1TGHA

Tata binding protein (tbp)/dna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
180
structure length
180
Chain Sequence
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*GP*TP*AP*TP*AP*TP*AP*TP*AP*CP*G)-3')
publication title How proteins recognize the TATA box.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 46
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1996-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tghA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tghA02
1YTFA 1VOKA 3H1ZA 2IV9A 1QN8A 5IYDP 1PCZA 1KY7A 1NH2A 1D3UA 1R4XA 1NGMA 1KYUA 4RODB 1TBPA 1VOLB 1KY6A 1KYDA 3OCIA 1PZDA 1QN4A 1CDWA 2G30A 1C9BB 1W80A 1QTSA 1QNBA 1QNEA 1QNAA 5IYCP 4ROCB 1TGHA 1QTPA 3EIKA 3OC3C 4WZSD 1VTOA 3HS9A 4ROEB 1NVPA 1E42A 1QN3A 2D0CA 1B9KA 1MP9A 3HS8A 2D0AA 5IYBP 1QNCA 1QN6A 3ASMA 1QN9A 1VTLE 1KYFA 2VJ0A 2MJ7A 2IV8A 2Z8UA 1AISA 1RM1A 1QN7A 1YTBA 4PY5A 4B0AA 2D0BA 1JFIC 1QN5A 3VN5A 1TBAB
chains in the Genus database with same CATH superfamily
3H1ZA 2DKDA 2IV9A 1EBMA 1KO9A 2NOFA 1D3UA 4BJUA 1M3QA 3OSTA 2FGTA 2G30A 3RPJA 1CDWA 1C9BB 2OOXA 1QTSA 1QNEA 4EAJA 5AN4A 1DIZA 1VOLB 2HKPA 4ROCB 3PDKA 4D7RA 1YQKA 3HS9A 2HL9A 2D0CA 4HJHA 1QNCA 1LWYA 2F7LA 3D7QA 1MPGA 1LXTA 2HZMA 1VTLE 2MZ8A 3T4NA 2YA3A 2MJ7A 2IV8A 2Z8UA 2V92A 3ENCA 1N3AA 1QN7A 4PY5A 4B0AA 1N3CA 2D0BA 1XSZA 1UL7A 4EJYA 3UW2A 4TPSA 1C4GA 1YTFA 1VOKA 1YQRA 4WX8A 1PCZA 2DKAA 3TE5A 1NH2A 3OSMA 2V9JA 3OLPA 4MRQA 1KYUA 1WJWA 4RODB 2NWVA 2PWWA 1TUOA 1KYDA 2QR1A 3OCIA 3ULXA 3OH6A 1LWWA 1FN7A 1QN4A 2NOZA 1P5GX 1W80A 2H4LX 3EAYA 1QNAA 1C47A 3EIKA 1VKLA 1M3HA 3OC3C 4WZSD 2NOHA 2QRDA 3C04A 2DKCA 4C7PA 4ROEB 1B9KA 1KFQA 5IYBP 2XHIA 2HZSA 3I0XA 3TDHA 2NOBA 3ENOC 2QRCA 1UT7A 3OSEA 1JDYA 4QG5A 1RM1A 3KTUA 2EHBD 2H5AX 4D7QA 1TBAB 5BMPA 3N89A 2NOIA 5JMVD 3SNSA 1YQMA 3F0ZA 5IYDP 2QREA 3OGDA 1NGMA 2ZFDB 2NVMA 2FKMX 5BMNA 5HSHA 1M5Q1 2YH5A 3CVTA 2FUVA 2O3OA 4EAIA 4IL8A 1QTPA 2Y8QA 2Z0FA 3I0WA 1HU0A 2R5XA 3CWSA 1VTOA 3DPUA 3IH7A 1QN3A 4EAKA 4CFFA 1QN6A 3ASMA 4I8OA 1KYFA 2JHJA 4WXAA 1EUVA 1PCJX 4EJZA 2I5WA 1V5SA 2NOEA 2HL8A 3BKQX 5EPCA 1JFIC 1PCMX 1Q9UA 2FKFA 3VN5A 3F10A 5F9CA 3OH9A 1P5DX 4Q11A 1QN8A 2Y8LA 1T6AA 5JN5A 3NA5A 3CW7A 1KY7A 1PVSA 1R4XA 3KRMA 1TBPA 1WQAA 1KY6A 2JHNA 1PZDA 2QLVA 3D4VA 3CWUA 3CWTA 2OOYA 1QNBA 1J3MA 1YQLA 5IYCP 2JPIA 2V8QA 1N39A 1TGHA 5KL0A 1KFIA 1K35A 3PMGA 1LWVA 3RSMA 4EAGA 4EALA 1NVPA 1E42A 3I3WA 1MP9A 3HS8A 2D0AA 2NLVA 1QN9A 2VJ0A 3CWAA 2LAEA 1AISA 1K2YX 1YTBA 3DPTA 3CVSA 2NOLA 4DULA 1QN5A 1UT4A 2JOIA
chains in the Genus database with same CATH topology
3H1ZA 2IV9A 1EBMA 1KO9A 2NOFA 1D3UA 1M3QA 3OSTA 2FGTA 2G30A 3RPJA 1CDWA 1C9BB 1QTSA 1QNEA 5AN4A 4ROCB 1YQKA 3HS9A 2D0CA 1QNCA 1LWYA 2HZMA 1VTLE 2MZ8A 1N3AA 2MJ7A 2IV8A 2Z8UA 1QN7A 4PY5A 4B0AA 1N3CA 2D0BA 4EJYA 4TPSA 1YTFA 1VOKA 1YQRA 1PCZA 1NH2A 3OSMA 1KYUA 4RODB 1FN7A 1VOLB 1KYDA 3OCIA 3ULXA 1LWWA 1QN4A 2NOZA 1W80A 1QNAA 3EIKA 1M3HA 2NOHA 3OC3C 4WZSD 4ROEB 1B9KA 5IYBP 3I0XA 2XHIA 2HZSA 2NOBA 1UT7A 1RM1A 3KTUA 1TBAB 3N89A 2NOIA 3SNSA 1YQMA 3F0ZA 5IYDP 1NGMA 2YH5A 2O3OA 1QTPA 3I0WA 1HU0A 1VTOA 3DPUA 3IH7A 1QN3A 1QN6A 3ASMA 4I8OA 1KYFA 4EJZA 2I5WA 2NOEA 1JFIC 3VN5A 3F10A 4Q11A 1QN8A 1KY7A 1R4XA 3KRMA 1TBPA 1KY6A 1PZDA 1QNBA 1YQLA 5IYCP 1N39A 1TGHA 1LWVA 1NVPA 1E42A 1MP9A 3HS8A 2D0AA 1QN9A 2VJ0A 2LAEA 1AISA 1YTBA 3DPTA 2NOLA 4DULA 1QN5A 1UT4A 2JOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF A;  1VOK A;  3H1Z A;  2IV9 A;  1QN8 A;  5IYD P;  1PCZ A;  1KY7 A;  1NH2 A;  1D3U A;  1R4X A;  1NGM A;  1KYU A;  4ROD B;  1TBP A;  1VOL B;  1KY6 A;  1KYD A;  3OCI A;  1PZD A;  1QN4 A;  1CDW A;  2G30 A;  1C9B B;  1W80 A;  1QTS A;  1QNB A;  1QNE A;  1QNA A;  5IYC P;  4ROC B;  1TGH A;  1QTP A;  3EIK A;  3OC3 C;  4WZS D;  1VTO A;  3HS9 A;  4ROE B;  1NVP A;  1E42 A;  1QN3 A;  2D0C A;  1B9K A;  1MP9 A;  3HS8 A;  2D0A A;  5IYB P;  1QNC A;  1QN6 A;  3ASM A;  1QN9 A;  1VTL E;  1KYF A;  2VJ0 A;  2MJ7 A;  2IV8 A;  2Z8U A;  1AIS A;  1RM1 A;  1QN7 A;  1YTB A;  4PY5 A;  4B0A A;  2D0B A;  1JFI C;  1QN5 A;  3VN5 A;  1TBA B; 
#chains in the Genus database with same CATH topology
 3H1Z A;  2DKD A;  2IV9 A;  1EBM A;  1KO9 A;  2NOF A;  1D3U A;  4BJU A;  1M3Q A;  3OST A;  2FGT A;  2G30 A;  3RPJ A;  1CDW A;  1C9B B;  2OOX A;  1QTS A;  1QNE A;  4EAJ A;  5AN4 A;  1DIZ A;  1VOL B;  2HKP A;  4ROC B;  3PDK A;  4D7R A;  1YQK A;  3HS9 A;  2HL9 A;  2D0C A;  4HJH A;  1QNC A;  1LWY A;  2F7L A;  3D7Q A;  1MPG A;  1LXT A;  2HZM A;  1VTL E;  2MZ8 A;  3T4N A;  2YA3 A;  2MJ7 A;  2IV8 A;  2Z8U A;  2V92 A;  3ENC A;  1N3A A;  1QN7 A;  4PY5 A;  4B0A A;  1N3C A;  2D0B A;  1XSZ A;  1UL7 A;  4EJY A;  3UW2 A;  4TPS A;  1C4G A;  1YTF A;  1VOK A;  1YQR A;  4WX8 A;  1PCZ A;  2DKA A;  3TE5 A;  1NH2 A;  3OSM A;  2V9J A;  3OLP A;  4MRQ A;  1KYU A;  1WJW A;  4ROD B;  2NWV A;  2PWW A;  1TUO A;  1KYD A;  2QR1 A;  3OCI A;  3ULX A;  3OH6 A;  1LWW A;  1FN7 A;  1QN4 A;  2NOZ A;  1P5G X;  1W80 A;  2H4L X;  3EAY A;  1QNA A;  1C47 A;  3EIK A;  1VKL A;  1M3H A;  3OC3 C;  4WZS D;  2NOH A;  2QRD A;  3C04 A;  2DKC A;  4C7P A;  4ROE B;  1B9K A;  1KFQ A;  5IYB P;  2XHI A;  2HZS A;  3I0X A;  3TDH A;  2NOB A;  3ENO C;  2QRC A;  1UT7 A;  3OSE A;  1JDY A;  4QG5 A;  1RM1 A;  3KTU A;  2EHB D;  2H5A X;  4D7Q A;  1TBA B;  5BMP A;  3N89 A;  2NOI A;  5JMV D;  3SNS A;  1YQM A;  3F0Z A;  5IYD P;  2QRE A;  3OGD A;  1NGM A;  2ZFD B;  2NVM A;  2FKM X;  5BMN A;  5HSH A;  1M5Q 1;  2YH5 A;  3CVT A;  2FUV A;  2O3O A;  4EAI A;  4IL8 A;  1QTP A;  2Y8Q A;  2Z0F A;  3I0W A;  1HU0 A;  2R5X A;  3CWS A;  1VTO A;  3DPU A;  3IH7 A;  1QN3 A;  4EAK A;  4CFF A;  1QN6 A;  3ASM A;  4I8O A;  1KYF A;  2JHJ A;  4WXA A;  1EUV A;  1PCJ X;  4EJZ A;  2I5W A;  1V5S A;  2NOE A;  2HL8 A;  3BKQ X;  5EPC A;  1JFI C;  1PCM X;  1Q9U A;  2FKF A;  3VN5 A;  3F10 A;  5F9C A;  3OH9 A;  1P5D X;  4Q11 A;  1QN8 A;  2Y8L A;  1T6A A;  5JN5 A;  3NA5 A;  3CW7 A;  1KY7 A;  1PVS A;  1R4X A;  3KRM A;  1TBP A;  1WQA A;  1KY6 A;  2JHN A;  1PZD A;  2QLV A;  3D4V A;  3CWU A;  3CWT A;  2OOY A;  1QNB A;  1J3M A;  1YQL A;  5IYC P;  2JPI A;  2V8Q A;  1N39 A;  1TGH A;  5KL0 A;  1KFI A;  1K35 A;  3PMG A;  1LWV A;  3RSM A;  4EAG A;  4EAL A;  1NVP A;  1E42 A;  3I3W A;  1MP9 A;  3HS8 A;  2D0A A;  2NLV A;  1QN9 A;  2VJ0 A;  3CWA A;  2LAE A;  1AIS A;  1K2Y X;  1YTB A;  3DPT A;  3CVS A;  2NOL A;  4DUL A;  1QN5 A;  1UT4 A;  2JOI A; 
#chains in the Genus database with same CATH homology
 3H1Z A;  2IV9 A;  1EBM A;  1KO9 A;  2NOF A;  1D3U A;  1M3Q A;  3OST A;  2FGT A;  2G30 A;  3RPJ A;  1CDW A;  1C9B B;  1QTS A;  1QNE A;  5AN4 A;  4ROC B;  1YQK A;  3HS9 A;  2D0C A;  1QNC A;  1LWY A;  2HZM A;  1VTL E;  2MZ8 A;  1N3A A;  2MJ7 A;  2IV8 A;  2Z8U A;  1QN7 A;  4PY5 A;  4B0A A;  1N3C A;  2D0B A;  4EJY A;  4TPS A;  1YTF A;  1VOK A;  1YQR A;  1PCZ A;  1NH2 A;  3OSM A;  1KYU A;  4ROD B;  1FN7 A;  1VOL B;  1KYD A;  3OCI A;  3ULX A;  1LWW A;  1QN4 A;  2NOZ A;  1W80 A;  1QNA A;  3EIK A;  1M3H A;  2NOH A;  3OC3 C;  4WZS D;  4ROE B;  1B9K A;  5IYB P;  3I0X A;  2XHI A;  2HZS A;  2NOB A;  1UT7 A;  1RM1 A;  3KTU A;  1TBA B;  3N89 A;  2NOI A;  3SNS A;  1YQM A;  3F0Z A;  5IYD P;  1NGM A;  2YH5 A;  2O3O A;  1QTP A;  3I0W A;  1HU0 A;  1VTO A;  3DPU A;  3IH7 A;  1QN3 A;  1QN6 A;  3ASM A;  4I8O A;  1KYF A;  4EJZ A;  2I5W A;  2NOE A;  1JFI C;  3VN5 A;  3F10 A;  4Q11 A;  1QN8 A;  1KY7 A;  1R4X A;  3KRM A;  1TBP A;  1KY6 A;  1PZD A;  1QNB A;  1YQL A;  5IYC P;  1N39 A;  1TGH A;  1LWV A;  1NVP A;  1E42 A;  1MP9 A;  3HS8 A;  2D0A A;  1QN9 A;  2VJ0 A;  2LAE A;  1AIS A;  1YTB A;  3DPT A;  2NOL A;  4DUL A;  1QN5 A;  1UT4 A;  2JOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...