2V8QA

Crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
156
structure length
102
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 23
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2v8qA01
2Y8LA 2QLVA 2OOYA 2YA3A 2EHBD 2QR1A 2V9JA 1V5SA 2ZFDB 2QRDA 4EAKA 4EAGA 4EALA 2Y8QA 4CFFA 2QREA 3TDHA 2V92A 4EAIA 4EAJA 2QRCA 3T4NA 3OSEA 1UL7A 2OOXA 3TE5A 2V8QA
chains in the Genus database with same CATH superfamily
3OH6A 3OSMA 1KO9A 3EIKA 4MRQA 4BJUA 1XSZA 1KYFA 2IV8A 3SNSA 1P5GX 1N3CA 3CWAA 2NLVA 2FGTA 1WJWA 1K35A 2ZFDB 4EJZA 1M5Q1 5BMPA 1QNCA 4EAKA 1Q9UA 1YTBA 2H5AX 1E42A 1K2YX 4RODB 2Z8UA 2V92A 4EAIA 5JN5A 3CWTA 4ROCB 4EAJA 3IH7A 1QTSA 2DKDA 1HU0A 2HZMA 1C47A 1C4GA 5AN4A 2NOFA 2R5XA 2G30A 1EUVA 1EBMA 1VOLB 3EAYA 5JMVD 1YQLA 1MP9A 2D0BA 3CWUA 1RM1A 1QN9A 1QNEA 4WZSD 1AISA 2I5WA 4TPSA 1YTFA 2QLVA 2OOYA 3ENOC 2Z0FA 3OC3C 2FUVA 3F0ZA 1P5DX 2FKMX 4C7PA 3CW7A 1R4XA 1TUOA 2JHNA 4ROEB 1MPGA 1JFIC 1KFIA 4WXAA 3CVSA 5KL0A 1VTLE 3PDKA 2NOHA 1LWVA 1TBPA 1QTPA 3TDHA 1VKLA 4D7RA 3PMGA 1PCJX 1YQRA 1FN7A 1QN8A 1QN3A 3CVTA 4QG5A 1NVPA 2D0CA 3DPTA 1LWWA 1KY6A 2PWWA 3ULXA 1KYDA 4IL8A 2MZ8A 4I8OA 1M3HA 4B0AA 5IYCP 1YQMA 2F7LA 2Y8LA 2NVMA 4Q11A 1QN6A 4WX8A 1N3AA 1T6AA 2YA3A 3F10A 2DKAA 2QR1A 3OSTA 2V9JA 1YQKA 2NOEA 3I3WA 2NOZA 1N39A 2QRDA 2NOIA 1WQAA 2H4LX 1KY7A 2O3OA 3RPJA 1PVSA 3OGDA 1M3QA 1PZDA 3D4VA 1QNAA 4PY5A 3D7QA 5IYBP 2HKPA 1D3UA 1TBAB 1B9KA 2MJ7A 2QRCA 1UT7A 3VN5A 4D7QA 4DULA 3C04A 2JOIA 2NWVA 3I0XA 1VTOA 1QN4A 1UL7A 3DPUA 4EJYA 3N89A 1VOKA 2V8QA 2VJ0A 2NOLA 5EPCA 3I0WA 2FKFA 3OH9A 1QNBA 5BMNA 3OCIA 2EHBD 2D0AA 1V5SA 3NA5A 1LXTA 1PCMX 3ENCA 1PCZA 2XHIA 3CWSA 2JHJA 3BKQX 1NGMA 1TGHA 4EAGA 2JPIA 4EALA 2Y8QA 4CFFA 2QREA 3RSMA 1J3MA 3ASMA 1C9BB 3HS9A 1NH2A 1CDWA 2HL8A 5IYDP 2IV9A 5HSHA 1QN7A 3H1ZA 1DIZA 1JDYA 1KYUA 1KFQA 3KTUA 3T4NA 3KRMA 3HS8A 2HZSA 4HJHA 3OLPA 3OSEA 2HL9A 1UT4A 5F9CA 1LWYA 1QN5A 2DKCA 2NOBA 2YH5A 2LAEA 1W80A 2OOXA 3UW2A 3TE5A
chains in the Genus database with same CATH topology
2Y8LA 2QLVA 2OOYA 2YA3A 2EHBD 2QR1A 2V9JA 1V5SA 2ZFDB 2QRDA 4EAKA 4EAGA 4EALA 2Y8QA 4CFFA 2QREA 3TDHA 2V92A 4EAIA 4EAJA 2QRCA 3T4NA 3OSEA 1UL7A 2OOXA 3TE5A 2V8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8L A;  2QLV A;  2OOY A;  2YA3 A;  2EHB D;  2QR1 A;  2V9J A;  1V5S A;  2ZFD B;  2QRD A;  4EAK A;  4EAG A;  4EAL A;  2Y8Q A;  4CFF A;  2QRE A;  3TDH A;  2V92 A;  4EAI A;  4EAJ A;  2QRC A;  3T4N A;  3OSE A;  1UL7 A;  2OOX A;  3TE5 A;  2V8Q A; 
#chains in the Genus database with same CATH topology
 3OH6 A;  3OSM A;  1KO9 A;  3EIK A;  4MRQ A;  4BJU A;  1XSZ A;  1KYF A;  2IV8 A;  3SNS A;  1P5G X;  1N3C A;  3CWA A;  2NLV A;  2FGT A;  1WJW A;  1K35 A;  2ZFD B;  4EJZ A;  1M5Q 1;  5BMP A;  1QNC A;  4EAK A;  1Q9U A;  1YTB A;  2H5A X;  1E42 A;  1K2Y X;  4ROD B;  2Z8U A;  2V92 A;  4EAI A;  5JN5 A;  3CWT A;  4ROC B;  4EAJ A;  3IH7 A;  1QTS A;  2DKD A;  1HU0 A;  2HZM A;  1C47 A;  1C4G A;  5AN4 A;  2NOF A;  2R5X A;  2G30 A;  1EUV A;  1EBM A;  1VOL B;  3EAY A;  5JMV D;  1YQL A;  1MP9 A;  2D0B A;  3CWU A;  1RM1 A;  1QN9 A;  1QNE A;  4WZS D;  1AIS A;  2I5W A;  4TPS A;  1YTF A;  2QLV A;  2OOY A;  3ENO C;  2Z0F A;  3OC3 C;  2FUV A;  3F0Z A;  1P5D X;  2FKM X;  4C7P A;  3CW7 A;  1R4X A;  1TUO A;  2JHN A;  4ROE B;  1MPG A;  1JFI C;  1KFI A;  4WXA A;  3CVS A;  5KL0 A;  1VTL E;  3PDK A;  2NOH A;  1LWV A;  1TBP A;  1QTP A;  3TDH A;  1VKL A;  4D7R A;  3PMG A;  1PCJ X;  1YQR A;  1FN7 A;  1QN8 A;  1QN3 A;  3CVT A;  4QG5 A;  1NVP A;  2D0C A;  3DPT A;  1LWW A;  1KY6 A;  2PWW A;  3ULX A;  1KYD A;  4IL8 A;  2MZ8 A;  4I8O A;  1M3H A;  4B0A A;  5IYC P;  1YQM A;  2F7L A;  2Y8L A;  2NVM A;  4Q11 A;  1QN6 A;  4WX8 A;  1N3A A;  1T6A A;  2YA3 A;  3F10 A;  2DKA A;  2QR1 A;  3OST A;  2V9J A;  1YQK A;  2NOE A;  3I3W A;  2NOZ A;  1N39 A;  2QRD A;  2NOI A;  1WQA A;  2H4L X;  1KY7 A;  2O3O A;  3RPJ A;  1PVS A;  3OGD A;  1M3Q A;  1PZD A;  3D4V A;  1QNA A;  4PY5 A;  3D7Q A;  5IYB P;  2HKP A;  1D3U A;  1TBA B;  1B9K A;  2MJ7 A;  2QRC A;  1UT7 A;  3VN5 A;  4D7Q A;  4DUL A;  3C04 A;  2JOI A;  2NWV A;  3I0X A;  1VTO A;  1QN4 A;  1UL7 A;  3DPU A;  4EJY A;  3N89 A;  1VOK A;  2V8Q A;  2VJ0 A;  2NOL A;  5EPC A;  3I0W A;  2FKF A;  3OH9 A;  1QNB A;  5BMN A;  3OCI A;  2EHB D;  2D0A A;  1V5S A;  3NA5 A;  1LXT A;  1PCM X;  3ENC A;  1PCZ A;  2XHI A;  3CWS A;  2JHJ A;  3BKQ X;  1NGM A;  1TGH A;  4EAG A;  2JPI A;  4EAL A;  2Y8Q A;  4CFF A;  2QRE A;  3RSM A;  1J3M A;  3ASM A;  1C9B B;  3HS9 A;  1NH2 A;  1CDW A;  2HL8 A;  5IYD P;  2IV9 A;  5HSH A;  1QN7 A;  3H1Z A;  1DIZ A;  1JDY A;  1KYU A;  1KFQ A;  3KTU A;  3T4N A;  3KRM A;  3HS8 A;  2HZS A;  4HJH A;  3OLP A;  3OSE A;  2HL9 A;  1UT4 A;  5F9C A;  1LWY A;  1QN5 A;  2DKC A;  2NOB A;  2YH5 A;  2LAE A;  1W80 A;  2OOX A;  3UW2 A;  3TE5 A; 
#chains in the Genus database with same CATH homology
 2Y8L A;  2QLV A;  2OOY A;  2YA3 A;  2EHB D;  2QR1 A;  2V9J A;  1V5S A;  2ZFD B;  2QRD A;  4EAK A;  4EAG A;  4EAL A;  2Y8Q A;  4CFF A;  2QRE A;  3TDH A;  2V92 A;  4EAI A;  4EAJ A;  2QRC A;  3T4N A;  3OSE A;  1UL7 A;  2OOX A;  3TE5 A;  2V8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...