2Z8UA

Methanococcus jannaschii tbp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
169
Chain Sequence
PEIKIVNVVVSTKIGDNIDLEEVAMILENAEGLVCRLSVPKVALLIFRSGKVNCTGAKSKEEAEIAIKKIIKELKDAGIDVIENPEIKIQNMVATADLGIEPNLDDIALMVEGTEYEPEQFPGLVYRLDDPKVVVLIFGSGKVVITGLKSEEDAKRALKKILDTIKEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TATA-box-binding protein
publication title Crystal structure of Methanococcus jannaschii TATA box-binding protein.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transcription
total genus 39
structure length 169
sequence length 176
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2z8uA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2z8uA02
4PY5A 1E42A 1KYDA 1NGMA 1YTFA 1MP9A 1TBPA 1W80A 2VJ0A 4B0AA 1VOLB 5IYCP 1YTBA 2IV8A 2D0AA 5IYDP 1QNAA 1QN9A 5IYBP 1QTSA 4WZSD 1QNCA 1NH2A 1QNBA 2D0CA 3HS9A 4ROCB 3ASMA 2IV9A 1PCZA 3H1ZA 1QN8A 1CDWA 2MJ7A 3OCIA 1R4XA 1QN3A 1VTOA 1PZDA 2Z8UA 1QN7A 4RODB 1RM1A 1JFIC 1KYUA 1B9KA 1KY6A 2D0BA 1QNEA 1KYFA 1KY7A 3HS8A 3VN5A 1D3UA 3EIKA 1NVPA 1TBAB 1QN6A 1AISA 3OC3C 1QN4A 1QN5A 1VTLE 1C9BB 2G30A 1VOKA 4ROEB 1QTPA 1TGHA
chains in the Genus database with same CATH superfamily
1E42A 2HKPA 1NGMA 1P5DX 4EALA 5F9CA 1VOLB 1LWWA 5IYDP 1QNAA 3CW7A 1QTSA 4WZSD 2FGTA 4IL8A 1NH2A 2QRDA 2D0CA 3UW2A 1HU0A 2IV9A 1LWVA 1WJWA 1EBMA 1R4XA 5KL0A 1QNEA 4EAJA 4RODB 3D4VA 1KO9A 1JFIC 1YTFA 2H5AX 4HJHA 2NOZA 1KYFA 3I0WA 3HS8A 4I8OA 1D3UA 3CWTA 3EIKA 5JMVD 2DKCA 2PWWA 3CVSA 1J3MA 2YA3A 1QN5A 1T6AA 3OSEA 5EPCA 3OH9A 2F7LA 3F0ZA 1QTPA 1UL7A 3F10A 3I0XA 1TGHA 2NOIA 1KYDA 2FKMX 1MP9A 2VJ0A 3N89A 4B0AA 4EAGA 2IV8A 1PCJX 1QN9A 1WQAA 3RPJA 2JOIA 2NVMA 3HS9A 1Q9UA 4MRQA 1XSZA 2Z0FA 2H4LX 3TDHA 1QN3A 2NOHA 1QN7A 1KYUA 1PCMX 3SNSA 2DKDA 2FKFA 2HL9A 3C04A 4C7PA 4Q11A 1LXTA 4EJYA 4D7RA 1QN6A 1EUVA 1QN4A 5JN5A 2G30A 1C4GA 3D7QA 5AN4A 2ZFDB 4ROEB 1KFIA 2R5XA 2LAEA 4WXAA 2Y8LA 1V5SA 2FUVA 2V92A 1W80A 1N3CA 1DIZA 1TUOA 2YH5A 5HSHA 5IYCP 1YTBA 3PDKA 3KRMA 1UT7A 3CWUA 3NA5A 1KFQA 2QLVA 3DPUA 5IYBP 3OGDA 2NOBA 2HZMA 2Y8QA 2JHJA 2NOEA 1QNBA 4WX8A 3RSMA 2JHNA 3T4NA 4ROCB 3H1ZA 3TE5A 2I5WA 2MJ7A 1M3QA 3IH7A 2HL8A 1YQKA 2NOFA 1PZDA 2Z8UA 4EAKA 1RM1A 2D0BA 3PMGA 1P5GX 1VKLA 1KY7A 1YQRA 1NVPA 2XHIA 1TBAB 1C47A 2EHBD 1JDYA 3OC3C 1K35A 4TPSA 3EAYA 1C9BB 3I3WA 2NWVA 2V9JA 3OSMA 1M3HA 3KTUA 2OOYA 2MZ8A 2QREA 4PY5A 1TBPA 2NLVA 4EAIA 3BKQX 2D0AA 4CFFA 2QRCA 3ULXA 4QG5A 4BJUA 3CVTA 1MPGA 1QNCA 2HZSA 3OH6A 2QR1A 3OLPA 2V8QA 3ASMA 5BMNA 1PCZA 4DULA 1QN8A 1LWYA 1CDWA 4EJZA 1N39A 3ENCA 3OCIA 2NOLA 3OSTA 1VTOA 1YQMA 1B9KA 1KY6A 4D7QA 1N3AA 2O3OA 3DPTA 1YQLA 3VN5A 2DKAA 1UT4A 1AISA 2OOXA 1M5Q1 3CWSA 1VTLE 1FN7A 1K2YX 1PVSA 3CWAA 5BMPA 1VOKA 3ENOC 2JPIA
chains in the Genus database with same CATH topology
1E42A 1NGMA 1VOLB 1LWWA 5IYDP 1QNAA 1QTSA 4WZSD 2FGTA 1NH2A 1HU0A 2D0CA 2IV9A 1LWVA 1EBMA 1R4XA 1QNEA 1YTFA 4RODB 1JFIC 1KO9A 2NOZA 1KYFA 3I0WA 3HS8A 4I8OA 1D3UA 3EIKA 1QN5A 3F0ZA 1QTPA 3I0XA 3F10A 1TGHA 2NOIA 1KYDA 1MP9A 2VJ0A 3N89A 4B0AA 2IV8A 1QN9A 3RPJA 2JOIA 3HS9A 1QN3A 1QN7A 1KYUA 3SNSA 4Q11A 4EJYA 1QN6A 1QN4A 2G30A 5AN4A 4ROEB 2LAEA 1N3CA 1W80A 2YH5A 5IYCP 1YTBA 2I5WA 3KRMA 1UT7A 2NOBA 2NOHA 3DPUA 5IYBP 2HZMA 2NOEA 1QNBA 4ROCB 3H1ZA 2MJ7A 1M3QA 3IH7A 1YQKA 2NOFA 1PZDA 2Z8UA 1RM1A 2D0BA 1KY7A 1YQRA 1NVPA 2XHIA 1TBAB 3OC3C 4TPSA 1C9BB 3OSMA 1M3HA 3KTUA 2MZ8A 4PY5A 1TBPA 2D0AA 3ULXA 1QNCA 2HZSA 3ASMA 1QN8A 1PCZA 4DULA 4EJZA 1LWYA 1CDWA 1N39A 3OCIA 2NOLA 3OSTA 1VTOA 1YQMA 1B9KA 1KY6A 1N3AA 2O3OA 3DPTA 1YQLA 3VN5A 1UT4A 1AISA 1VTLE 1FN7A 1VOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PY5 A;  1E42 A;  1KYD A;  1NGM A;  1YTF A;  1MP9 A;  1TBP A;  1W80 A;  2VJ0 A;  4B0A A;  1VOL B;  5IYC P;  1YTB A;  2IV8 A;  2D0A A;  5IYD P;  1QNA A;  1QN9 A;  5IYB P;  1QTS A;  4WZS D;  1QNC A;  1NH2 A;  1QNB A;  2D0C A;  3HS9 A;  4ROC B;  3ASM A;  2IV9 A;  1PCZ A;  3H1Z A;  1QN8 A;  1CDW A;  2MJ7 A;  3OCI A;  1R4X A;  1QN3 A;  1VTO A;  1PZD A;  2Z8U A;  1QN7 A;  4ROD B;  1RM1 A;  1JFI C;  1KYU A;  1B9K A;  1KY6 A;  2D0B A;  1QNE A;  1KYF A;  1KY7 A;  3HS8 A;  3VN5 A;  1D3U A;  3EIK A;  1NVP A;  1TBA B;  1QN6 A;  1AIS A;  3OC3 C;  1QN4 A;  1QN5 A;  1VTL E;  1C9B B;  2G30 A;  1VOK A;  4ROE B;  1QTP A;  1TGH A; 
#chains in the Genus database with same CATH topology
 1E42 A;  2HKP A;  1NGM A;  1P5D X;  4EAL A;  5F9C A;  1VOL B;  1LWW A;  5IYD P;  1QNA A;  3CW7 A;  1QTS A;  4WZS D;  2FGT A;  4IL8 A;  1NH2 A;  2QRD A;  2D0C A;  3UW2 A;  1HU0 A;  2IV9 A;  1LWV A;  1WJW A;  1EBM A;  1R4X A;  5KL0 A;  1QNE A;  4EAJ A;  4ROD B;  3D4V A;  1KO9 A;  1JFI C;  1YTF A;  2H5A X;  4HJH A;  2NOZ A;  1KYF A;  3I0W A;  3HS8 A;  4I8O A;  1D3U A;  3CWT A;  3EIK A;  5JMV D;  2DKC A;  2PWW A;  3CVS A;  1J3M A;  2YA3 A;  1QN5 A;  1T6A A;  3OSE A;  5EPC A;  3OH9 A;  2F7L A;  3F0Z A;  1QTP A;  1UL7 A;  3F10 A;  3I0X A;  1TGH A;  2NOI A;  1KYD A;  2FKM X;  1MP9 A;  2VJ0 A;  3N89 A;  4B0A A;  4EAG A;  2IV8 A;  1PCJ X;  1QN9 A;  1WQA A;  3RPJ A;  2JOI A;  2NVM A;  3HS9 A;  1Q9U A;  4MRQ A;  1XSZ A;  2Z0F A;  2H4L X;  3TDH A;  1QN3 A;  2NOH A;  1QN7 A;  1KYU A;  1PCM X;  3SNS A;  2DKD A;  2FKF A;  2HL9 A;  3C04 A;  4C7P A;  4Q11 A;  1LXT A;  4EJY A;  4D7R A;  1QN6 A;  1EUV A;  1QN4 A;  5JN5 A;  2G30 A;  1C4G A;  3D7Q A;  5AN4 A;  2ZFD B;  4ROE B;  1KFI A;  2R5X A;  2LAE A;  4WXA A;  2Y8L A;  1V5S A;  2FUV A;  2V92 A;  1W80 A;  1N3C A;  1DIZ A;  1TUO A;  2YH5 A;  5HSH A;  5IYC P;  1YTB A;  3PDK A;  3KRM A;  1UT7 A;  3CWU A;  3NA5 A;  1KFQ A;  2QLV A;  3DPU A;  5IYB P;  3OGD A;  2NOB A;  2HZM A;  2Y8Q A;  2JHJ A;  2NOE A;  1QNB A;  4WX8 A;  3RSM A;  2JHN A;  3T4N A;  4ROC B;  3H1Z A;  3TE5 A;  2I5W A;  2MJ7 A;  1M3Q A;  3IH7 A;  2HL8 A;  1YQK A;  2NOF A;  1PZD A;  2Z8U A;  4EAK A;  1RM1 A;  2D0B A;  3PMG A;  1P5G X;  1VKL A;  1KY7 A;  1YQR A;  1NVP A;  2XHI A;  1TBA B;  1C47 A;  2EHB D;  1JDY A;  3OC3 C;  1K35 A;  4TPS A;  3EAY A;  1C9B B;  3I3W A;  2NWV A;  2V9J A;  3OSM A;  1M3H A;  3KTU A;  2OOY A;  2MZ8 A;  2QRE A;  4PY5 A;  1TBP A;  2NLV A;  4EAI A;  3BKQ X;  2D0A A;  4CFF A;  2QRC A;  3ULX A;  4QG5 A;  4BJU A;  3CVT A;  1MPG A;  1QNC A;  2HZS A;  3OH6 A;  2QR1 A;  3OLP A;  2V8Q A;  3ASM A;  5BMN A;  1PCZ A;  4DUL A;  1QN8 A;  1LWY A;  1CDW A;  4EJZ A;  1N39 A;  3ENC A;  3OCI A;  2NOL A;  3OST A;  1VTO A;  1YQM A;  1B9K A;  1KY6 A;  4D7Q A;  1N3A A;  2O3O A;  3DPT A;  1YQL A;  3VN5 A;  2DKA A;  1UT4 A;  1AIS A;  2OOX A;  1M5Q 1;  3CWS A;  1VTL E;  1FN7 A;  1K2Y X;  1PVS A;  3CWA A;  5BMP A;  1VOK A;  3ENO C;  2JPI A; 
#chains in the Genus database with same CATH homology
 1E42 A;  1NGM A;  1VOL B;  1LWW A;  5IYD P;  1QNA A;  1QTS A;  4WZS D;  2FGT A;  1NH2 A;  1HU0 A;  2D0C A;  2IV9 A;  1LWV A;  1EBM A;  1R4X A;  1QNE A;  1YTF A;  4ROD B;  1JFI C;  1KO9 A;  2NOZ A;  1KYF A;  3I0W A;  3HS8 A;  4I8O A;  1D3U A;  3EIK A;  1QN5 A;  3F0Z A;  1QTP A;  3I0X A;  3F10 A;  1TGH A;  2NOI A;  1KYD A;  1MP9 A;  2VJ0 A;  3N89 A;  4B0A A;  2IV8 A;  1QN9 A;  3RPJ A;  2JOI A;  3HS9 A;  1QN3 A;  1QN7 A;  1KYU A;  3SNS A;  4Q11 A;  4EJY A;  1QN6 A;  1QN4 A;  2G30 A;  5AN4 A;  4ROE B;  2LAE A;  1N3C A;  1W80 A;  2YH5 A;  5IYC P;  1YTB A;  2I5W A;  3KRM A;  1UT7 A;  2NOB A;  2NOH A;  3DPU A;  5IYB P;  2HZM A;  2NOE A;  1QNB A;  4ROC B;  3H1Z A;  2MJ7 A;  1M3Q A;  3IH7 A;  1YQK A;  2NOF A;  1PZD A;  2Z8U A;  1RM1 A;  2D0B A;  1KY7 A;  1YQR A;  1NVP A;  2XHI A;  1TBA B;  3OC3 C;  4TPS A;  1C9B B;  3OSM A;  1M3H A;  3KTU A;  2MZ8 A;  4PY5 A;  1TBP A;  2D0A A;  3ULX A;  1QNC A;  2HZS A;  3ASM A;  1QN8 A;  1PCZ A;  4DUL A;  4EJZ A;  1LWY A;  1CDW A;  1N39 A;  3OCI A;  2NOL A;  3OST A;  1VTO A;  1YQM A;  1B9K A;  1KY6 A;  1N3A A;  2O3O A;  3DPT A;  1YQL A;  3VN5 A;  1UT4 A;  1AIS A;  1VTL E;  1FN7 A;  1VOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...