1TGHA

Tata binding protein (tbp)/dna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
180
structure length
180
Chain Sequence
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*CP*GP*TP*AP*TP*AP*TP*AP*TP*AP*CP*G)-3')
publication title How proteins recognize the TATA box.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1996-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tghA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tghA02
4B0AA 1QN3A 1YTBA 1JFIC 1VTOA 1VOKA 4ROCB 1QTPA 2G30A 1PCZA 3H1ZA 1QNBA 1QN7A 4RODB 3VN5A 1C9BB 1PZDA 3OC3C 1QN6A 2IV8A 1MP9A 1VOLB 3OCIA 3HS9A 1AISA 1QTSA 1E42A 2IV9A 1NGMA 2D0BA 1KY7A 2VJ0A 3EIKA 1TBPA 1TBAB 5IYBP 1VTLE 1RM1A 1CDWA 1KYDA 1D3UA 1QN5A 1QNCA 1QN4A 1B9KA 1QN8A 1NVPA 2D0CA 2D0AA 1W80A 2Z8UA 5IYCP 1QNEA 4PY5A 1TGHA 3ASMA 1QNAA 1NH2A 1KYUA 2MJ7A 1QN9A 5IYDP 4ROEB 4WZSD 1YTFA 1KY6A 1R4XA 1KYFA 3HS8A
chains in the Genus database with same CATH superfamily
1QN3A 1C47A 2HL8A 3N89A 1QN7A 1QNBA 2G30A 5HSHA 1M5Q1 3D4VA 2QREA 2OOYA 2H5AX 1QN6A 1PZDA 2QR1A 2IV8A 1PCMX 4C7PA 2NOBA 1TUOA 1PCJX 3CVSA 1UT4A 1E42A 1NGMA 4TPSA 1KY7A 1D3UA 1N3CA 3OSEA 2MZ8A 2NOIA 2DKDA 2PWWA 2NVMA 2D0AA 1P5DX 1W80A 3T4NA 5JN5A 3CWAA 1QNEA 4PY5A 2DKAA 3PMGA 5IYDP 3DPUA 3OSMA 3RPJA 3KRMA 1N39A 2NOLA 3EAYA 1MPGA 4EAKA 2NWVA 3OC3C 5KL0A 2JHNA 1LWVA 3HS9A 3TDHA 1N3AA 5BMPA 1VKLA 2IV9A 4I8OA 3CWUA 2DKCA 1TBPA 1QNCA 1KYDA 2O3OA 1P5GX 3C04A 1HU0A 2I5WA 1WQAA 2JOIA 2JHJA 3DPTA 3NA5A 1EBMA 2D0CA 2NOFA 3OH9A 1EUVA 3OSTA 2NOZA 5JMVD 3SNSA 1NH2A 2MJ7A 3UW2A 2HL9A 1J3MA 2V92A 4EJZA 4Q11A 1KFIA 3ENCA 4WZSD 4D7RA 1V5SA 3I0XA 1KYFA 1Q9UA 3HS8A 1VTLE 2H4LX 3PDKA 3KTUA 2YH5A 1LWWA 2NLVA 3ULXA 4ROCB 1VTOA 1PVSA 1PCZA 1LXTA 1YQLA 3I3WA 4MRQA 3VN5A 4DULA 1LWYA 1WJWA 3IH7A 1C9BB 1C4GA 1KO9A 2QLVA 4WX8A 1UT7A 2EHBD 1XSZA 2HZSA 3F0ZA 4EAIA 2NOEA 2NOHA 1QTSA 2HKPA 2FUVA 3CW7A 2Y8QA 2OOXA 1FN7A 2D0BA 2VJ0A 2FKFA 5IYBP 1CDWA 1QN5A 2HZMA 4EALA 2ZFDB 3OGDA 4EAGA 2Z0FA 1K35A 2R5XA 5AN4A 5IYCP 1YQMA 1TGHA 2QRDA 1KYUA 3RSMA 3OH6A 3ENOC 4BJUA 3F10A 4IL8A 4B0AA 1YQRA 2F7LA 4D7QA 2FKMX 3BKQX 1JFIC 4QG5A 3TE5A 3I0WA 1VOKA 1QTPA 3H1ZA 4EJYA 4RODB 1M3QA 5BMNA 1YQKA 1MP9A 1VOLB 3OCIA 1AISA 1K2YX 3CVTA 2JPIA 2QRCA 3CWTA 4WXAA 1M3HA 4EAJA 4CFFA 1DIZA 1RM1A 3OLPA 3EIKA 4HJHA 1TBAB 2XHIA 3D7QA 1QN4A 2V8QA 1JDYA 1B9KA 1T6AA 2LAEA 2Y8LA 1QN8A 5F9CA 1NVPA 2Z8UA 2FGTA 3ASMA 1QNAA 2YA3A 1QN9A 3CWSA 4ROEB 1YTFA 5EPCA 1KY6A 1UL7A 2V9JA 1R4XA 1YTBA 1KFQA
chains in the Genus database with same CATH topology
1QN3A 3N89A 1QN7A 1QNBA 2G30A 1QN6A 1PZDA 2IV8A 2NOBA 1UT4A 1E42A 1NGMA 4TPSA 1KY7A 1D3UA 1N3CA 2MZ8A 2NOIA 2D0AA 1W80A 1QNEA 4PY5A 5IYDP 3DPUA 3RPJA 3OSMA 3KRMA 1N39A 2NOLA 3OC3C 1LWVA 3HS9A 1N3AA 2IV9A 4I8OA 1TBPA 1QNCA 1KYDA 2O3OA 1HU0A 2I5WA 2JOIA 3DPTA 1EBMA 2D0CA 2NOFA 3OSTA 2NOZA 3SNSA 1NH2A 2MJ7A 4EJZA 4Q11A 4WZSD 3I0XA 1KYFA 1VTLE 3HS8A 3KTUA 2YH5A 1LWWA 1VTOA 3ULXA 4ROCB 1PCZA 1YQLA 3VN5A 4DULA 1LWYA 1C9BB 3IH7A 1KO9A 1UT7A 3F0ZA 2HZSA 2NOHA 2NOEA 1QTSA 1FN7A 2D0BA 2VJ0A 5IYBP 1CDWA 1QN5A 2HZMA 5AN4A 5IYCP 1YQMA 1TGHA 1KYUA 3F10A 4B0AA 1YQRA 1JFIC 3I0WA 1VOKA 1QTPA 3H1ZA 4EJYA 4RODB 1M3QA 1MP9A 1VOLB 3OCIA 1AISA 1M3HA 1RM1A 3EIKA 1TBAB 2XHIA 1QN4A 1B9KA 1QN8A 2LAEA 1NVPA 2Z8UA 2FGTA 3ASMA 1QNAA 1QN9A 4ROEB 1YTFA 1YQKA 1KY6A 1R4XA 1YTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B0A A;  1QN3 A;  1YTB A;  1JFI C;  1VTO A;  1VOK A;  4ROC B;  1QTP A;  2G30 A;  1PCZ A;  3H1Z A;  1QNB A;  1QN7 A;  4ROD B;  3VN5 A;  1C9B B;  1PZD A;  3OC3 C;  1QN6 A;  2IV8 A;  1MP9 A;  1VOL B;  3OCI A;  3HS9 A;  1AIS A;  1QTS A;  1E42 A;  2IV9 A;  1NGM A;  2D0B A;  1KY7 A;  2VJ0 A;  3EIK A;  1TBP A;  1TBA B;  5IYB P;  1VTL E;  1RM1 A;  1CDW A;  1KYD A;  1D3U A;  1QN5 A;  1QNC A;  1QN4 A;  1B9K A;  1QN8 A;  1NVP A;  2D0C A;  2D0A A;  1W80 A;  2Z8U A;  5IYC P;  1QNE A;  4PY5 A;  1TGH A;  3ASM A;  1QNA A;  1NH2 A;  1KYU A;  2MJ7 A;  1QN9 A;  5IYD P;  4ROE B;  4WZS D;  1YTF A;  1KY6 A;  1R4X A;  1KYF A;  3HS8 A; 
#chains in the Genus database with same CATH topology
 1QN3 A;  1C47 A;  2HL8 A;  3N89 A;  1QN7 A;  1QNB A;  2G30 A;  5HSH A;  1M5Q 1;  3D4V A;  2QRE A;  2OOY A;  2H5A X;  1QN6 A;  1PZD A;  2QR1 A;  2IV8 A;  1PCM X;  4C7P A;  2NOB A;  1TUO A;  1PCJ X;  3CVS A;  1UT4 A;  1E42 A;  1NGM A;  4TPS A;  1KY7 A;  1D3U A;  1N3C A;  3OSE A;  2MZ8 A;  2NOI A;  2DKD A;  2PWW A;  2NVM A;  2D0A A;  1P5D X;  1W80 A;  3T4N A;  5JN5 A;  3CWA A;  1QNE A;  4PY5 A;  2DKA A;  3PMG A;  5IYD P;  3DPU A;  3OSM A;  3RPJ A;  3KRM A;  1N39 A;  2NOL A;  3EAY A;  1MPG A;  4EAK A;  2NWV A;  3OC3 C;  5KL0 A;  2JHN A;  1LWV A;  3HS9 A;  3TDH A;  1N3A A;  5BMP A;  1VKL A;  2IV9 A;  4I8O A;  3CWU A;  2DKC A;  1TBP A;  1QNC A;  1KYD A;  2O3O A;  1P5G X;  3C04 A;  1HU0 A;  2I5W A;  1WQA A;  2JOI A;  2JHJ A;  3DPT A;  3NA5 A;  1EBM A;  2D0C A;  2NOF A;  3OH9 A;  1EUV A;  3OST A;  2NOZ A;  5JMV D;  3SNS A;  1NH2 A;  2MJ7 A;  3UW2 A;  2HL9 A;  1J3M A;  2V92 A;  4EJZ A;  4Q11 A;  1KFI A;  3ENC A;  4WZS D;  4D7R A;  1V5S A;  3I0X A;  1KYF A;  1Q9U A;  3HS8 A;  1VTL E;  2H4L X;  3PDK A;  3KTU A;  2YH5 A;  1LWW A;  2NLV A;  3ULX A;  4ROC B;  1VTO A;  1PVS A;  1PCZ A;  1LXT A;  1YQL A;  3I3W A;  4MRQ A;  3VN5 A;  4DUL A;  1LWY A;  1WJW A;  3IH7 A;  1C9B B;  1C4G A;  1KO9 A;  2QLV A;  4WX8 A;  1UT7 A;  2EHB D;  1XSZ A;  2HZS A;  3F0Z A;  4EAI A;  2NOE A;  2NOH A;  1QTS A;  2HKP A;  2FUV A;  3CW7 A;  2Y8Q A;  2OOX A;  1FN7 A;  2D0B A;  2VJ0 A;  2FKF A;  5IYB P;  1CDW A;  1QN5 A;  2HZM A;  4EAL A;  2ZFD B;  3OGD A;  4EAG A;  2Z0F A;  1K35 A;  2R5X A;  5AN4 A;  5IYC P;  1YQM A;  1TGH A;  2QRD A;  1KYU A;  3RSM A;  3OH6 A;  3ENO C;  4BJU A;  3F10 A;  4IL8 A;  4B0A A;  1YQR A;  2F7L A;  4D7Q A;  2FKM X;  3BKQ X;  1JFI C;  4QG5 A;  3TE5 A;  3I0W A;  1VOK A;  1QTP A;  3H1Z A;  4EJY A;  4ROD B;  1M3Q A;  5BMN A;  1YQK A;  1MP9 A;  1VOL B;  3OCI A;  1AIS A;  1K2Y X;  3CVT A;  2JPI A;  2QRC A;  3CWT A;  4WXA A;  1M3H A;  4EAJ A;  4CFF A;  1DIZ A;  1RM1 A;  3OLP A;  3EIK A;  4HJH A;  1TBA B;  2XHI A;  3D7Q A;  1QN4 A;  2V8Q A;  1JDY A;  1B9K A;  1T6A A;  2LAE A;  2Y8L A;  1QN8 A;  5F9C A;  1NVP A;  2Z8U A;  2FGT A;  3ASM A;  1QNA A;  2YA3 A;  1QN9 A;  3CWS A;  4ROE B;  1YTF A;  5EPC A;  1KY6 A;  1UL7 A;  2V9J A;  1R4X A;  1YTB A;  1KFQ A; 
#chains in the Genus database with same CATH homology
 1QN3 A;  3N89 A;  1QN7 A;  1QNB A;  2G30 A;  1QN6 A;  1PZD A;  2IV8 A;  2NOB A;  1UT4 A;  1E42 A;  1NGM A;  4TPS A;  1KY7 A;  1D3U A;  1N3C A;  2MZ8 A;  2NOI A;  2D0A A;  1W80 A;  1QNE A;  4PY5 A;  5IYD P;  3DPU A;  3RPJ A;  3OSM A;  3KRM A;  1N39 A;  2NOL A;  3OC3 C;  1LWV A;  3HS9 A;  1N3A A;  2IV9 A;  4I8O A;  1TBP A;  1QNC A;  1KYD A;  2O3O A;  1HU0 A;  2I5W A;  2JOI A;  3DPT A;  1EBM A;  2D0C A;  2NOF A;  3OST A;  2NOZ A;  3SNS A;  1NH2 A;  2MJ7 A;  4EJZ A;  4Q11 A;  4WZS D;  3I0X A;  1KYF A;  1VTL E;  3HS8 A;  3KTU A;  2YH5 A;  1LWW A;  1VTO A;  3ULX A;  4ROC B;  1PCZ A;  1YQL A;  3VN5 A;  4DUL A;  1LWY A;  1C9B B;  3IH7 A;  1KO9 A;  1UT7 A;  3F0Z A;  2HZS A;  2NOH A;  2NOE A;  1QTS A;  1FN7 A;  2D0B A;  2VJ0 A;  5IYB P;  1CDW A;  1QN5 A;  2HZM A;  5AN4 A;  5IYC P;  1YQM A;  1TGH A;  1KYU A;  3F10 A;  4B0A A;  1YQR A;  1JFI C;  3I0W A;  1VOK A;  1QTP A;  3H1Z A;  4EJY A;  4ROD B;  1M3Q A;  1MP9 A;  1VOL B;  3OCI A;  1AIS A;  1M3H A;  1RM1 A;  3EIK A;  1TBA B;  2XHI A;  1QN4 A;  1B9K A;  1QN8 A;  2LAE A;  1NVP A;  2Z8U A;  2FGT A;  3ASM A;  1QNA A;  1QN9 A;  4ROE B;  1YTF A;  1YQK A;  1KY6 A;  1R4X A;  1YTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...