5IYDP

Human core-pic in the initial transcribing state (no iis)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
TPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iydP01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iydP02
3VN5A 1QTPA 1R4XA 1NVPA 4PY5A 1YTFA 1QN3A 1QNAA 1PZDA 1QNBA 1AISA 2D0AA 3EIKA 4RODB 3H1ZA 1QNCA 1QTSA 2G30A 4B0AA 1QN6A 1QN9A 1YTBA 1MP9A 1QN4A 3ASMA 2D0CA 1D3UA 2MJ7A 1TBPA 1KYUA 1KY6A 2D0BA 5IYBP 1NH2A 3OCIA 1C9BB 1NGMA 1QN8A 5IYDP 1VOLB 1CDWA 1W80A 2VJ0A 1JFIC 1KYDA 1VTLE 4ROCB 2IV8A 1TBAB 5IYCP 1QN7A 1TGHA 3OC3C 1B9KA 1PCZA 1E42A 4ROEB 1KY7A 2Z8UA 1VOKA 3HS8A 1KYFA 2IV9A 4WZSD 1RM1A 1QN5A 1QNEA 3HS9A 1VTOA
chains in the Genus database with same CATH superfamily
3EAYA 1YQRA 1T6AA 1NVPA 4PY5A 3OGDA 2V9JA 1QNBA 2QR1A 1Q9UA 1KFQA 3H1ZA 4Q11A 3CWUA 4D7QA 1DIZA 4EAJA 1UL7A 1EUVA 3I0XA 2Y8LA 2H5AX 1C9BB 1J3MA 1KYUA 1KY6A 5IYBP 1QN8A 3OCIA 3OSTA 3CWSA 2NOIA 1JFIC 4QG5A 3TE5A 2YH5A 5BMNA 1TGHA 1PCZA 1E42A 4ROEB 2FKMX 1KY7A 2QLVA 1YQKA 1N39A 1P5DX 3HS8A 3RSMA 4EAKA 1UT4A 2JHNA 3C04A 3HS9A 3TDHA 3D4VA 5HSHA 2NOBA 2JPIA 3DPTA 5BMPA 1TUOA 3VN5A 3D7QA 1WQAA 3DPUA 4DULA 1R4XA 1C4GA 1YTFA 2PWWA 1K35A 3CW7A 5EPCA 1PZDA 1KFIA 3EIKA 4RODB 3KRMA 3CWTA 5AN4A 2OOXA 4B0AA 1YTBA 2XHIA 1N3AA 2QREA 1MP9A 3ASMA 2FUVA 3UW2A 3I0WA 4HJHA 1JDYA 3KTUA 1M5Q1 1NGMA 5IYDP 1VOLB 2F7LA 1CDWA 4IL8A 3ULXA 2NOZA 2R5XA 1YQMA 4ROCB 2IV8A 5KL0A 4BJUA 5IYCP 1M3HA 1LWWA 3OC3C 1B9KA 4WX8A 1N3CA 2NOHA 2LAEA 2OOYA 3T4NA 2HL8A 2NWVA 1QNEA 4WZSD 4TPSA 1PVSA 4CFFA 1LWYA 2O3OA 3ENCA 1VTOA 2NOEA 1QTPA 1QN3A 1AISA 3CVSA 2MZ8A 1HU0A 1PCMX 2QRDA 1LWVA 1QN9A 4I8OA 3OH9A 1QN4A 3ENOC 2D0CA 1D3UA 2MJ7A 1TBPA 2D0BA 1MPGA 1WJWA 2V92A 2H4LX 1W80A 1QN7A 2I5WA 2JOIA 2HKPA 3CVTA 1C47A 2ZFDB 2Z8UA 1VOKA 4C7PA 1KYFA 3N89A 4EAIA 3NA5A 5F9CA 1QN5A 4EJZA 2V8QA 5JMVD 3IH7A 1XSZA 1K2YX 3OSMA 1M3QA 1FN7A 2QRCA 5JN5A 2DKAA 3I3WA 3PDKA 4D7RA 2FKFA 1YQLA 1QNAA 1PCJX 3OSEA 2DKDA 2D0AA 2NVMA 2NOFA 1QNCA 1QTSA 2G30A 2HL9A 2DKCA 3RPJA 4EAGA 2FGTA 3CWAA 4EJYA 2Y8QA 2HZMA 1EBMA 2NOLA 1VKLA 3BKQX 1NH2A 3OLPA 1QN6A 1P5GX 3OH6A 1LXTA 2VJ0A 1KYDA 1VTLE 1V5SA 2HZSA 1TBAB 4WXAA 2EHBD 2Z0FA 3F10A 2YA3A 4MRQA 3SNSA 1KO9A 1RM1A 2IV9A 1UT7A 3PMGA 4EALA 2JHJA 3F0ZA 2NLVA
chains in the Genus database with same CATH topology
1YQRA 1NVPA 4PY5A 1QNBA 3H1ZA 4Q11A 3I0XA 1C9BB 1KYUA 1KY6A 5IYBP 1QN8A 3OCIA 3OSTA 2NOIA 1JFIC 2YH5A 1TGHA 1PCZA 1E42A 4ROEB 1KY7A 1YQKA 1N39A 3HS8A 1UT4A 3HS9A 2NOBA 3DPTA 3VN5A 4DULA 3DPUA 1R4XA 1YTFA 1PZDA 3EIKA 4RODB 3KRMA 5AN4A 4B0AA 1YTBA 2XHIA 1N3AA 1MP9A 3ASMA 3I0WA 3KTUA 5IYDP 1NGMA 1VOLB 1CDWA 3ULXA 2NOZA 1YQMA 4ROCB 2IV8A 1M3HA 5IYCP 1LWWA 3OC3C 1B9KA 1N3CA 2NOHA 2LAEA 1QNEA 4WZSD 4TPSA 1LWYA 2O3OA 1VTOA 2NOEA 1QTPA 1QN3A 1AISA 2MZ8A 1HU0A 1LWVA 1QN9A 4I8OA 1QN4A 2D0CA 1D3UA 2MJ7A 1TBPA 2D0BA 1W80A 1QN7A 2I5WA 2JOIA 2Z8UA 1VOKA 1KYFA 3N89A 1QN5A 4EJZA 3IH7A 3OSMA 1M3QA 1FN7A 1YQLA 1QNAA 2D0AA 2NOFA 1QNCA 1QTSA 2G30A 4EJYA 3RPJA 2FGTA 1EBMA 2HZMA 2NOLA 1NH2A 1QN6A 2VJ0A 1KYDA 1VTLE 2HZSA 1TBAB 3F10A 3SNSA 1KO9A 1RM1A 2IV9A 1UT7A 3F0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VN5 A;  1QTP A;  1R4X A;  1NVP A;  4PY5 A;  1YTF A;  1QN3 A;  1QNA A;  1PZD A;  1QNB A;  1AIS A;  2D0A A;  3EIK A;  4ROD B;  3H1Z A;  1QNC A;  1QTS A;  2G30 A;  4B0A A;  1QN6 A;  1QN9 A;  1YTB A;  1MP9 A;  1QN4 A;  3ASM A;  2D0C A;  1D3U A;  2MJ7 A;  1TBP A;  1KYU A;  1KY6 A;  2D0B A;  5IYB P;  1NH2 A;  3OCI A;  1C9B B;  1NGM A;  1QN8 A;  5IYD P;  1VOL B;  1CDW A;  1W80 A;  2VJ0 A;  1JFI C;  1KYD A;  1VTL E;  4ROC B;  2IV8 A;  1TBA B;  5IYC P;  1QN7 A;  1TGH A;  3OC3 C;  1B9K A;  1PCZ A;  1E42 A;  4ROE B;  1KY7 A;  2Z8U A;  1VOK A;  3HS8 A;  1KYF A;  2IV9 A;  4WZS D;  1RM1 A;  1QN5 A;  1QNE A;  3HS9 A;  1VTO A; 
#chains in the Genus database with same CATH topology
 3EAY A;  1YQR A;  1T6A A;  1NVP A;  4PY5 A;  3OGD A;  2V9J A;  1QNB A;  2QR1 A;  1Q9U A;  1KFQ A;  3H1Z A;  4Q11 A;  3CWU A;  4D7Q A;  1DIZ A;  4EAJ A;  1UL7 A;  1EUV A;  3I0X A;  2Y8L A;  2H5A X;  1C9B B;  1J3M A;  1KYU A;  1KY6 A;  5IYB P;  1QN8 A;  3OCI A;  3OST A;  3CWS A;  2NOI A;  1JFI C;  4QG5 A;  3TE5 A;  2YH5 A;  5BMN A;  1TGH A;  1PCZ A;  1E42 A;  4ROE B;  2FKM X;  1KY7 A;  2QLV A;  1YQK A;  1N39 A;  1P5D X;  3HS8 A;  3RSM A;  4EAK A;  1UT4 A;  2JHN A;  3C04 A;  3HS9 A;  3TDH A;  3D4V A;  5HSH A;  2NOB A;  2JPI A;  3DPT A;  5BMP A;  1TUO A;  3VN5 A;  3D7Q A;  1WQA A;  3DPU A;  4DUL A;  1R4X A;  1C4G A;  1YTF A;  2PWW A;  1K35 A;  3CW7 A;  5EPC A;  1PZD A;  1KFI A;  3EIK A;  4ROD B;  3KRM A;  3CWT A;  5AN4 A;  2OOX A;  4B0A A;  1YTB A;  2XHI A;  1N3A A;  2QRE A;  1MP9 A;  3ASM A;  2FUV A;  3UW2 A;  3I0W A;  4HJH A;  1JDY A;  3KTU A;  1M5Q 1;  1NGM A;  5IYD P;  1VOL B;  2F7L A;  1CDW A;  4IL8 A;  3ULX A;  2NOZ A;  2R5X A;  1YQM A;  4ROC B;  2IV8 A;  5KL0 A;  4BJU A;  5IYC P;  1M3H A;  1LWW A;  3OC3 C;  1B9K A;  4WX8 A;  1N3C A;  2NOH A;  2LAE A;  2OOY A;  3T4N A;  2HL8 A;  2NWV A;  1QNE A;  4WZS D;  4TPS A;  1PVS A;  4CFF A;  1LWY A;  2O3O A;  3ENC A;  1VTO A;  2NOE A;  1QTP A;  1QN3 A;  1AIS A;  3CVS A;  2MZ8 A;  1HU0 A;  1PCM X;  2QRD A;  1LWV A;  1QN9 A;  4I8O A;  3OH9 A;  1QN4 A;  3ENO C;  2D0C A;  1D3U A;  2MJ7 A;  1TBP A;  2D0B A;  1MPG A;  1WJW A;  2V92 A;  2H4L X;  1W80 A;  1QN7 A;  2I5W A;  2JOI A;  2HKP A;  3CVT A;  1C47 A;  2ZFD B;  2Z8U A;  1VOK A;  4C7P A;  1KYF A;  3N89 A;  4EAI A;  3NA5 A;  5F9C A;  1QN5 A;  4EJZ A;  2V8Q A;  5JMV D;  3IH7 A;  1XSZ A;  1K2Y X;  3OSM A;  1M3Q A;  1FN7 A;  2QRC A;  5JN5 A;  2DKA A;  3I3W A;  3PDK A;  4D7R A;  2FKF A;  1YQL A;  1QNA A;  1PCJ X;  3OSE A;  2DKD A;  2D0A A;  2NVM A;  2NOF A;  1QNC A;  1QTS A;  2G30 A;  2HL9 A;  2DKC A;  3RPJ A;  4EAG A;  2FGT A;  3CWA A;  4EJY A;  2Y8Q A;  2HZM A;  1EBM A;  2NOL A;  1VKL A;  3BKQ X;  1NH2 A;  3OLP A;  1QN6 A;  1P5G X;  3OH6 A;  1LXT A;  2VJ0 A;  1KYD A;  1VTL E;  1V5S A;  2HZS A;  1TBA B;  4WXA A;  2EHB D;  2Z0F A;  3F10 A;  2YA3 A;  4MRQ A;  3SNS A;  1KO9 A;  1RM1 A;  2IV9 A;  1UT7 A;  3PMG A;  4EAL A;  2JHJ A;  3F0Z A;  2NLV A; 
#chains in the Genus database with same CATH homology
 1YQR A;  1NVP A;  4PY5 A;  1QNB A;  3H1Z A;  4Q11 A;  3I0X A;  1C9B B;  1KYU A;  1KY6 A;  5IYB P;  1QN8 A;  3OCI A;  3OST A;  2NOI A;  1JFI C;  2YH5 A;  1TGH A;  1PCZ A;  1E42 A;  4ROE B;  1KY7 A;  1YQK A;  1N39 A;  3HS8 A;  1UT4 A;  3HS9 A;  2NOB A;  3DPT A;  3VN5 A;  4DUL A;  3DPU A;  1R4X A;  1YTF A;  1PZD A;  3EIK A;  4ROD B;  3KRM A;  5AN4 A;  4B0A A;  1YTB A;  2XHI A;  1N3A A;  1MP9 A;  3ASM A;  3I0W A;  3KTU A;  5IYD P;  1NGM A;  1VOL B;  1CDW A;  3ULX A;  2NOZ A;  1YQM A;  4ROC B;  2IV8 A;  1M3H A;  5IYC P;  1LWW A;  3OC3 C;  1B9K A;  1N3C A;  2NOH A;  2LAE A;  1QNE A;  4WZS D;  4TPS A;  1LWY A;  2O3O A;  1VTO A;  2NOE A;  1QTP A;  1QN3 A;  1AIS A;  2MZ8 A;  1HU0 A;  1LWV A;  1QN9 A;  4I8O A;  1QN4 A;  2D0C A;  1D3U A;  2MJ7 A;  1TBP A;  2D0B A;  1W80 A;  1QN7 A;  2I5W A;  2JOI A;  2Z8U A;  1VOK A;  1KYF A;  3N89 A;  1QN5 A;  4EJZ A;  3IH7 A;  3OSM A;  1M3Q A;  1FN7 A;  1YQL A;  1QNA A;  2D0A A;  2NOF A;  1QNC A;  1QTS A;  2G30 A;  4EJY A;  3RPJ A;  2FGT A;  1EBM A;  2HZM A;  2NOL A;  1NH2 A;  1QN6 A;  2VJ0 A;  1KYD A;  1VTL E;  2HZS A;  1TBA B;  3F10 A;  3SNS A;  1KO9 A;  1RM1 A;  2IV9 A;  1UT7 A;  3F0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...