5IYDP

Human core-pic in the initial transcribing state (no iis)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
185
structure length
185
Chain Sequence
TPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
total genus 39
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iydP01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 5iydP02
1QTSA 1KYDA 1TGHA 4PY5A 1D3UA 2VJ0A 3OC3C 1QN8A 1YTBA 1JFIC 4ROCB 1KY6A 1QN4A 1KYUA 1QNAA 3HS9A 5IYDP 2D0BA 1KY7A 1NVPA 2D0CA 1QNEA 3ASMA 4ROEB 1QN5A 1VOKA 1NGMA 1VOLB 1QNCA 1VTOA 1E42A 1QTPA 2MJ7A 1TBAB 3HS8A 1PZDA 1C9BB 1QN9A 1TBPA 1RM1A 1QN7A 1QN3A 1VTLE 2G30A 1PCZA 3OCIA 5IYCP 1CDWA 1QNBA 4WZSD 2IV9A 4RODB 1NH2A 1W80A 1MP9A 1B9KA 1R4XA 1AISA 3EIKA 3VN5A 2D0AA 3H1ZA 1KYFA 2Z8UA 4B0AA 5IYBP 1QN6A 2IV8A 1YTFA
chains in the Genus database with same CATH superfamily
4BJUA 4HJHA 2PWWA 3NA5A 3OH6A 1VKLA 1QN8A 1YTBA 2NOFA 2O3OA 2QRDA 1QNAA 4QG5A 1YQMA 3EAYA 2NOLA 1J3MA 3BKQX 2HZMA 3ASMA 3F10A 3OSMA 2JOIA 3D7QA 4DULA 2I5WA 2V9JA 3CVSA 1LWYA 2MJ7A 3TDHA 1KO9A 1UL7A 1YQKA 1QN7A 1WJWA 3OCIA 1PCZA 2H4LX 5IYCP 2FGTA 3N89A 1N3AA 3DPTA 4WX8A 4EAGA 2NOEA 1B9KA 2Y8QA 3T4NA 3EIKA 2Y8LA 1QN6A 2H5AX 2XHIA 1P5GX 2DKAA 5F9CA 2Z0FA 1WQAA 1LWWA 1UT4A 5KL0A 1TGHA 5EPCA 2VJ0A 3D4VA 2NOHA 4WXAA 1EBMA 5JMVD 4ROCB 4CFFA 1FN7A 1KYUA 4C7PA 3ENCA 4IL8A 2D0BA 3RPJA 1KY7A 1C47A 1M3HA 5HSHA 5BMNA 1QN5A 3PDKA 4EAIA 1EUVA 1NGMA 1V5SA 3IH7A 2DKDA 1UT7A 3HS8A 4I8OA 1K2YX 1PCMX 1PZDA 1RM1A 1QN3A 1HU0A 1VTLE 3TE5A 1QNBA 3I3WA 2QR1A 1JDYA 1MP9A 2HL8A 1AISA 3VN5A 2D0AA 4TPSA 3KTUA 2NWVA 1DIZA 1M5Q1 2HZSA 1XSZA 2DKCA 1PVSA 2NOBA 2IV8A 2HKPA 1K35A 1QTSA 3ULXA 4EALA 2NOIA 4EJZA 4PY5A 1D3UA 3OC3C 3CWTA 2FKFA 1QN4A 1KY6A 1KFIA 5IYDP 4EAJA 1NVPA 4EJYA 1VOKA 2JPIA 2QRCA 1QNCA 1VTOA 1E42A 1QTPA 1TBAB 3CWAA 3DPUA 2QREA 5JN5A 1CDWA 2G30A 3C04A 3UW2A 3CWUA 1YQRA 2V8QA 1W80A 2JHJA 1R4XA 2NLVA 3RSMA 1LXTA 3SNSA 3OGDA 1KFQA 1N3CA 1C4GA 3F0ZA 3CWSA 2JHNA 1N39A 3OSTA 2EHBD 2NOZA 1T6AA 3ENOC 1YTFA 1KYDA 2YA3A 4D7RA 3OLPA 2MZ8A 4Q11A 3CVTA 2F7LA 1TUOA 3PMGA 1JFIC 3OH9A 3KRMA 3HS9A 5AN4A 1PCJX 3I0XA 2D0CA 1QNEA 4ROEB 2FKMX 2OOXA 1VOLB 2YH5A 4MRQA 4D7QA 1C9BB 1M3QA 1P5DX 1QN9A 1TBPA 2LAEA 1MPGA 2ZFDB 4WZSD 2IV9A 4EAKA 4RODB 2V92A 1NH2A 2FUVA 1YQLA 2R5XA 2OOYA 3H1ZA 5BMPA 1KYFA 2Z8UA 2QLVA 5IYBP 4B0AA 3I0WA 1LWVA 3OSEA 3CW7A 2HL9A 2NVMA 1Q9UA
chains in the Genus database with same CATH topology
1QN8A 1YTBA 2NOFA 2O3OA 1QNAA 1YQMA 2NOLA 2HZMA 3ASMA 3F10A 3OSMA 2JOIA 2I5WA 1LWYA 2MJ7A 1KO9A 1YQKA 1QN7A 3OCIA 1PCZA 5IYCP 2FGTA 1N3AA 3DPTA 2NOEA 1B9KA 3EIKA 1QN6A 2XHIA 1LWWA 1UT4A 1TGHA 2VJ0A 2NOHA 1EBMA 4ROCB 1FN7A 1KYUA 3RPJA 2D0BA 1KY7A 1M3HA 1QN5A 1NGMA 3IH7A 1UT7A 3HS8A 4I8OA 1PZDA 1RM1A 1QN3A 1HU0A 1VTLE 1QNBA 1MP9A 1AISA 3VN5A 2D0AA 4TPSA 3KTUA 2HZSA 2NOBA 2IV8A 1QTSA 3ULXA 2NOIA 4EJZA 4PY5A 1D3UA 3OC3C 1QN4A 1KY6A 5IYDP 1NVPA 4EJYA 1VOKA 1QNCA 1VTOA 1E42A 1QTPA 1TBAB 3DPUA 1CDWA 2G30A 1YQRA 1W80A 1R4XA 3SNSA 1N3CA 3F0ZA 1N39A 3OSTA 2NOZA 1YTFA 1KYDA 2MZ8A 4Q11A 1JFIC 3KRMA 3HS9A 5AN4A 3I0XA 2D0CA 1QNEA 4ROEB 1VOLB 2YH5A 1C9BB 1M3QA 1QN9A 1TBPA 2LAEA 4WZSD 2IV9A 4RODB 1NH2A 1YQLA 3H1ZA 1KYFA 2Z8UA 4B0AA 5IYBP 3I0WA 1LWVA 3N89A 4DULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QTS A;  1KYD A;  1TGH A;  4PY5 A;  1D3U A;  2VJ0 A;  3OC3 C;  1QN8 A;  1YTB A;  1JFI C;  4ROC B;  1KY6 A;  1QN4 A;  1KYU A;  1QNA A;  3HS9 A;  5IYD P;  2D0B A;  1KY7 A;  1NVP A;  2D0C A;  1QNE A;  3ASM A;  4ROE B;  1QN5 A;  1VOK A;  1NGM A;  1VOL B;  1QNC A;  1VTO A;  1E42 A;  1QTP A;  2MJ7 A;  1TBA B;  3HS8 A;  1PZD A;  1C9B B;  1QN9 A;  1TBP A;  1RM1 A;  1QN7 A;  1QN3 A;  1VTL E;  2G30 A;  1PCZ A;  3OCI A;  5IYC P;  1CDW A;  1QNB A;  4WZS D;  2IV9 A;  4ROD B;  1NH2 A;  1W80 A;  1MP9 A;  1B9K A;  1R4X A;  1AIS A;  3EIK A;  3VN5 A;  2D0A A;  3H1Z A;  1KYF A;  2Z8U A;  4B0A A;  5IYB P;  1QN6 A;  2IV8 A;  1YTF A; 
#chains in the Genus database with same CATH topology
 4BJU A;  4HJH A;  2PWW A;  3NA5 A;  3OH6 A;  1VKL A;  1QN8 A;  1YTB A;  2NOF A;  2O3O A;  2QRD A;  1QNA A;  4QG5 A;  1YQM A;  3EAY A;  2NOL A;  1J3M A;  3BKQ X;  2HZM A;  3ASM A;  3F10 A;  3OSM A;  2JOI A;  3D7Q A;  4DUL A;  2I5W A;  2V9J A;  3CVS A;  1LWY A;  2MJ7 A;  3TDH A;  1KO9 A;  1UL7 A;  1YQK A;  1QN7 A;  1WJW A;  3OCI A;  1PCZ A;  2H4L X;  5IYC P;  2FGT A;  3N89 A;  1N3A A;  3DPT A;  4WX8 A;  4EAG A;  2NOE A;  1B9K A;  2Y8Q A;  3T4N A;  3EIK A;  2Y8L A;  1QN6 A;  2H5A X;  2XHI A;  1P5G X;  2DKA A;  5F9C A;  2Z0F A;  1WQA A;  1LWW A;  1UT4 A;  5KL0 A;  1TGH A;  5EPC A;  2VJ0 A;  3D4V A;  2NOH A;  4WXA A;  1EBM A;  5JMV D;  4ROC B;  4CFF A;  1FN7 A;  1KYU A;  4C7P A;  3ENC A;  4IL8 A;  2D0B A;  3RPJ A;  1KY7 A;  1C47 A;  1M3H A;  5HSH A;  5BMN A;  1QN5 A;  3PDK A;  4EAI A;  1EUV A;  1NGM A;  1V5S A;  3IH7 A;  2DKD A;  1UT7 A;  3HS8 A;  4I8O A;  1K2Y X;  1PCM X;  1PZD A;  1RM1 A;  1QN3 A;  1HU0 A;  1VTL E;  3TE5 A;  1QNB A;  3I3W A;  2QR1 A;  1JDY A;  1MP9 A;  2HL8 A;  1AIS A;  3VN5 A;  2D0A A;  4TPS A;  3KTU A;  2NWV A;  1DIZ A;  1M5Q 1;  2HZS A;  1XSZ A;  2DKC A;  1PVS A;  2NOB A;  2IV8 A;  2HKP A;  1K35 A;  1QTS A;  3ULX A;  4EAL A;  2NOI A;  4EJZ A;  4PY5 A;  1D3U A;  3OC3 C;  3CWT A;  2FKF A;  1QN4 A;  1KY6 A;  1KFI A;  5IYD P;  4EAJ A;  1NVP A;  4EJY A;  1VOK A;  2JPI A;  2QRC A;  1QNC A;  1VTO A;  1E42 A;  1QTP A;  1TBA B;  3CWA A;  3DPU A;  2QRE A;  5JN5 A;  1CDW A;  2G30 A;  3C04 A;  3UW2 A;  3CWU A;  1YQR A;  2V8Q A;  1W80 A;  2JHJ A;  1R4X A;  2NLV A;  3RSM A;  1LXT A;  3SNS A;  3OGD A;  1KFQ A;  1N3C A;  1C4G A;  3F0Z A;  3CWS A;  2JHN A;  1N39 A;  3OST A;  2EHB D;  2NOZ A;  1T6A A;  3ENO C;  1YTF A;  1KYD A;  2YA3 A;  4D7R A;  3OLP A;  2MZ8 A;  4Q11 A;  3CVT A;  2F7L A;  1TUO A;  3PMG A;  1JFI C;  3OH9 A;  3KRM A;  3HS9 A;  5AN4 A;  1PCJ X;  3I0X A;  2D0C A;  1QNE A;  4ROE B;  2FKM X;  2OOX A;  1VOL B;  2YH5 A;  4MRQ A;  4D7Q A;  1C9B B;  1M3Q A;  1P5D X;  1QN9 A;  1TBP A;  2LAE A;  1MPG A;  2ZFD B;  4WZS D;  2IV9 A;  4EAK A;  4ROD B;  2V92 A;  1NH2 A;  2FUV A;  1YQL A;  2R5X A;  2OOY A;  3H1Z A;  5BMP A;  1KYF A;  2Z8U A;  2QLV A;  5IYB P;  4B0A A;  3I0W A;  1LWV A;  3OSE A;  3CW7 A;  2HL9 A;  2NVM A;  1Q9U A; 
#chains in the Genus database with same CATH homology
 1QN8 A;  1YTB A;  2NOF A;  2O3O A;  1QNA A;  1YQM A;  2NOL A;  2HZM A;  3ASM A;  3F10 A;  3OSM A;  2JOI A;  2I5W A;  1LWY A;  2MJ7 A;  1KO9 A;  1YQK A;  1QN7 A;  3OCI A;  1PCZ A;  5IYC P;  2FGT A;  1N3A A;  3DPT A;  2NOE A;  1B9K A;  3EIK A;  1QN6 A;  2XHI A;  1LWW A;  1UT4 A;  1TGH A;  2VJ0 A;  2NOH A;  1EBM A;  4ROC B;  1FN7 A;  1KYU A;  3RPJ A;  2D0B A;  1KY7 A;  1M3H A;  1QN5 A;  1NGM A;  3IH7 A;  1UT7 A;  3HS8 A;  4I8O A;  1PZD A;  1RM1 A;  1QN3 A;  1HU0 A;  1VTL E;  1QNB A;  1MP9 A;  1AIS A;  3VN5 A;  2D0A A;  4TPS A;  3KTU A;  2HZS A;  2NOB A;  2IV8 A;  1QTS A;  3ULX A;  2NOI A;  4EJZ A;  4PY5 A;  1D3U A;  3OC3 C;  1QN4 A;  1KY6 A;  5IYD P;  1NVP A;  4EJY A;  1VOK A;  1QNC A;  1VTO A;  1E42 A;  1QTP A;  1TBA B;  3DPU A;  1CDW A;  2G30 A;  1YQR A;  1W80 A;  1R4X A;  3SNS A;  1N3C A;  3F0Z A;  1N39 A;  3OST A;  2NOZ A;  1YTF A;  1KYD A;  2MZ8 A;  4Q11 A;  1JFI C;  3KRM A;  3HS9 A;  5AN4 A;  3I0X A;  2D0C A;  1QNE A;  4ROE B;  1VOL B;  2YH5 A;  1C9B B;  1M3Q A;  1QN9 A;  1TBP A;  2LAE A;  4WZS D;  2IV9 A;  4ROD B;  1NH2 A;  1YQL A;  3H1Z A;  1KYF A;  2Z8U A;  4B0A A;  5IYB P;  3I0W A;  1LWV A;  3N89 A;  4DUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...