 4OCWH 5F7MC 3SSGA 4FNTA 1S7SB 2B4CH 2ZX8A 4LDEB 2OMVB 4F7KA 5I76A 4M8RA 3QCTH 1E43A 5T1DH 3FOMA 1R3IH 4MJHA 2XQYA 2UX6A 3WXVH 4W9KC 5EFIB 3DPBA 2ZE0A 1U8LB 4IRJA 3GRBA 4GQQA 3LV3B 5E8EA 1FNSL 1SJHA 3AT0A 4JG5A 4R4FH 2XNAB 3GSRA 1IIKA 1P4BL 3HHRB 3MRCA 4GAAA 3MTRA 4LP4A 4ORZC 3STLB 4WENB 3UAFA 2AEOA 1CICA 3F65A 5F7DB 4PRHB 3HRZC 3UJJH 1MIEH 2GT9B 3BUDA 3DTUB 3FSWA 4Q9CA 3VGAC 8PAZA 5EF3A 3ARDC 3VB9A 1P2CB 1EAOA 4G8FB 5H35B 4BZYA 3NEOA 2CM5A 4O2EA 1QBBA 2EH8H 5BQ7B 5E1AB 2P5ED 5KBKA 3EH4B 1S7RA 2BIIA 3F62A 1CTMA 5CEYA 3WEBA 3HMWH 4APQD 3KLHD 3VSTA 1DDTA 5BQDA 5KSBA 4PY7B 4ZUTA 2Y23A 4IMLB 3NCYP 1N19A 1NZRA 4QYAA 3I0WA 2GK0A 3ROOA 4LCCA 2EDBA 3WD5H 1URZA 3T6ZA 3LZNA 4IGBD 4L5FE 3DNKA 1I8UA 1JHLL 1IBFA 1RIUH 3AZUA 2HFGL 4AGQA 43C9A 3GSWB 4JFFA 1I7UB 3MUY1 4JZOB 3D18A 5CNHA 1DJSA 3UAJA 1Q9WB 4ZOAA 2CO6B 2Y6SD 2KL6A 3H9HB 4J4PD 4N8CL 3ETTA 1ASOA 1K4CB 4LLYA 3EGXB 2JJSA 1G0YR 1TR7A 4Q52A 1XGRB 2FEDD 3B3IA 4MJ4A 4YHOH 5IQ7H 5I6KA 1KFQA 1I1AD 5DRZB 3DA0A 5HYIA 3TNMB 4JDTL 1T2JA 4LQFH 4MKTA 2F18A 2DL2A 5HGAB 5T3ZH 1G0XA 1Q9KA 2RACA 5CN2A 3SDAD 1JVLA 3CWTA 3QXUA 3I50H 2MQ3A 4PIRF 5I1HL 1VADB 1OM3H 3VU2A 3AREB 3MOQA 4UBDD 2BOBB 5JHLH 5LXGH 3GM0A 5KAQF 1DVFA 4FHKA 1CG9A 4M61B 1NGZB 3CH1A 3UADA 4FAAB 1XF2B 2BY3A 4TXVB 4ORGA 2XPGA 4RAUB 1GGIH 1ZLVK 1DBBH 3QULA 4TPSA 3EO0B 4TV3A 4AUUA 2Q9OA 1V3MA 3GXNA 3LEXA 1XFPA 1AXTH 2GJ6B 3KL0A 4M7JL 1TMQA 1IAKB 4JQIH 1GS7A 3FT2A 4YDJA 4ODUB 3IPFA 4PRPE 5HDQH 3VGEA 1IKOP 4NO3A 1EBAA 1D5IL 2FECL 1QFUH 5DZ9A 3GNMH 2O3OA 2FYYB 1AZUA 1QSEE 4JLRA 4OZIA 5I74B 4AIEA 3KZ8A 1Q0XL 3UYPB 4JKMA 4ZFFB 5IF0B 1YEWA 4YBQD 1GGBL 1ZLUH 3TVMA 4DP2X 4F9PC 3EO1A 4KI5D 4CW1A 2CXGA 4XAKE 3WJLA 2EYSA 4XPGH 1J48A 1KGUA 2VSMB 5DD3L 2YRPA 3K6SA 5JMVD 1IBBA 5EN2A 2DMBA 3I9GH 3HE7C 4R3SA 3QJOA 1XL6A 1YDPA 5GZOC 2CRIA 2WQRA 4QXUL 3WFCH 3DUUA 2E8ZA 3QDGD 1KEML 3KPNA 4JJ5B 2JMRA 2GK2A 2VH5H 4J3XA 5KYXB 5KW9L 3FU7B 5KBLA 3T77A 4WV1A 3H53A 2OOXA 1XIWB 2NY4C 3NDYE 2VZOA 4X8XA 1XT5A 3HN3A 2F6AA 2IBZY 5D7EA 1ADQL 5TE7L 1C9BB 1NFDE 2O5YH 4LEXH 4D9QD 3W0WD 5I0DA 3MCLL 2R2CA 2A6KA 1EHLH 3TO4A 2JWYA 2QZQA 4LP5A 4DHLA 4DKDC 4YHML 5EWIH 5EIIG 3MV7B 4ZSOA 5IYDP 2IO5A 3QQXA 4HFUL 5IB4A 3ISYA 1CVRA 3R1GL 4NHCH 1S9YA 2X42A 1PZUB 2EEBA 5BV7L 4ZTEA 2YUWA 1HILA 2EXYD 3OSKA 3NJGA 2Q7YA 1A1NA 1KPRB 4YE4H 5F7FA 3H6JA 4YLBA 3LQAL 3VDAA 2AVGA 2NPLX 3DECA 3BRFA 3SE9H 1P7QD 3VSVA 4AIXA 1E5YA 5F7EL 1D7DA 1YEEL 1C5BH 3JWDH 1CCZA 4YSDA 4Y9CA 3FB6B 3HAEG 1M1XA 3DARA 5ABDE 4JR9H 4G9FD 4PJGF 1GCYA 3OF6A 2EEXA 4DKTA 3X13B 3KNBB 5E2TL 4U1LB 5LKNA 1I1YB 3L4VA 4ODWB 3RVVC 4PJ9C 4JO1L 2OXHA 3CX2A 1OGSA 4ZO8A 4AE0A 2WBJA 1D5XB 1SXAA 32C2A 4L0PB 4YVUA 3WLBB 3QZWG 2VIRA 2VN6A 5DUBA 5IHWA 4P46A 5FM5M 5CP7B 3HS9A 3HZ3A 2QT6A 1BV8A 4LRIA 4Y4FD 2H6UA 1A25A 3DX1A 3EJZC 4IRSA 3VYNA 2Q7NA 4M3KB 5DRWA 1YEDA 1XL4A 4HQQL 1AHKA 3B9EA 2ZWLT 3C87A 2IDSA 1URIA 4JFDB 4MAYC 1AD0B 4AL8C 4XNXH 4L1HA 3TBSB 3RA7H 1TLKA 2J5WA 2V9RA 4G8AC 3KPRD 5IEHB 3L3IB 1DBKH 1VFBB 4UQ3A 1I7RB 2X40A 4LBEA 1RZPA 1CN4A 2G75B 2P5EE 4OB5H 1QLRB 4XB7A 4XXCC 3E1ZA 1RPKA 4HSAC 1KPVA 1D5ZA 1IX2A 2PTTB 2R59A 4ODXB 3SQRA 3PIQB 1QLEH 4XGZB 5J11C 2M2DA 1YEGH 2V2TB 4FFYH 2EE3A 3NCEB 2EVHA 2VERN 2BZDA 2BNUB 2CO1A 3WTTA 3PWNA 1ZHNB 1JWSA 3V5HA 5KG9A 1AKJA 5JXED 5KVDE 5H8DA 1A22B 6TAAA 2PABA 3MLTA 4L3CB 3IPBA 4CMMA 4HU8A 2OJ1A 5DJYA 1OE1A 5GS1C 1OWRM 1I8MB 4UYPA 1K6QH 3O2DA 3L3DB 4LOVA 4Q9QL 4I5BB 4IS6B 4Y5VA 3GZQA 4N2MA 3FN9A 1NGWA 4RA3A 1XGPB 2VXQA 5IHZB 1A1OA 5CBAA 3P0VL 2RR3A 1HSBB 3AM8C 5L9DL 4LLUB 3S2CA 3RGHA 3QXVA 4F7CA 4G6JH 5TDOB 1XZWA 3FOLB 3I6GA 5T3XH 3QJRB 3TPUB 3G08B 3O11A 3VFVA 2Y7QB 2B2XH 2J8UA 3HNTH 1USZA 3LZFL 2I60L 1OTTD 4FTDA 4KNUA 3S6CA 2WLHA 2B1AH 3ULVH 2XWRA 4CGUB 2AQNA 4NP9A 2FJGB 4JPKL 1CTNA 3KYKL 2D7TH 2ZD0A 2WYTA 1UXMA 1PKOA 1MFVA 1PD6A 2BRQA 2LT9A 3LS4L 5EZPA 3DGGA 2QSCL 4MQSB 4PRAB 3CVIH 4ISVB 1ZSDA 1G7LB 4PRID 4ZDHB 1RZIA 2UZYA 3ZSSA 2O5ZL 4AENA 1KTDB 2BNQD 1F3JB 1UKTA 2WXHA 5E8DL 5IVZA 1JGDA 2EINB 3ZE1E 2AV1A 1G7HA 4H1LG 1FVEB 3O4LE 3G5YA 3UBXB 1X9QA 4DEPB 4RDQG 4HVBA 1I4FB 5ILTH 3QE5A 4K2UL 4AY0A 4FQ1L 1UOLA 2AJZA 4H0GA 2QHRH 3Q6FB 3QUHA 4QR7A 1C7SA 1WAEA 4TRPL 2OP4L 1U3HC 3HPJA 4JVPA 5BO0D 2PO6A 3VFNA 1KDJA 4AX3A 1NDMA 3TEWA 4W9JC 3QEUA 3CQQA 1BEYL 4YHLH 2BS9A 2YO3A 4EO5A 4OGXL 3ZTNH 1BEXA 3ZW3A 3ILEA 2EACA 1AACA 1IL1A 3QDGE 1CL7L 1EUUA 3IEAA 1G7MA 1QNZH 1XD1A 4I88A 4RMVA 4TL4A 1F11A 3MNVA 3MYZA 2WQWA 3UO1L 4WIQA 2CNYA 1KLFB 1R24A 1INQA 2NY1B 1F1GA 4FD0A 2G30A 5INCB 3UEQA 5IESL 4TTGA 3EIFA 3GYRA 3D4VA 2VDKB 4D9QE 3W0WE 1A2YA 2WV3A 3PQYD 1OSYA 3LNFA 5JW3H 2WWMC 3GS4A 3EADA 1JXDA 4QJ5B 3O3UN 4G7YL 2M83A 1WJWA 3AGWA 4MD0B 5CS7A 1FIGL 3EYFA 3JV6B 1UM5L 1F90H 1AZRA 1G87A 4E9LA 4LGRB 2FH6A 3Q8EA 2ERJC 1MLBB 1RURL 2X4PA 3ZHFA 4WAFA 2Z64C 2LLLA 2BJML 1MCEA 1MCOH 1QBMH 3OR6A 5CINL 5HD8D 2XX0A 1Z9NA 1HYSD 3OJMB 3BSGA 4DT2A 3RWEB 1HEZA 5F1IA 1E4KC 4GO9A 3OLGA 2ZOTA 4LAQL 5DVLA 1BMZA 1P9MA 1BVKB 3EYVB 4G9FE 4APXB 2Y9RT 2G4GA 3DHPA 3HMXA 2A83B 5AQ0A 5EF2A 1AS7A 2AJ3A 2ZKHH 5BXFA 4MJJA 1PGRB 2FBRA 1F42A 2KPNA 2R8SH 2YPVH 5CLXA 1IMHC 2CHNA 3KYMB 1FVCA 5DHEA 2HL9A 4YXHL 4Y4KB 5AKTA 5F0LB 4PV9B 2IPTH 2FJFB 4OZGF 2PUQT 5CILL 4XO4A 2FX9H 4I1RA 5E7BA 3LSOA 4XPTL 5AVZB 3G5ZB 5ABAA 1LWRA 2K8QA 5JYMA 2J57A 3FH7A 3MBEA 4MNGB 1QX1A 2Y4SA 4NOFA 4D8PA 4EI5C 2DBJA 1YJDC 1LVEA 3EG9B 1T20B 3I9PA 3QNFA 4ZTPH 4B53A 2GY5A 1QKZL 1UT9A 5JHDE 3EJYD 1ZV5A 1MZZA 5LHDA 1EIBA 1XF4B 2DYPA 4PJFE 5IVXF 1W15A 1F18A 1XEUA 1JGVL 2LQRA 1E5BA 1X7SA 3GHEH 3RX5A 3U48A 3UIYA 1EWHA 4HWBA 5E7FA 4XMLL 2BP0A 3AU1B 3KPRE 5A2KH 2C4FT 4L3EE 5C97A 3MLVH 5A6IA 4MA3A 4IRJB 4WFED 5E8EB 1E6OH 2CD0A 2IAND 2I27N 3L4XA 1SJHB 2VXVH 3ARGA 3QYMA 1WC7A 1EZVX 2PWHA 3GSRB 3MRCB 5D7LD 2D0HA 5JIKA 5KSAC 1CICB 4HEPG 1W16A 1O7DC 4JFZH 4W4NA 3WXWL 1BBDH 2AQ2A 2F1AA 4PJXF 1NCWL 4MD4A 3OGCB 4E41D 1BJMA 3AWEA 4XO9A 5J3HD 4OLYH 4MCMA 2EDWA 2PP7A 4Q4EA 4O2EB 4MKMA 4YSEA 3OLPA 1A8ZA 2VUYA 4EN3D 4OJFH 3UZQA 1U8MA 4L23A 5IQ9B 1JZ2A 1S7RB 2Y5EA 1FBIL 4FQLL 5CEYB 1QLEB 2Z35A 3CZLA 4HIJA 2V8QA 3MNZA 4ACTA 3KGSA 1LEKA 2OCFD 3KW7A 4E9RA 1VFAA 5CCKH 5ADOH 5KSBB 1PD0A 4ZUTB 3VXMA 1TO5A 2AABL 3ROOB 4LCCB 3LMJH 2OR9L 3NSFA 3Q1EA 3WFDL 4X80H 3IFPB 5L88H 2VLRA 2VXQH 5EOCJ 3TBBA 5J8OA 4XWGH 1AZBA 1A47A 5AZEH 4JFFB 2FO1A 4TMPA 3D18B 5LJYH 4PMEA 1AGBA 5MI0C 4C56D 1DVYA 4OGQC 4F2EA 4HZLB 4PY5A 1TYRA 4LLYB 1KCKA 5HGGS 4QF1A 1JYVA 5C0NC 5L6YH 4X8GA 3B3IB 1JPST 2IOOA 5F7AA 3QPXH 4PRIE 2LU4A 1FL5A 4EXPX 4Z7QE 1RUMH 4KPHH 2VUKA 1K9TA 4UV7L 4ZW7A 1N5YH 1UD5A 5C9JA 4GXFA 2YN3A 2BNQE 5B39G 1EK3A 4F20A 1LQBC 2NNCA 3U1SL 1Q9KB 4X0KA 5FDWA 1HZHL 2X5PA 2CBMA 3PPSA 4HS3A 1OAKH 5L2KD 1QEWA 2X6UA 3QG7L 5E2VH 3GXDA 3QEGL 4M29A 3VAEA 4Z7VA 1TTCA 4RDQF 1DVFB 4AG4H 3GXPA 1CG9B 2HJFA 4IU2A 3CH1B 5HHOA 4FG0A 4XH2A 2YEVB 5EO9A 3RHWK 3BT2L 4ORGB 4MRQA 4FQQB 1OP5K 3CSFA 4HPYL 3RWJA 3NIDB 4PWFA 2W92A 1YY8A 3QULB 5I5RA 3L81A 5LDSA 3LEXB 4KKLD 1UWFA 3EZJB 3LTVA 3QIBA 4YDJB 3UG3A 3FT2B 3P1VA 1UEYA 4PJEE 3GDCA 4X50A 3AS3A 2PTUA 3PGCB 1INDL 2DQTH 4NO3B 2IFFL 3ETBF 4MA8H 5AB1A 4MHHI 4JLRB 2CRMA 2GCYA 3QC5X 4HGMA 1QRKA 3KXFA 1WF5A 5HGHA 4PG9A 4DK3A 3TVMB 3EO1B 4BHUA 4HEMA 4CW1B 4Z8FL 3JUYA 2YH5A 2BINA 2VO8A 2EDNA 5GS0H 1RFDH 4I18A 5EN2B 3UAAA 1QN5A 3LNEA 2V7HA 4R3SB 3ZR5A 1YDPB 3PQYE 4Z0BH 4N2NA 4ODSH 1VZGA 1VZHA 3S3DB 3U83A 3DUUB 2QPEB 2VXTL 3KPNB 4U7KA 5KVGH 3GSVA 2WZ6A 4M4RA 5CXPA 2G3MA 1Y6NR 4WV1B 5TF1H 2PYED 3T77B 4Q0XL 4ODTL 1SHMA 1OCRB 3HNSL 1IE4A 1MVUA 2RTTA 1QSZA 4WGKA 1OCWL 2J55A 3C6LD 3ELQA 1MCHA 2WKOA 4IJ3C 5CKGA 3RY5A 3SDDC 2EEDA 2AJUH 2VC2L 1N18A 2X53A 2A6KB 4HUWA 1JI2A 1PLBA 5HDBE 2OTUA 1RZFL 1LWHA 2A9BA 1IC1A 1KB5L 4OKDA 4KK6C 4ZSOB 3V79C 1UL7A 1LXMA 3F58H 5HGBA 5IB4B 4PVBA 4ETYA 5KYUA 1TZGL 4KGJA 4U6XA 3QZMA 1JNNL 1S9YB 3SDXF 3GBMH 4LVHC 1BAWA 1HILB 3HMXH 2Q7YB 1A1NB 1N67A 3VFUA 3FSVA 1PCJX 1S46A 3TXAA 4UANA 1S3KL 3APFA 2BWIA 3KW8A 1I9RH 2EVGA 1MCRA 3N1FC 3L9EA 3CVTA 2EH7L 3WELA 3QWRD 1M1XB 4IOFD 4OZ4A 4QRUA 1JFQH 4ZMYA 3CJJA 2HRPH 5BVJA 3ZY7A 2OXHB 2WBJB 1BQSA 32C2B 1I85C 4U3SB 3CX5J 4ANKA 3U2JA 5JPNC 5EULV 2VIRB 5DUBB 4P46B 4XBGA 1ND0A 3J7HA 4HWBH 5EU3A 2GSMB 4WFEE 4M5YL 4S10A 2IANE 4IRSB 4B96A 1HL8A 5TQ2L 2APVA 1KFAH 1WZMA 1YEDB 3LPOA 5D7LE 3WNLA 5I6LA 4LZKA 3PP3K 2R0WH 4NUGL 1C08A 4BH7A 2WO2B 4X7SL 4U7SA 2ZOOA 3U30B 2R1WA 4BXSV 1IBDA 2EECA 1B3IA 2WLIA 4NLHA 4PI2A 4YHIA 1BQ5A 3AROA 3CCHA 3CLFL 3PLYA 4DVRL 2XZCL 4E41E 5BW7C 1INEL 1DJWA 3LNIA 1ODUA 1YHPA 4FE9A 4UQ3B 3ASOB 1NSNL 1AO7D 1E3FA 2BERA 4LBEB 4OLXL 2WWOA 2AZAA 5DFVC 5JLZA 3MI6A 2CNZA 5FUZH 1KPVB 2CQVA 4KBPA 1OB1A 1KBPA 2WW8A 2Y0SA 1QFOA 5FHAH 2NT0A 1VA9A 3D85A 3TEUA 1UT7A 2Z0FA 2VLKD 1B4JH 4RAVB 1DEDA 2NOZA 5IMMA 1NOAA 1T3FA 1VFOA 2E27L 5CJQL 1A3LH 1UT2A 3V5HB 4CDHA 5KG9B 1AKJB 2JQMA 1IFRA 1BDYA 1JZFA 2AKRA 3BEVA 1DJZA 4J3OD 4PGBA 2FUVA 1JCVA 3SQBA 5DJYB 4C56E 4G11A 1JE6A 4IU3B 2DEXX 1W2KT 5K5YA 4GKOA 2CR3A 2J1XA 2R39A 4FLQA 4JPVL 4Y5VB 3LPGA 1NGWB 3EHBD 4MA7L 1FZOA 3TA3A 1A1OB 1QSFD 4FS0A 4HIXH 4JM2C 4ZAKC 5CBAB 1FPTH 4HJJL 4UTAA 1CDJA 4F7CB 3PYCA 3RFZC 4HK3J 4HOMA 3ARFD 2LLGA 3O11B 3TZVB 1VAHA 2HVBA 2J8UB 3GJFK 1KJVA 2MPAH 5I1JH 4WTXA 3F83A 3QRGH 2HL8A 1E5AA 3T2PA 1UB5A 5E2UL 1SDDA 1FLRH 2JNZA 1BZ7A 4LPXA 4POUB 2OK0L 3BRDA 3ZDXE 5L2KE 4H2CA 1SEQL 1EHXA 2QR0A 1UD4A 4FQIH 3DGGB 5DWUL 2CPCA 2YSSA 1QG3A 2WLLA 4PREA 1ZSDB 1RK7A 1IB5A 3H54A 3MJ6A 4K3EL 1OP3K 1RZIB 2UZYB 1WFNA 2A77L 1W8NA 4AENB 1KENL 2HJLA 5IVZB 1JGDB 3OLEA 5G5DB 1YC8A 4LSUH 1QHQA 1CGTA 2AV1B 3D0LA 3HG4A 4TSCH 4BK5A 4AMKL 4R26H 2VDMH 1R46A 4NZDA 4JHVA 2YN5A 5ESAB 5IBTH 2Y72A 4LGSB 3QG6A 1GR7A 2H9GA 5LLIC 1RIHL 3NIFE 5T5NG 4WY7L 4BZ1L 2AJZB 5JPMA 1C7TA 3H9SD 1H6TA 1A6VH 3VFTA 1ZOXA 4CC0A 1H8SA 4KK8C 4AITA 4AYEC 1KELH 2FX7L 3HPJB 3CMOL 1N6QH 4WK4B 2DQDH 2ZFDB 2PO6B 4TVPH 3VFNB 5IUSA 1NDMB 1BZEA 3QEUB 4YLQT 4HD9A 1S8DA 1F8TL 1NGYB 4TLTA 1PG7L 2F8IA 5JORA 3W5MA 1G7MB 2WXNA 3Q2VA 4JANA 1CYGA 3LOWA 1F11B 4LCUB 3MNVB 4LFHG 5CGYC 5ADPH 4NJ9H 2DIEA 1UXSA 4HHWA 3EJTA 4JRFA 4O58L 2ICWB 1OW0C 1U6AL 3BKCH 5CJXC 1R24B 3MFGB 3DXAA 1EHNA 3SGKC 2A0LD 1INQB 1NCGA 2VR4A 2Z3FA 4A7VA 3RWGA 2Z93A 1QZ1A 2SEBA 4FADA 5I71B 5EPMA 1A2YB 1DVTA 3VVVA 2IAMC 3U9PH 2VDLL 1VGEH 1VZIA 4RZKA 3IM1A 4M3JA 5BO1H 4Y1TA 3EYFB 3OV6A 5E6ZA 1RZJC 2IF7A 1Z5YD 5EOQL 1UACH 4FL4B 4PLJD 2WCPA 5FW6A 3V4UH 5A6MA 4XWOD 4MTMA 5JMRA 3R0MA 5EBWB 3BP6A 5EEWA 2X4PB 2ENQA 2XY1A 3GGWA 3JWOL 4H8VA 4JQXA 3OR6B 4GO8A 3VD5A 4Z7NB 1CGYA 4P2OD 1FCCA 5F1IB 1FG2A 2E7DA 5IQOA 4F37F 3QIWB 4PP2A 4DUXA 2VSCA 2P9RA 3WIAA 4A37A 3BDXA 1KN4L 1RP9A 3FUNA 4X4ME 4ZBJA 3CN1A 2AJ3B 1U9KA 4CJ0A 5BXFB 2E76C 4N1CA 3ULSB 1R0AH 2K6WA 2FBJH 1FNGA 3KEDA 4NC1E 4R83A 1UKQA 3UIZA 1ZHKA 4S2SA 1FVCB 3TWYA 3DPUA 1ZANL 1HVXA 1FFNA 3NA9L 4HZ1A 4ANXA 4N8UA 5LG1A 3BD5A 1SVZA 2P45B 3LSOB 1HDMA 4KX9A 3MBEB 3RVWD 1J0KA 1CYWA 4D8PB 2WXMA 2G3XA 3VXTA 3CC5A 5B1CA 3ZDZF 3L5XL 3NCMA 5BVPH 1FFQA 2DYPB 1OXYA 4AI7A 2FIKA 2AEQL 3K3QA 4Q97A 3FU8A 5D93B 4YGVA 4RNRA 3F5WA 5GGQH 1RERA 2WZPD 1XF3A 2BP0B 3S96A 4FQXA 4R90H 1JOIA 1AO7E 4MA3B 4PJ6A 2EUWA 1T0PB 1PJWA 3VGBA 4MS6A 3PNWA 3ZIYA 1WC7B 5ERWA 1RSYA 5AVQB 3H42H 3A6BL 1OOWA 4EUPA 1YMMB 1DJHA 1PAZA 4WNQA 4AIZB 4N25A 3FPXA 3VRLF 2EDJA 2VLKE 5GZNC 4UWQB 1E7UA 2C9XA 1BZDA 1Z2KA 1A7RL 4MD4B 4CSPA 4EAGA 3WLWC 4MMZC 4JPIA 3ECVA 3UZQB 1U8MB 1JPEA 5D7IE 4D9RE 4YHZH 3G6JB 4WUKL 4GT0A 3VG0L 1MFAL 2Z35B 4HF5L 1R3LA 3MNZB 2WXOA 1LEKB 2EXYC 3AUWB 1VFAB 5DD1H 4JY6A 4JRYA 4AQ8C 3LZOA 4OBSA 4F33A 3SPVB 2HRHA 1OCOB 1QSFE 5ICYA 4HC1A 3U7AA 2VLRB 3BWAA 1UCBL 1SGKA 4UTAH 1DVUA 1GTFA 4ZFOL 3QK0A 4JJOA 4QHMB 5DJ2A 3TL5A 2DMGA 1AGBB 1TEFA 3G5VA 1VERA 2Q0ZX 3FRUA 4Y2DA 3U4AA 4XN8A 2IQ9L 2WXFA 4OI9A 1UZGA 3ILPB 1DHKA 1D7BA 2K9UA 4JAMA 4OI7A 2K9FB 4QF1B 3BZFA 4KUZL 3KBEA 2IV9A 1K2YX 4JCMA 3Q2NA 4B27A 3ZE0F 2ODHA 5JW4R 1FL5B 1JF1A 4XBEH 1UM4L 3ZL4L 3HJ0A 5C9JB 4L8CA 5JQIB 4YXLL 1IILE 2K6ZA 5AD0B 3MLXL 3EBHA 4X0KB 2FQGA 4P2RA 5FDWB 3T4NA 4HXBL 4HS3B 1CWVA 1CUOA 2W38A 5D8JH 4Z7VB 2ZOUA 3KPLA 2XXFA 2HJFB 4IU2B 4OZFA 2H1XA 5ALBL 5HHOB 5EO9B 3KVDD 4KY1L 1A6UL 2QQNL 2BDNL 1LMKA 4W6YB 3WKPA 4AQZA 3RWJB 5BZDA 1YY8B 5DFTA 1FAIL 3FXIC 1YQKA 3EDDA 3H9SE 2H0JA 5D1QD 1MFDH 4XX1G 1T5WA 1NMCB 1USQA 2TSBA 3QIBB 4HWZA 5DJDA 2F58H 3BAYA 1HHIA 4O51B 4PHZA 3PGDA 1NGQH 2FAUA 1U8QB 3NN8A 3QUYA 3L5JA 1GYVA 2GCYB 5HGHB 1BX2A 3KXFB 1JTTA 4PG9B 1Z7JA 4AEHH 2KMWA 3HR6A 4M6OH 4RMRA 4TNWF 5IHHA 5I19L 4I18B 2H5AX 4A55A 3S36L 4F8OA 2EZ0C 3BQUC 4UOJA 5BRQA 4YQXH 3AQZA 3NZ8B 3AU0A 4I2XA 3OX8A 3NA4A 4RSYA 3QFDA 5F9WB 3ZYOA 1RUKL 3GSVB 3HNVL 5JA9A 4M4RB 4NLAA 1PQZB 2YQ2A 5EZIH 2WTPA 3V52L 1NCUA 4CC4A 3C9NA 3AXLA 4W9EC 5CR1A 1T0NB 3SE4A 3UTZA 3D07A 4OTXL 4K3JL 3MLSL 2BY0A 4HUWB 5B8CC 1F5WA 2OTUB 3LN4B 5AW0B 2Q6WA 2AQ1A 4MSWA 1EJOH 2ZWYA 1JGUL 1S7QA 1PEWA 5HGBB 1B0RB 2QRCA 4EJZA 4ZMQA 3HR5A 2WUBL 4F8PA 1OGAE 4QGYA 3FBQA 5B3JE 2CWRA 3M45A 3RPIA 2ARWA 5LCVA 5E4EC 4YH6A 4HJEA 1IGIH 3EBGA 3VFUB 5DD6B 4H20L 1RLWA 2AGJH 4V33A 4Y4HC 5F7KC 5H94A 4IBZA 3E8UH 1LLAA 2C3VB 5E5UB 3L3GA 1GIGL 1W0WA 2UY6A 1CFVH 1WT5C 4B60A 2E5EA 3DVNA 1MCCA 4MAUH 3V5KA 2LE9A 3T2NH 4Y5YC 2IDFA 2RJMA 4OZ4B 3VFSA 4QRUB 3SO3B 3VYOA 5FYLH 4FI8A 2QGEA 2C1OA 1Y6KR 1FN4A 5TTRA 5BVJB 1NJ9A 3O3AA 3PGFH 1IARB 4P5MA 2OMXA 3RTQC 3RPKA 1BGXH 4F8LA 4X6FA 1Z6JT 3P9WB 3OJ2C 3INUL 4IDLA 4WI4A 1Y18A 1JZHA 2B15A 2OYKA 4XBGB 1ND0B 4Y1AD 1P1ZA 4XPAH 3W37A 4UI2A 3WAKA 2ORBL 1BVLA 1XEDA 1VCAA 5EU3B 3ZKNC 1U3NA 5IHUH 3F64A 4OM1L 5EZLA 3SCMC 2CUMA 3HVDA 4JN2A 4M7KL 4M93C 4BH7B 1ES0A 2JCWA 1C08B 3AFLA 5IM7A 3IAQA 4PGCA 1PAMA 2R1WB 4PJ7B 1N70A 1OAZH 4EIGB 2WLIB 4YHIB 2YWZA 3VFPA 3CCHB 2F54E 2NUPA 4DN3L 4FABH 5D4HA 4R0LA 1EXUA 2Z31D 4PYHA 3ZXAC 1PBYA 1PCXA 3N1QC 5MERB 3CVBA 4KV5E 4P4KA 4X8JA 3Q5YA 5JLZB 1KGCD 4EEEA 5IGXL 3NK3A 1RK0A 4BA0A 3I02B 4ZXBA 1NIEA 3P77A 5I17B 4KK9D 5A1AA 1EO7A 2D8KA 1CLZH 3D85B 1F6FB 4D3CH 4RMQA 4XN5A 4XTRC 3CZNA 1KSRA 5FPIA 5IMMB 1T3FB 1JPTL 3JVFC 5EEZA 1G84A 2H0FA 4G8GE 1L3NA 4V1DA 5JMOC 3C08L 3RPJA 1CR9L 2AKRB 4HH9A 5EA0H 3ESVF 4PGBB 3SQBB 4KVNL 3QUXC 1EXGA 5CGTA 1CU4L 4JDZA 5E4OA 1BWWA 3PL6D 4R97C 2D0BA 2NXZD 3THMH 1FZOB 4R4NC 3TA3B 1AFVH 2NY5H 2VM3A 2Z0BA 2G60L 5GGSA 3WMSA 2CKBL 3LKPA 5ACLA 4HUCA 1MCPH 3D25A 3P4LA 1C5CH 1SOSA 1BD2A 1E4XL 1VPOL 1WWBX 2O6EA 1YPZF 3QZNA 5I30H 4PJ8D 5CEXA 1KJVB 3FT1A 3TBYA 1U95A 4X6EA 4JVWA 4XC1L 4B0MB 1IGTB 3LPFA 1UB5B 4QD2E 1SDDB 4JMNA 4J3VA 1CGVA 1OE3A 1BZ7B 2YA0A 3S3PA 3GO1H 5BZWA 2MNWA 1SY6A 5I6XB 3WO4B 4O4YL 1N3CA 4KDTC 3WHE1 2QR0B 1ROWA 4C4KT 1T4KB 2PCYA 2WINA 3BIBX 4R5XA 2YSSB 4YDMA 3LNHA 2WLLB 4PREB 4NN5B 3ZUCA 5F7HA 4HCRL 3DVFA 1Q9LB 2WM0A 4RDBA 4G6KL 2XWJB 4OZFH 4DGVH 5F0JB 1OPGH 4QXTB 2OI9B 5DHYA 4GQPH 5D1QE 5HPOA 1B3JA 1EFXA 2J4WH 1Z3GH 3D0LB 3KPTA 4OV6F 5AVXB 2B20A 1R6VA 5FYKE 2MCPH 1L0YA 2DH3A 3MROA 3QG6B 3ARRA 2W07A 5B4MD 2H9GB 4NKMA 2K70A 3D39A 1R5VA 5GRYA 3W11C 5I1GH 2AQTA 1CT8A 2E7HA 3T3PE 5DK3A 2RQ8A 4QTIH 5JPMB 1RL1A 4F7TA 1G9MC 4K9JA 4LLDA 2NY3B 3VFTB 2VJ8A 2VDNH 2ATKA 2WVTA 4GSUA 2VKXA 5D2LE 3O41A 3BWUF 4MXWL 2YAQA 3V0GA 5FCUL 1N0XH 4ZMLA 3OG6B 5E99L 3EUDA 4DN4L 4GRWE 4FQHB 4G6FD 1S8DB 3L4ZA 1TZAA 3M46A 2VUOA 3OKDA 3R4DA 1T4WA 4PTTB 5JORB 4B0MM 4WEEA 2YRLA 4JANB 5EIIA 5KBPA 1E9PA 2R29L 5MEPA 4HJGB 3B4NA 4GIAA 1WTGT 4YFDB 3UMTA 5DMIL 3DXAB 3MMEA 4N2KA 1MRDL 2NY2B 3D1MC 4KX7A 2Z93B 4JCLA 4N68A 2SEBB 3QHFL 4MBRA 2IDTA 3RWGB 1TZOA 1J86A 3SYCA 2NY6D 4HXAH 2N1TE 3T0ED 4XNYL 3M17A 2J43A 2WXPA 5GGVL 1WZ1H 1KJ3L 1DN2A 1YNLL 3O6FD 4GAGL 4LKXA 1JI1A 4FEMA 2P5WA 5F72S 4FF9A 2YGOA 1FYTB 2VXSL 4PLKC 5GJSH 1JGEA 1MI5D 3FAWA 4U6HA 3BP6B 4G3YL 3GGWB 1V8HA 5FFGA 3HTLX 3GBNH 3M7FB 5EOCL 4P48A 4R5TA 5LCVH 4QHKJ 2J88L 3WKMH 2NY0B 2PPEA 3VG9B 4GAJL 1FG2B 1NFDF 1GGCL 4U0QB 4UM8A 1U33A 3GTVA 4NQEA 4PP2B 1FLTX 4W81A 1K3ZA 1GC1H 4G8IA 1L9RA 3QZWA 5L8LB 4XHQA 4OZGA 3CFTA 4Y16D 2C7FA 3BZ4A 1YSOA 2DTML 3WTSA 1AZVA 2K78A 1FNGB 4KKLC 2CHDA 4LHUD 1DQIA 1ZHKB 4S2SB 1ZJAA 4NQCD 4S1RH 1FFNB 2RQEA 4NRZB 3GF8A 3G6DL 1JAEA 4FFWC 4KK5D 5F89A 6PAZA 5IVXA 1XGYL 1HAWA 4Y1AE 1NEZG 1H6EA 3AREC 5JZ7C 1NIDA 4CU6A 1A65A 4N2LA 2WXIA 4OUUA 2CZNA 4AQ1A 3KTUA 5AB9A 5JQ6H 2E3VA 1JERA 3QWNA 1RCYA 4LPYA 3CC5B 3VXTB 4A2FA 3HC3H 1OF0A 3BAEL 1QNAA 1V05A 3F04A 1N8ZA 2W0LA 2YK1L 2FIKB 1F58H 2EE0A 4TLUA 4RNRB 1PNCA 3RU8L 4U49A 4E9WA 2IPUG 2QVIA 2E74C 1XF3B 3O6LL 1P5VA 4FQXB 2GITA 2ZAIA 4BFJA 4PJXA 3ZHLA 4JKPH 1KGCE 3PNWB 2QKIA 4ADIA 5ERWB 4WNQB 4B9IA 4KKZA 1TTRA 1BJ1H 1S5IL 1MP9A 2BSRA 1S2EA 5DA0B 2I5YH 2HPTA 2IH1A 5J7CC 4RFNC 2EDQA 1BPLB 3GPSA 3JSSA 4X6CE 1O6TA 4HAGA 1FE8H 3X12A 2BPBA 4MBOA 4BSVA 4XP4L 4BQ8A 2J1WA 4ONFH 1UUSA 2IMNA 4JY6B 1XIWC 4JRYB 3CHQA 1M6OA 2HTLD 5D5ME 4F33B 3ARWA 3OH6A 5ICYB 3K71A 5C0RH 1U8HA 3NZHH 2GVYA 1G0DA 3K0YA 3M1BA 4GMSL 4LPWA 4QTHA 3BWAB 1A7QL 1KCVL 4NCDA 3PAUA 4LESA 1UA6L 1A9EA 4QRPD 2V17L 3QZOA 4U6VL 5MP6L 3JZYA 5DJ2B 1WISA 5TE4L 3CZFA 5D96B 4YE0A 3G5VB 2C7UB 2HFTA 4KTGA 1RQ5A 3FRUB 4Y2DB 1NIFA 2GJJA 4V2BA 4ES9A 2BHUA 5T5FL 1HCVA 1BLNA 4MXVE 1EMTH 5GXBB 3QWQB 2Y7SA 4DIXA 3QUZC 5M94B 3BZFB 4B50A 1G6VK 3WTWA 1SY6H 1ETA1 4JKKA 2FWUA 2XJKA 4H1LA 3DRTA 1I8LA 1JSYA 1JF1B 4GW1A 1SBSL 4LL1A 4JREB 4L8CB 4N9OB 5I73C 1JZIA 5DEGA 1KJ2A 1NLBH 2F8VA 4TTDD 4U0RB 2HLFC 1WGVA 2VCOA 4F58L 1UURA 2I85A 2O5XH 1RIVH 3W56A 4H26A 5FUOH 1WA2X 2YXMA 3X1EA 5B1KA 2YLKA 4FZ8H 2WQSA 2QPDB 3KPLB 3J2PA 4G59C 4OZFB 5HYSG 4DGIH 1ZCRA 2YD8A 3OHXB 4K94L 5HYFA 3UGEA 5CZXC 5BZDB 6FABH 2FR4A 4GG8B 4IBUA 4GQZA 1L7TH 2V37A 4NZRH 3WN5A 4BJUA 4NQDA 2FWOA 1T5WB 1M56B 3MUHL 4HWZB 3RX8A 1J1PH 5HYJD 5FOJA 4JHWL 2HCZX 5DVOA 1HHIB 3BH4A 5K9OA 4WO4B 3PGDB 2I9TA 2VB5A 4OI8A 5LWYH 2H3NB 2B4CC 3C5ZC 3L3JA 3FB5A 3MJ8A 3P3UA 3ZE1F 3NN8B 1QBAA 4CFFA 4BGLA 5IJVA 3IRCA 3ZRSA 3QUYB 3B8SA 5AEAA 4HWEH 5H4ZA 4AJYV 1F4WH 5LGHL 2XWEA 3GRGA 4QAMB 3RDTC 1BX2B 4LMQE 1WFIA 2M1KA 3NEXA 5IWLC 2VDNB 1IC0A 4PS8A 3TTYA 3MJ7A 2NX5D 4P49A 3QYNA 1ZVSA 2JJTA 4B9ZA 2WUCH 4XCFH 5GHWL 3GHBH 4NZTL 4RMSA 4U1GB 4A7GF 1KB3A 3APNA 3WIHL 5DS1A 1MWOA 4XHJD 4YZWA 3U7WH 3I3BA 3I3EA 2AXGA 4OQTA 3V4LA 1YEHL 4I2XB 3CVHA 1OGPA 3OX8B 4J2QA 5HHXH 4PB9L 3DROA 3QFDB 1DCLA 5IJDC 2K7QA 4Z7IA 1CPUA 2VLJD 3CXHJ 5K33A 4ZMNA 3IXAB 4UU9A 1PG7X 4OIAA 5F7UA 3HRZA 4N85A 1MI5E 5IJCC 3RAJH 4QNPE 2YKLL 3HRPA 3C9NB 3AXLB 2BCMA 2ETWA 2G2NA 1UZ8A 3BAKA 3BN3B 4Z95H 1DCEA 3UTZB 3SDXA 4ZNEE 4HG4J 5B38B 3O81A 2WVVA 5J5EA 1NFAA 3OMZA 3ESUF 4G1EB 2VMEA 2Q6WB 4MSWB 5I1CH 1BHGA 4FYTA 4KQ3H 3JQOB 3CDGB 1S7QB 2R27A 3FB8A 1T66C 3MNMA 5F9OH 4D7RA 4GEJA 4YDNA 2FQDA 4TQPA 2IEPA 3HR5B 3FW6A 2QR1A 1KFIA 4OCXH 1ONQA 3RPIB 3ZL1A 4ANVA 3ARTA 5AVWB 2OXGA 4NQCE 2HG5B 2YPLD 3N43F 4K9EH 5H94B 4XP5H 3ML8A 4GG6E 3L3GB 1W0WB 2UY6B 3HC4H 4XP1L 1KO9A 3DVNB 4KJQC 3V5KB 2J1KA 5TPWL 3VFSB 4S11A 4ERSH 1TF4A 3BEWA 4BGDA 4TNVK 3S88L 2C1OB 1U8CA 5KN5A 3KMDA 1YNKL 4OGAD 1NJ9B 1QOKA 2KLSA 3O3AB 4P5MB 2OMXB 3ZQWA 1J8HD 4I9WD 5C2BL 5DZLA 4X6FB 2MNJB 3SKMA 1YZZA 3KDPB 1WFTA 1MPAH 3EXJA 4HBCH 4HLZG 1Y18B 4N2EA 3W9DA 3OKMA 1KULA 1P1ZB 2OV0A 3IN2A 3SDYH 1AH1A 4L3AA 4IKJA 5IEKA 4QWWC 1MCSA 1HT6A 5EC2A 5EZLB 1XH0A 1F6LL 4FJYA 1UHVA 2NLJA 2JQZA 3H1ZA 4ZS6C 3TBTA 1IQWL 1MJUH 4M1DL 3IFLH 1RUAL 3QDJA 1RM1A 1ZEAH 1DLHA 2J21A 1ES0B 1TJGH 5I28A 3GZPA 2VZSA 5IM7B 5DURB 2WSDA 4UT9L 2X9YA 4BZ2L 5JOPD 1S9WB 2EE2A 4QLWA 3VFPB 4PJFF 2NUPB 3PXLA 1EXUB 1TTUA 3CSGA 4LCWA 5DGRA 4P4KB 2PTVA 4X8JB 3RILA 1PNDA 2C9PA 4KZDH 2WXKA 1D2OA 1M9SA 1RK0B 2OMWA 4PBDA 4ZXBB 1JXGA 5CGMA 3P77B 4ZUVA 3N41B 5FIEA 3CK0L 2X6AA 4GLRI 3TS8A 4P9ML 2BY1A 1NCAH 2DQJH 2CK0H 4HCGA 3O4OB 3T3MB 1ZKAA 3PABB 1W6LA 4I3RL 4DERA 1OT1A 25C8H 3QWOA 5B1BB 2IWGA 5I6NA 2GIYA 5EN3A 4QRPE 3O8XA 4V1DB 3EYSH 3V7AG 2DYSB 2AEPH 3HE7A 1Q1PA 2M26A 2OTPA 4HH9B 4OCRH 5GZOA 3QIUA 1TLMA 2A6JA 4TL5A 3C09C 3P0YL 5E51A 5F9JA 1MN4A 4AH2A 1BQHA 2QMKA 5IQNA 3B9DA 2R1YA 1XO8A 5E5RB 2GYSA 4Y2LA 4L0YA 5GGSB 1TJHL 5I15H 1ED3A 5T33H 1E2VA 3PFUA 2O72A 3D25B 1BD2B 2Z4TA 4P59L 1AOHA 4PJ5D 4H1LH 3X17A 1U95B 4X6EB 3MZTA 5AYUH 4MLIA 5K1VA 4BQ9A 2XCMC 4TUKH 4KMTH 4YSPA 2FCBA 3VWKD 5IFJA 4RMWA 1KJ2H 5BZWB 3EH2A 3LVEA 1BXUA 2HRLA 2NNAA 3WKYA 1TMCB 1TCMA 2WINB 2QL1A 1KTLB 5I1KL 3MR9A 1B4LA 5LBSL 1HJCA 3JWNH 5JHMA 2VN3A 2Y2TA 5J1SC 3JWDC 1ZIBA 1FZJA 4LSQH 4PWJA 4Y4KC 5DHMC 1MHHB 2EIEA 5AKVA 1YECH 5DHYB 3VI3E 2MKLC 4F24A 2YWYA 1EFXB 4XNBA 5D7SH 2VW6A 4OIIH 2R51A 1B4TA 4LCIH 1GY2A 1RZJL 3MROB 4YHYB 2W07B 4RX4A 2WLKA 4NKMB 5BOZG 1UADC 3T0XA 3RIAK 4PJ9A 3PHSA 2PCXA 3QR0A 1QSVA 3PJNA 3TEYA 2YUXA 4FP8H 3ZTJH 3BD4A 2Y69B 2EIBA 2NX5E 2D4DA 3CN2A 4LLDB 4F7TB 1FFOA 3MA7A 2AJSH 2ATKB 4IRJC 1Q38A 2AEWA 4IIQC 1S6NA 3DIDA 4F2MB 1LE9A 4JGMA 1KCRL 3O41B 4ZW5A 1AGCB 5KJRL 3H3KA 4QT5A 5I66B 1CDWA 3WFBH 4DQOH 4AV5A 3FO2A 1BVZA 4PJEF 3AVEA 1CICC 3GI8L 4FZEL 4OQTH 3OKDB 4NWUL 2L8AA 5EUOB 3CVHH 3GRWA 3SB3A 5EIIB 1BXAA 4RIRA 5MEPB 1NDGA 2KUTA 4HMDA 4KXAA 2RMNA 3MMEB 4F91B 5JIIA 3QO1B 3BP4A 1ZY9A 3Q8AA 4R7NB 1FAKT 2R4RL 2XETA 4N87A 3S36X 3ZZLA 1OK8A 3M17B 4RGNB 2BS8A 4ZS7L 4XXCA 1JZEA 2D7NA 3IMTA 5DO2C 5FV1L 3RIKA 1WSST 1DBAH 1E5UI 2V8MA 3GMQA 3QEQE 4LKXB 1SN0A 3QISA 1AGFA 4LCCC 2P5WB 2I9LA 3KM2A 2WYZA 3QCVL 4QRRA 2XTJE 2CO3A 4YSRA 4Z3HA 1JGEB 3D30A 3ROLA 4U6HB 3MRNA 1K72A 2XA8L 4BK4A 4CDGC 4HLEA 2HPOA 4R2GB 3UAJC 2YPLE 4X4ZA 4UM8B 4NQEB 3VMOA 1IC7L 5C0BA 2VMJA 5JOFA 2QQLH 2PWGA 1J5HA 2VR9A 4G8IB 3QZWB 1EO8H 3ZO0A 4OZGB 4ABWA 3BZ4B 3OC8A 2VL4A 5GGTL 5EU6D 4PWKA 3G5XA 4UINL 1F4YL 1AQMA 1N0LA 3PDOA 3QCUH 5C1MB 1HQRA 1EERB 1A3ZA 3ULVC 1J8HE 1YRKA 2HT4C 3O9WD 1GJUA 2P46B 1SOQA 5E56A 3T0VA 1CC3A 1MHPL 5HHQA 1S5HA 4Q11A 4K15A 1J1OH 5IVXB 2OQJA 2WOBA 2QGCA 3KWXA 3LS5L 1TPXB 4OD3L 4QYOA 1GAFL 4OUUB 4AQ1B 3OPZL 5FYJH 5HP5A 4PJHE 4RZCA 4A04A 2ADJA 4K3GA 4MDJA 2NOBA 2Y36L 1Z5LA 1YA5A 5EORL 1BF8A 1N8ZB 1IAOA 3MGTA 5TK4A 5KVFL 5AW2B 3VFOB 1NFKA 1Y1DA 2ZQKA 5CSZA 3UYRL 3S35L 3VDBA 1H5BA 2C9SA 1AD9A 4HP5A 4MZ2A 1SLXA 1P6AB 1F45A 5E1IA 1KLGA 2GITB 2X4SA 1S78D 2XWXA 1YEFL 3NJHA 2FGWL 3L5WB 2B5IC 2L7UA 2ESVA 3NCFB 4G5AA 2QKIB 3QRLA 3LQZA 1E4WL 3I3WA 3TVMC 4JKNA 1FGVL 4N3UA 3BKYH 5GSRA 5GRXG 2ZXGA 3IMRA 3QSKB 2BSRB 2EILB 3BVVA 4KHTH 1HU0A 2CLZB 2IH1B 4MB4A 3REVA 3S4SG 1MWAA 1S7XA 3VXSA 1P6WA 3X12B 4A7UA 2GJ6D 5ISZE 5HHMD 2BX5A 4KZCA 4Y1SA 3VRJA 4C54A 1NAKL 3HC2A 1RJLA 4BSVB 3OAZH 3UJIL 1IM9A 1LQSR 4UOZA 1M6OB 2CJTA 3ESPA 5DD5H 3K71B 4PCTA 2X4QB 3M1BB 4QTHB 2W81C 4U33A 3HG5A 1A9EB 2X4RA 3AQDA 4PJ5E 3IVKB 3P4NA 1UFGA 3QJQB 3CZFB 4UDUA 3PWPA 2ZXBA 4HDIA 2ADYA 1T5KA 5SWSA 3SKNA 3KJ4C 3ZOAA 4J3OG 4WKZA 2XY2A 1BLNB 2F0CA 2R4SL 2XBZA 5TQ0H 2CGYA 4MMYA 5HJ3A 4AOFA 2FLMA 4TOYH 2VSKB 5T1LA 3C8KB 4XVSH 2VZ3A 4H1LB 4LOEA 4A2LA 4GW1B 4ZPVA 5C09D 3M8OH 4PM1A 4HKXA 4OLWL 2HSIA 3VH8G 3RBSA 4J12A 4ZOEA 1KJ2B 4PWGA 1QLFA 2MWCA 4MNQD 5B1JC 2XHNA 2VMDA 1E2ZA 3K2MC 4PVLA 2CGRH 2WBXA 3LZLA 4HKJB 3GLAA 4JRXD 4C47A 4H26B 3ULUD 4S0TD 3MV7D 1BVNP 3IJHA 4RBPK 5DJXA 3T6WA 1PSKL 2WBJC 5HHVH 5KBMA 3ZDXF 1T22A 2UYLA 3FH8A 4X5QA 3HI5L 5FB8A 1FHNA 2IOMA 1GA2A 4BJLA 2C26A 4Z7AA 2F53A 1F4HA 4P46C 5K59E 3WN5B 4NWTL 2O61B 4NQDB 2FWOB 3E9TA 4PY8J 3RWCB 3ZHNA 3RY4A 5E9AA 4LRIC 3MLYL 4HOZA 4IRSC 4NM4L 4OCYL 5K9OB 2H26A 3BUYA 2VDQL 4M5ZL 2I9TB 1IAIH 2JLLA 3L3JB 3FB5B 3MJ8B 4EI5A 5F1OB 4XVJH 2WNWA 3HB3B 4BQBA 4C57C 3GIZH 4GB9A 3U30C 4XMPL 2A9DA 4FYRA 4TNFA 3KLDA 4UT7L 3GRWH 1IU1A 2K4WA 2EDKA 2BIMA 3DRQA 3MLRL 3MJ7B 3NIFF 1ZVSB 3P73A 5F96L 2QDWA 4QRFA 5FUCC 2Y1AA 4AL8H 1U0QA 1XCXA 2FO4A 3BPLB 4JFYA 4QKXB 5C3LD 5F8RC 3S3JA 2DJMA 2AXGB 3HBPA 1KXQA 4RMTA 5IOKA 3CVHB 4LIQE 3DROB 4GKZA 4Y8AA 3CBKB 2EYRB 2J12B 2XZQL 1XB8A 4O5LH 3JUZA 5E2JA 2BHYA 5KSAA 4XN2A 4UU9B 5E03A 3HRZB 3WE6A 3RBGA 4OGYL 1M4KA 4OJCA 2D7OA 2D0AA 1IBHA 1UZ8B 5IMOA 3SDXB 4JFDD 4FXTA 4HSQA 3TN0D 2IDCA 2WVVB 4DOHE 1HH9A 4FFTA 4PB0L 2ZG2A 4NP4L 4Y5VC 3D33A 2CJSA 3FB8B 4OCNC 1MCBA 5AL0A 5CSGA 3QPQC 2W0FA 5IW6A 4NYLA 2D7MA 1Q0EA 3WYRA 4EN2A 2FEEL 1ONQB 5AALA 2BW4A 2COVD 3DETC 5EU6E 4JFPA 1FNEA 3TZVC 3GKZA 3CHSA 4AEIH 4KHXL 2OXGB 5IUCA 3U4BH 1Z66A 3D9AL 2GW5A 3BO8A 2Z9TA 3LH2L 5KTEH 1TFHA 3IJYA 5DQ9B 2CRYA 5D2NB 5B4MC 1XSOA 2AQQA 1RPQA 2YAPA 5MEND 3WFZA 5C92A 5E8OA 2VQTA 3GK8L 4JRWA 2C5DC 4UNIA 4EI0A 5LUMA 4XAWH 2CCVA 3S34L 1FZMA 2B3RA 1LMIA 1XCTA 4NUMA 1NL0H 4OLVL 3ESNA 4YN3A 1NIBA 1DQML 3LHPL 1SXSA 3W9DB 4RA0C 4PJDE 3OKMB 1XTLA 3SDCD 5J6GA 4RISH 3CZEA 5IEKB 2PF6A 1CFQA 1U2CA 1AP2A 5EC2B 3BFWA 1XXDC 2NLJB 2QQQA 2CE6A 2ZXWB 3TBTB 3TH2T 3QDJB 1UGNA 3F7YA 4Y7OC 2MKWA 5I0VA 4HAFA 1DLHB 1NC2A 2FX8H 1Y07A 5D55A 3CTTA 4XMTA 1H6UA 5C07A 1NOFA 1UQSA 1BAFL 1VDGA 4PW3A 1ZAGA 5CEZD 4P5TC 2PO6C 4CN1A 4XVOA 1ADQA 4PP1C 3O6FC 4LCWB 2QSTA 4YHNA 2HFEB 1WZAA 1I9IH 1MWAH 5HHME 2G5BA 1UOWA 2OMWB 1UCTA 4K3DL 3ZKMC 4ZUVB 3MREA 2CCWA 5GS0C 2ZSVA 5G4NA 1ZLSL 5AAWC 5DT1H 1TSHA 5TF0A 3P2TA 1LO3H 3IJ9A 5I71C 3Q0HA 5CMAA 3EJQA 3QWOB 4WFGE 5AOIA 5CD3A 1GL4B 3IFNL 5KL0A 3CFCH 3O8XB 1FP5A 3BWSA 4MVBD 4XPFH 2FKFA 4NM8H 3L13A 3PWLA 3QIUB 2A6JB 2F19H 5I5JA 5C6WH 2DQHL 2AK1H 5F9JB 4AH2B 2ADIA 1CQKA 5D7IF 4J3OF 4GSDH 1V54B 2R1YB 3PHQA 4JG1H 5B39B 2YZ1A 4L48A 4HBQA 4J2XA 5TFSL 1CLOL 1FORL 4N90D 2IFGA 3N2JA 2OSXA 3OAUL 4KRPD 4MXQD 4QHKI 2B8OT 4XCYA 4QIRA 2CXKA 1ED3B 2P28B 3MGAA 3QQ4A 1DL7L 3SDDA 3P4OA 3VW3H 2I5WA 2FEJA 5C09E 4MCYA 3QIWC 1B2WL 1BQKA 2FJHA 2P52A 3KCPA 5J56B 2CLVA 3L45A 3CPLA 4Q9RH 4G7VL 4MNQE 4KKNA 4F27A 3TGXA 5IFJB 3FFOA 2MPVA 1NGPL 4JRXE 3U0WL 4GJTB 3DDGA 3ULUE 3HZMB 2ICWJ 4L2YA 2ICCA 3V9CA 2NNAB 3NSJA 3MR9B 3SZKC 3GB7A 1FNSH 4GBXC 4BV1A 1FZJB 2AC0A 4MMXB 3FYIB 3HUJB 3KJ6L 5AZ2H 1N2RA 1F00I 3ZKSD 2ED8A 5SWZB 5GJTH 1KBKA 4PGDA 1X5ZA 5DZNA 2YMOA 3UZEC 3NAAH 2BRRL 4HIIA 4KFZC 2P8LA 1XSKA 3SJVD 2Q5BA 5CSBA 1VTLE 3N91A 4PJ9B 3MLWH 4EE2A 2VRAA 4W4OC 3WI9A 4ZMWA 1I85A 4U3CA 3VGGA 4NCC1 2HZMA 3GMPB 5JPNA 1JF5A 3F01A 4PRPA 1FFOB 2ROXA 1CK0L 3MA7B 1CXHA 3I85A 1JNLL 1LE9B 2GB2A 4I1PA 5BRZD 4NKIH 1NCCH 1NUFA 3DJTA 4KROD 1A5FH 1QSEA 2ZUQC 1P0SE 4QT5B 4XOEA 2HFGH 2C9UA 2MRYA 5J13B 1E6JL 4K8RH 2XVBA 4AYFA 4Q58C 1SYVA 1HWWA 4RIRB 1NDGB 3OKNA 1HINH 3IETA 5BW7A 1MQ8A 4KU1A 2VZ1A 3KWVA 3BP4B 4JFHD 4JFDE 1MCKA 4P4RA 4WEBL 1ORQB 1GS6X 2V5RA 1MH5A 2OSWA 1NCBL 1NC4D 1U2HA 2BSSA 1BYOA 3GMQB 4R84A 2MTPA 1CDCA 1UOVA 2I9LB 1XF5B 4PS4L 4QRRB 3ISWA 4RSVA 5EO0A 5J11B 2OLDA 1NFDA 4G5ZL 3ROLB 1SUJA 2BP8A 2FJSA 4QLRA 2ZICA 4KUCD 2NZ9C 4A7TA 3MRNB 4RODB 5BUGA 5I1HH 1FO0L 1RVFL 1FDLL 4WCYL 3IGLA 2XQYK 3IS0X 1OSPH 4MJ5A 1KBGL 4E9YA 3BDYL 2FATL 5CU9A 3DUSB 4BA8A 1IVLA 1YY9D 2D03H 2HKAA 4NSKA 2DJ4A 3ZK0A 3L17A 2HLEB 2QDVA 4JK0D 5JOFB 1ASQA 4M7JH 5MENE 4HZAA 5J57B 4TQIA 5FK9A 3UDWC 5CWSA 5IMLB 3O3EA 1IAIM 5ALCL 3G5XB 4WI8A 5GGSY 1N0LB 2DQCL 3PDOB 3B5TA 1HQRB 1D5IH 3OVUB 5B3JF 2ZYIA 3ZDZB 3FRPA 1L6ZA 5IK3A 5HHQB 1Q0XH 2Y7NA 1S5HB 4J23A 2N01B 3IDYB 4CKVX 5PCYA 3MBXL 1BOGA 1GGBH 1VFUA 4GAYA 4HUUA 4QYOB 4JGNA 3L3KA 1OLZA 1P53A 4HKBB 4RZCB 1SLUA 2V5TA 2QQKL 3HI6L 3QZBA 4MDJB 4Z7WE 1KYOK 1Z5LB 1A7PL 3MGTB 4QXUH 5IY5B 4HJ0C 1G9NH 5CSZB 4TSBH 5T8IA 1NMCC 1H5BB 3QIBC 5KW9H 3UTTA 2CSPA 4YIQA 1AD9B 1JTOA 5CEZE 4FCAA 1NPJA 3MKGA 1KLGB 2X4SB 1TG8A 3JBG7 2OTWA 3KR3L 1P4IL 4J1UA 1ADQH 3LRHA 2ESVB 2CHZA 5TE7H 2UZPA 1V27A 4JFXA 2VR7A 1BVNT 2Y2YA 3MCLH 5E95B 2HTKD 3LQZB 3LNDA 2DEWX 2GJRA 4FKEA 4TPRL 2WYHA 5GSRB 3BX7C 5B7MA 4Y89A 4N2HA 1DVFD 2F8XC 4EI6A 3FF8A 3ARBD 2Q20A 3GSUA 2CK2A 2P5EA 1WAAE 2A4CA 4LO9A 5BS0A 2VKWA 3REVB 4APQA 1MWAB 5JUEH 1QW8A 1S7XB 2VDOH 3GT6A 4Z7UE 3VXSB 2EUZA 1N59A 5F9WC 2XTJC 2ZF8A 3BH9A 3VRJB 1EAQA 3LQAH 2GEQA 5DVKA 3GXTA 3RIFK 1BF5A 4KV5F 1IM9B 2G9HA 1Q4NX 1NTDA 4LVNB 1FH5L 3REWA 1CVSC 2AJVL 2AF2A 3OHMB 3BVNA 2BHZA 5EF0A 4L5FH 4N90E 4NT6A 2MCG1 2GC4C 3RTLA 3SGKA 2X1OA 2E7LC 3SE3C 2X4RB 1AQHA 3FNKA 4J4PA 4LEBA 3IN0A 4WNSA 4UDUB 3X3GL 3PWPB 4HDIB 4OCWL 4TNGA 2Y8LA 1L9PA 5SWSB 2RH0A 3SKNB 1JVOA 3QCTL 1HZKA 4R5VA 2H6PA 4WKZB 1R3IL 3IAPA 3O0RL 5L2JA 4MMYB 3DSFL 5HJ3B 5KYWA 1I1AA 2ERJB 1JNHB 5IG7A 1TVDA 3PCYA 5T1LB 4M9OA 1PX3A 1LEGA 3S97C 1PZAA 4ZPVB 3PRZA 1EGJA 4EDWH 2C3WA 4WWKD 4HKXB 3LB6C 1DFBH 1QLFB 4B5ZA 5TDNA 1BG1A 3SO3C 3TO4D 1Z9MA 1MIEL 5CP3A 1I3GL 3ZYZA 3IJHB 3HE6D 5DJXB 3SJVE 1Z5HA 3O6MH 2EH8L 5EIQA 2IBZX 4RLDA 1T22B 2UYLB 3QRFM 4G1MA 5GISH 3MNDA 3R7QA 3DO7A 3HMWL 5FB8B 3BAJA 5C0CD 4PG2A 2F53B 1TXKA 1IBZA 2VR6A 3CHXA 2JSFA 3O4LA 3Q43A 3WD5L 5BRZE 3B2MA 4J7RA 4BIKA 1KIRA 2H26B 2G2PA 3BUYB 4EI5B 5D1XE 3VN5A 3CDYA 4HJ1A 1M71A 2N4IA 1M53A 4A7GA 1FCGA 3OF6D 5F1NA 3ZZSA 1COBA 1RMFH 2VW7A 3C12A 5LNDA 3DRQB 3P73B 3SOBH 4DUVA 5A16B 3VXMD 5L9DH 4JFHE 3HFFA 1TQTA 2FO4B 3QDGA 3TO2A 1YYML 2BOCA 3T04D 1YQVH 5BZXA 1R3JB 5HPMA 4N5EC 3LQMA 3NP3A 1CE6A 1ZA3A 5IQ7L 3E0GA 5D2LF 4GKZB 3ARPA 3F6JA 5JDJA 2VITA 3K6IA 4G70B 1JZ4A 5KSAB 1WBXA 4GRWF 4HFWA 4IBTA 1B88A 1SF3A 4X7CC 5GZNA 3W0WA 2NT1A 3FFCA 1M7XA 4W6WB 1OM3L 3VNZA 2WZ5A 2M8XA 3UBXI 5IMOB 1VEMA 4EOWL 1FSKB 3LS4H 5EU5A 4EVNA 1U4FA 4MMZA 5JHLL 5LXGL 3T0AA 1HH9B 3OZLA 4Z76A 1BBJA 3NVQA 3KYNA 1XH3A 3TYFA 3L2NA 4L1SA 1DBBL 2J5LB 5E8DH 3QZPA 5IW6B 4NYLB 4AQ8A 2DZEA 3FO0L 1LO4L 4JQIL 1I1CA 2IDUA 5GRJH 1NWOA 2AXWA 4NQSA 2BSCA 3L9YA 4GXUN 3DX8B 4K71C 1FNEB 5HVHC 3OM3B 2A7BA 1PZ5A 5HDQL 3TDHA 4O2FA 1RSFA 4M00A 4ALAH 3KAAA 3BO8B 1DSWA 2OMNA 3ALWA 3MCKB 4J3TA 1X4YA 1E8XA 5F3FA 5IBLC 3H0TA 2DF3A 4FQ1H 2NTFB 5IQLA 3WO4C 5GPRA 3H2QA 3WKNA 2HX9A 4PSRA 5E8OB 1I8KA 5D72H 1HYRC 1HXKA 4OF5A 2VDRL 4XZUB 3I9GL 3GMOA 1HHJA 1K5NA 1PX4A 1IUZA 1FZMB 4LRNH 1XCTB 4NN6B 1EVTC 4FNSA 2OI9C 2VDKL 5ECGA 5E9DA 4EMZA 1ZS2A 2XI9A 5DEJA 3WFCL 5BNXD 2BWDA 2EC9T 1A4KA 1CL7H 1YAZA 4NFCA 1A4BA 1E5ZA 4LHUG 3D51A 4Y4FA 4BFOA 4DVBA 3VFRA 1OK0A 4OCSH 5JHDA 1CFQB 1RKRA 1AP2B 5CJXA 1F4AA 1GVIA 4Z6AT 4PJFA 1FNHA 4M8QA 5HI4D 1YYCA 3KPPA 1UJ3C 1AKPA 1RU9L 2VLMD 5E6ID 3NH7H 3T1WA 3CZUB 5JPMC 3CFUA 3VQMA 4BM7A 3KPRA 2NDGA 4L3EA 1AQKH 1BLIA 1SJXA 1NH6A 3PWVA 1UQSB 5E5LA 1UM5H 3DTXA 1OAYL 5KYYA 2FBOJ 2JKTM 5ESQA 5CINH 4V11A 4KO6A 4YE4L 2G5BB 1KB5A 4HOWA 1HXYA 2DWTA 5FFOA 3MREB 3SE9L 3EBIA 2Z8VC 2MQ0A 2ZSVB 1X9LA 3OKLA 3TOPA 1TQCC 5JR1H 4NUQA 1VOKA 3JWDL 4BFKA 1PD1A 1ZA6A 2E6PA 2NY2C 1HHHA 3FHQA 4BH8A 5JXEA 4OZIE 2PLTA 4FMKA 4Q7DA 1MXGA 5CMAB 2VDOB 5CD3B 5KVDH 4I3SL 4N0UE 5FOBA 5CD5C 4C7PA 1X6LA 1ZWIA 2Q7AA 3KRMA 3L08A 3PWLB 1OCZB 2KZWA 2PPDA 2EKSA 4NB7A 1B2YA 3RX7A 1OHZA 4X6CF 1WFUA 2WP3O 1AI1L 2ADIB 4BFFA 1ID2A 4N6RA 4ZMAT 5CILH 1ET8A 3PHQB 4ZO6A 4I8DA 4ABQA 3PS6A 3PWJA 4XPTH