2Z8UA

Methanococcus jannaschii tbp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
169
Chain Sequence
PEIKIVNVVVSTKIGDNIDLEEVAMILENAEGLVCRLSVPKVALLIFRSGKVNCTGAKSKEEAEIAIKKIIKELKDAGIDVIENPEIKIQNMVATADLGIEPNLDDIALMVEGTEYEPEQFPGLVYRLDDPKVVVLIFGSGKVVITGLKSEEDAKRALKKILDTIKEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TATA-box-binding protein
publication title Crystal structure of Methanococcus jannaschii TATA box-binding protein.
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 39
structure length 169
sequence length 176
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2z8uA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2z8uA02
1QNBA 1KY6A 1E42A 3OCIA 1QN3A 1VTLE 1QN8A 2D0BA 3OC3C 1MP9A 1QN9A 1QN7A 1KY7A 1QTPA 5IYBP 3HS9A 1QN4A 2Z8UA 1VTOA 1CDWA 2G30A 1TGHA 5IYCP 1YTFA 3ASMA 1NVPA 1W80A 1JFIC 1PZDA 1TBAB 2VJ0A 4WZSD 3H1ZA 1D3UA 1QN6A 4PY5A 4RODB 2D0CA 1QNCA 1QNAA 5IYDP 1YTBA 1KYFA 1KYDA 2MJ7A 3HS8A 1AISA 1NH2A 1QTSA 1QNEA 1VOLB 1TBPA 1R4XA 3EIKA 1B9KA 4ROCB 1C9BB 1QN5A 2D0AA 2IV9A 1NGMA 1VOKA 1KYUA 1PCZA 1RM1A 4B0AA 4ROEB 3VN5A 2IV8A
chains in the Genus database with same CATH superfamily
1KO9A 4BJUA 1QN7A 1KFQA 1QN9A 3F0ZA 1V5SA 3KRMA 5IYBP 1QN4A 3OSMA 4EJYA 2HL8A 2G30A 3D4VA 5IYCP 2FGTA 3ASMA 1W80A 1LWVA 2FUVA 3N89A 1PVSA 2YH5A 2LAEA 5KL0A 1P5DX 1JFIC 3SNSA 2EHBD 2NOIA 3H1ZA 3OSEA 4QG5A 1D3UA 1J3MA 2NOBA 2NLVA 3ENOC 2H5AX 3RPJA 1JDYA 2JOIA 2FKFA 2HL9A 1N3AA 1NH2A 1N3CA 1M5Q1 3EIKA 3C04A 2IV9A 1VOKA 3DPTA 3CW7A 1HU0A 3VN5A 2HZSA 2O3OA 1QNBA 2OOXA 4MRQA 3TE5A 1QN3A 2D0BA 2Y8LA 3OC3C 1EBMA 4I8OA 3KTUA 1UL7A 3CWAA 2Z8UA 4EAJA 1CDWA 1YTFA 1UT4A 2QR1A 5BMNA 1K35A 2QRCA 2VJ0A 3ENCA 1K2YX 1YQMA 1FN7A 4PY5A 1C47A 2NOLA 1VKLA 3CWSA 3BKQX 3D7QA 3UW2A 2NOEA 3OGDA 1Q9UA 1QTSA 2JHJA 5JN5A 1C4GA 1R4XA 3OLPA 2I5WA 1PCJX 2HZMA 1QN5A 2D0AA 2YA3A 2QLVA 3IH7A 1KYUA 1RM1A 1YQLA 4EAGA 1DIZA 2DKAA 2NOHA 4Q11A 3F10A 2V92A 4D7QA 2ZFDB 1E42A 2F7LA 3OCIA 2HKPA 5F9CA 3OH6A 1VTLE 1QN8A 1WQAA 1MP9A 1QTPA 4D7RA 1YQRA 4EAIA 1T6AA 3PMGA 3TDHA 2DKCA 4HJHA 5JMVD 1VTOA 1M3QA 2H4LX 3CVTA 2MZ8A 4TPSA 2NVMA 1PCMX 1EUVA 1PZDA 2NWVA 1TBAB 3PDKA 1LWYA 2Y8QA 1LWWA 1WJWA 4WX8A 2PWWA 3CVSA 3CWUA 4EJZA 1KYFA 2QRDA 1KYDA 3NA5A 2MJ7A 1VOLB 1LXTA 2DKDA 1TBPA 4ROCB 1P5GX 2FKMX 1YQKA 2QREA 5HSHA 1TUOA 4EAKA 4B0AA 2IV8A 2OOYA 3RSMA 4CFFA 3OH9A 1KY6A 2V8QA 2V9JA 5AN4A 5BMPA 3ULXA 2NOFA 3OSTA 2JHNA 1XSZA 1KY7A 4DULA 1UT7A 3HS9A 2XHIA 3EAYA 2R5XA 3DPUA 1TGHA 1NVPA 4IL8A 3I0XA 1KFIA 1N39A 3T4NA 4WXAA 4C7PA 4WZSD 1QN6A 4RODB 2D0CA 2JPIA 1QNAA 1QNCA 5IYDP 3I0WA 2Z0FA 1YTBA 3I3WA 5EPCA 3HS8A 1MPGA 1AISA 1QNEA 4EALA 1C9BB 1B9KA 1NGMA 3CWTA 1PCZA 2NOZA 4ROEB 1M3HA
chains in the Genus database with same CATH topology
1KO9A 1QN7A 1QN9A 3F0ZA 5IYBP 3KRMA 1QN4A 3OSMA 4EJYA 2G30A 5IYCP 2FGTA 3ASMA 1W80A 1LWVA 3N89A 2YH5A 2LAEA 1JFIC 3SNSA 2NOIA 3H1ZA 1D3UA 2NOBA 3RPJA 2JOIA 1N3AA 1NH2A 1N3CA 3EIKA 2IV9A 1VOKA 3DPTA 1HU0A 3VN5A 2HZSA 2O3OA 1QNBA 1QN3A 2D0BA 3OC3C 1EBMA 4I8OA 3KTUA 2Z8UA 1CDWA 1YTFA 1UT4A 2VJ0A 1FN7A 4PY5A 1YQMA 2NOLA 2NOEA 1QTSA 2I5WA 1R4XA 2HZMA 1QN5A 2D0AA 3IH7A 1KYUA 1RM1A 1YQLA 2NOHA 4Q11A 3F10A 1E42A 3OCIA 1VTLE 1QN8A 1MP9A 1QTPA 1YQRA 1VTOA 1M3QA 2MZ8A 4TPSA 1PZDA 1TBAB 1LWYA 1LWWA 4EJZA 1KYFA 1KYDA 2MJ7A 1VOLB 1TBPA 4ROCB 1YQKA 4B0AA 2IV8A 2NOFA 1KY6A 5AN4A 3ULXA 3OSTA 1KY7A 4DULA 1UT7A 3HS9A 2XHIA 3DPUA 1TGHA 1NVPA 3I0XA 1N39A 4WZSD 1QN6A 4RODB 2D0CA 1QNCA 1QNAA 5IYDP 3I0WA 1YTBA 3HS8A 1AISA 1QNEA 1C9BB 1B9KA 1NGMA 1PCZA 2NOZA 4ROEB 1M3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNB A;  1KY6 A;  1E42 A;  3OCI A;  1QN3 A;  1VTL E;  1QN8 A;  2D0B A;  3OC3 C;  1MP9 A;  1QN9 A;  1QN7 A;  1KY7 A;  1QTP A;  5IYB P;  3HS9 A;  1QN4 A;  2Z8U A;  1VTO A;  1CDW A;  2G30 A;  1TGH A;  5IYC P;  1YTF A;  3ASM A;  1NVP A;  1W80 A;  1JFI C;  1PZD A;  1TBA B;  2VJ0 A;  4WZS D;  3H1Z A;  1D3U A;  1QN6 A;  4PY5 A;  4ROD B;  2D0C A;  1QNC A;  1QNA A;  5IYD P;  1YTB A;  1KYF A;  1KYD A;  2MJ7 A;  3HS8 A;  1AIS A;  1NH2 A;  1QTS A;  1QNE A;  1VOL B;  1TBP A;  1R4X A;  3EIK A;  1B9K A;  4ROC B;  1C9B B;  1QN5 A;  2D0A A;  2IV9 A;  1NGM A;  1VOK A;  1KYU A;  1PCZ A;  1RM1 A;  4B0A A;  4ROE B;  3VN5 A;  2IV8 A; 
#chains in the Genus database with same CATH topology
 1KO9 A;  4BJU A;  1QN7 A;  1KFQ A;  1QN9 A;  3F0Z A;  1V5S A;  3KRM A;  5IYB P;  1QN4 A;  3OSM A;  4EJY A;  2HL8 A;  2G30 A;  3D4V A;  5IYC P;  2FGT A;  3ASM A;  1W80 A;  1LWV A;  2FUV A;  3N89 A;  1PVS A;  2YH5 A;  2LAE A;  5KL0 A;  1P5D X;  1JFI C;  3SNS A;  2EHB D;  2NOI A;  3H1Z A;  3OSE A;  4QG5 A;  1D3U A;  1J3M A;  2NOB A;  2NLV A;  3ENO C;  2H5A X;  3RPJ A;  1JDY A;  2JOI A;  2FKF A;  2HL9 A;  1N3A A;  1NH2 A;  1N3C A;  1M5Q 1;  3EIK A;  3C04 A;  2IV9 A;  1VOK A;  3DPT A;  3CW7 A;  1HU0 A;  3VN5 A;  2HZS A;  2O3O A;  1QNB A;  2OOX A;  4MRQ A;  3TE5 A;  1QN3 A;  2D0B A;  2Y8L A;  3OC3 C;  1EBM A;  4I8O A;  3KTU A;  1UL7 A;  3CWA A;  2Z8U A;  4EAJ A;  1CDW A;  1YTF A;  1UT4 A;  2QR1 A;  5BMN A;  1K35 A;  2QRC A;  2VJ0 A;  3ENC A;  1K2Y X;  1YQM A;  1FN7 A;  4PY5 A;  1C47 A;  2NOL A;  1VKL A;  3CWS A;  3BKQ X;  3D7Q A;  3UW2 A;  2NOE A;  3OGD A;  1Q9U A;  1QTS A;  2JHJ A;  5JN5 A;  1C4G A;  1R4X A;  3OLP A;  2I5W A;  1PCJ X;  2HZM A;  1QN5 A;  2D0A A;  2YA3 A;  2QLV A;  3IH7 A;  1KYU A;  1RM1 A;  1YQL A;  4EAG A;  1DIZ A;  2DKA A;  2NOH A;  4Q11 A;  3F10 A;  2V92 A;  4D7Q A;  2ZFD B;  1E42 A;  2F7L A;  3OCI A;  2HKP A;  5F9C A;  3OH6 A;  1VTL E;  1QN8 A;  1WQA A;  1MP9 A;  1QTP A;  4D7R A;  1YQR A;  4EAI A;  1T6A A;  3PMG A;  3TDH A;  2DKC A;  4HJH A;  5JMV D;  1VTO A;  1M3Q A;  2H4L X;  3CVT A;  2MZ8 A;  4TPS A;  2NVM A;  1PCM X;  1EUV A;  1PZD A;  2NWV A;  1TBA B;  3PDK A;  1LWY A;  2Y8Q A;  1LWW A;  1WJW A;  4WX8 A;  2PWW A;  3CVS A;  3CWU A;  4EJZ A;  1KYF A;  2QRD A;  1KYD A;  3NA5 A;  2MJ7 A;  1VOL B;  1LXT A;  2DKD A;  1TBP A;  4ROC B;  1P5G X;  2FKM X;  1YQK A;  2QRE A;  5HSH A;  1TUO A;  4EAK A;  4B0A A;  2IV8 A;  2OOY A;  3RSM A;  4CFF A;  3OH9 A;  1KY6 A;  2V8Q A;  2V9J A;  5AN4 A;  5BMP A;  3ULX A;  2NOF A;  3OST A;  2JHN A;  1XSZ A;  1KY7 A;  4DUL A;  1UT7 A;  3HS9 A;  2XHI A;  3EAY A;  2R5X A;  3DPU A;  1TGH A;  1NVP A;  4IL8 A;  3I0X A;  1KFI A;  1N39 A;  3T4N A;  4WXA A;  4C7P A;  4WZS D;  1QN6 A;  4ROD B;  2D0C A;  2JPI A;  1QNA A;  1QNC A;  5IYD P;  3I0W A;  2Z0F A;  1YTB A;  3I3W A;  5EPC A;  3HS8 A;  1MPG A;  1AIS A;  1QNE A;  4EAL A;  1C9B B;  1B9K A;  1NGM A;  3CWT A;  1PCZ A;  2NOZ A;  4ROE B;  1M3H A; 
#chains in the Genus database with same CATH homology
 1KO9 A;  1QN7 A;  1QN9 A;  3F0Z A;  5IYB P;  3KRM A;  1QN4 A;  3OSM A;  4EJY A;  2G30 A;  5IYC P;  2FGT A;  3ASM A;  1W80 A;  1LWV A;  3N89 A;  2YH5 A;  2LAE A;  1JFI C;  3SNS A;  2NOI A;  3H1Z A;  1D3U A;  2NOB A;  3RPJ A;  2JOI A;  1N3A A;  1NH2 A;  1N3C A;  3EIK A;  2IV9 A;  1VOK A;  3DPT A;  1HU0 A;  3VN5 A;  2HZS A;  2O3O A;  1QNB A;  1QN3 A;  2D0B A;  3OC3 C;  1EBM A;  4I8O A;  3KTU A;  2Z8U A;  1CDW A;  1YTF A;  1UT4 A;  2VJ0 A;  1FN7 A;  4PY5 A;  1YQM A;  2NOL A;  2NOE A;  1QTS A;  2I5W A;  1R4X A;  2HZM A;  1QN5 A;  2D0A A;  3IH7 A;  1KYU A;  1RM1 A;  1YQL A;  2NOH A;  4Q11 A;  3F10 A;  1E42 A;  3OCI A;  1VTL E;  1QN8 A;  1MP9 A;  1QTP A;  1YQR A;  1VTO A;  1M3Q A;  2MZ8 A;  4TPS A;  1PZD A;  1TBA B;  1LWY A;  1LWW A;  4EJZ A;  1KYF A;  1KYD A;  2MJ7 A;  1VOL B;  1TBP A;  4ROC B;  1YQK A;  4B0A A;  2IV8 A;  2NOF A;  1KY6 A;  5AN4 A;  3ULX A;  3OST A;  1KY7 A;  4DUL A;  1UT7 A;  3HS9 A;  2XHI A;  3DPU A;  1TGH A;  1NVP A;  3I0X A;  1N39 A;  4WZS D;  1QN6 A;  4ROD B;  2D0C A;  1QNC A;  1QNA A;  5IYD P;  3I0W A;  1YTB A;  3HS8 A;  1AIS A;  1QNE A;  1C9B B;  1B9K A;  1NGM A;  1PCZ A;  2NOZ A;  4ROE B;  1M3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...