The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
64
|
sequence length |
274
|
structure length |
273
|
Chain Sequence |
MHHHHHHMTRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLYVPARSLPYNQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDTVTMQVTARSLEELPVDIILASV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Coatomer gamma subunit
|
publication title |
Gamma-COP appendage domain - structure and function
pubmed doi rcsb |
source organism |
Homo sapiens
|
molecule tags |
Protein transport
|
total genus |
64
|
structure length |
273
|
sequence length |
274
|
ec nomenclature | |
pdb deposition date | 2003-10-09 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08752 | COP-gamma_platf | Coatomer gamma subunit appendage platform subdomain |
A | PF16381 | Coatomer_g_Cpla | Coatomer subunit gamma-1 C-terminal appendage platform |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Coatomer, gamma subunit, appendage domain | ||
Alpha Beta | 2-Layer Sandwich | TATA-Binding Protein | TATA-Binding Protein |