2V8QA

Crystal structure of the regulatory fragment of mammalian ampk in complexes with amp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
156
structure length
102
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 23
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2v8qA01
1UL7A 2OOXA 3T4NA 4CFFA 2V9JA 1V5SA 2Y8QA 2ZFDB 2YA3A 2QREA 3TE5A 2QR1A 2EHBD 2OOYA 2V8QA 2QRDA 4EAIA 4EAKA 2V92A 2QRCA 4EALA 3TDHA 2Y8LA 2QLVA 3OSEA 4EAJA 4EAGA
chains in the Genus database with same CATH superfamily
3OGDA 3OCIA 1YQRA 3T4NA 2H4LX 3F10A 1KYDA 3PMGA 1K2YX 2FUVA 2Y8QA 3HS9A 2ZFDB 1LWVA 1K35A 5F9CA 3CVSA 2G30A 2NVMA 1HU0A 1N3AA 4ROCB 1VTOA 4D7RA 2QREA 4HJHA 2QR1A 1QN6A 5JMVD 2OOYA 2V8QA 2HL8A 1TBAB 2QRDA 3PDKA 1JDYA 1W80A 1NGMA 2QRCA 1RM1A 4PY5A 2H5AX 4WXAA 1KY7A 3ENOC 2NOZA 5BMPA 2HZMA 1C4GA 3OC3C 2Z0FA 3C04A 1CDWA 1EBMA 1VKLA 3KRMA 3RPJA 4WX8A 1KFQA 3UW2A 2NOHA 1TBPA 1VOKA 3RSMA 3I3WA 2R5XA 2OOXA 3ULXA 1D3UA 4CFFA 2NOFA 2JHJA 1UT7A 4D7QA 1J3MA 1YQLA 2V9JA 1N39A 2FKFA 3CWAA 4B0AA 1KYFA 1MP9A 2NOLA 2LAEA 1QTPA 1AISA 3TE5A 2EHBD 1N3CA 1VOLB 5BMNA 2XHIA 3CWSA 3EAYA 2D0AA 1EUVA 1KYUA 1QTSA 2V92A 1QN3A 1UT4A 3D7QA 1QN7A 2Y8LA 3DPTA 3CW7A 3OH6A 1M5Q1 1LXTA 3SNSA 1C9BB 2O3OA 2NOEA 1QNBA 4WZSD 1KO9A 1PVSA 1QNAA 4I8OA 2VJ0A 4EAGA 4EJZA 2NOIA 1FN7A 2D0BA 3ASMA 3I0WA 1MPGA 2DKAA 1R4XA 1KFIA 4DULA 3DPUA 3OLPA 1NVPA 1P5GX 4TPSA 1M3QA 3BKQX 3NA5A 1PCZA 1WQAA 1VTLE 2YA3A 2NWVA 1TGHA 5IYDP 1B9KA 2DKCA 2FKMX 3IH7A 5EPCA 4EAIA 1QN5A 3ENCA 2HL9A 5IYCP 4EAKA 3CVTA 4BJUA 3F0ZA 3OSEA 2I5WA 1Q9UA 2HKPA 2DKDA 4EAJA 5HSHA 2F7LA 2Z8UA 1LWYA 3H1ZA 3OSMA 5IYBP 1TUOA 4MRQA 1UL7A 4Q11A 4IL8A 1P5DX 1QN9A 2HZSA 2NLVA 1QN4A 2FGTA 2JOIA 3HS8A 1WJWA 2MZ8A 3OSTA 3VN5A 4RODB 2IV9A 3N89A 1V5SA 1YTFA 1M3HA 1E42A 4EJYA 3D4VA 1PCMX 1NH2A 3CWTA 5KL0A 1DIZA 4QG5A 3I0XA 3KTUA 3CWUA 2YH5A 1XSZA 1PZDA 1JFIC 1KY6A 1C47A 2NOBA 2D0CA 1QN8A 1YQKA 1PCJX 4EALA 3TDHA 4ROEB 2JHNA 2PWWA 2IV8A 2QLVA 2MJ7A 1YTBA 4C7PA 2JPIA 5AN4A 1LWWA 5JN5A 1QNCA 1QNEA 3EIKA 3OH9A 1T6AA 1YQMA
chains in the Genus database with same CATH topology
1UL7A 2OOXA 3T4NA 4CFFA 2V9JA 1V5SA 2Y8QA 2ZFDB 2YA3A 2QREA 3TE5A 2QR1A 2EHBD 2OOYA 2V8QA 2QRDA 4EAIA 4EAKA 2V92A 2QRCA 4EALA 3TDHA 2Y8LA 2QLVA 3OSEA 4EAJA 4EAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UL7 A;  2OOX A;  3T4N A;  4CFF A;  2V9J A;  1V5S A;  2Y8Q A;  2ZFD B;  2YA3 A;  2QRE A;  3TE5 A;  2QR1 A;  2EHB D;  2OOY A;  2V8Q A;  2QRD A;  4EAI A;  4EAK A;  2V92 A;  2QRC A;  4EAL A;  3TDH A;  2Y8L A;  2QLV A;  3OSE A;  4EAJ A;  4EAG A; 
#chains in the Genus database with same CATH topology
 3OGD A;  3OCI A;  1YQR A;  3T4N A;  2H4L X;  3F10 A;  1KYD A;  3PMG A;  1K2Y X;  2FUV A;  2Y8Q A;  3HS9 A;  2ZFD B;  1LWV A;  1K35 A;  5F9C A;  3CVS A;  2G30 A;  2NVM A;  1HU0 A;  1N3A A;  4ROC B;  1VTO A;  4D7R A;  2QRE A;  4HJH A;  2QR1 A;  1QN6 A;  5JMV D;  2OOY A;  2V8Q A;  2HL8 A;  1TBA B;  2QRD A;  3PDK A;  1JDY A;  1W80 A;  1NGM A;  2QRC A;  1RM1 A;  4PY5 A;  2H5A X;  4WXA A;  1KY7 A;  3ENO C;  2NOZ A;  5BMP A;  2HZM A;  1C4G A;  3OC3 C;  2Z0F A;  3C04 A;  1CDW A;  1EBM A;  1VKL A;  3KRM A;  3RPJ A;  4WX8 A;  1KFQ A;  3UW2 A;  2NOH A;  1TBP A;  1VOK A;  3RSM A;  3I3W A;  2R5X A;  2OOX A;  3ULX A;  1D3U A;  4CFF A;  2NOF A;  2JHJ A;  1UT7 A;  4D7Q A;  1J3M A;  1YQL A;  2V9J A;  1N39 A;  2FKF A;  3CWA A;  4B0A A;  1KYF A;  1MP9 A;  2NOL A;  2LAE A;  1QTP A;  1AIS A;  3TE5 A;  2EHB D;  1N3C A;  1VOL B;  5BMN A;  2XHI A;  3CWS A;  3EAY A;  2D0A A;  1EUV A;  1KYU A;  1QTS A;  2V92 A;  1QN3 A;  1UT4 A;  3D7Q A;  1QN7 A;  2Y8L A;  3DPT A;  3CW7 A;  3OH6 A;  1M5Q 1;  1LXT A;  3SNS A;  1C9B B;  2O3O A;  2NOE A;  1QNB A;  4WZS D;  1KO9 A;  1PVS A;  1QNA A;  4I8O A;  2VJ0 A;  4EAG A;  4EJZ A;  2NOI A;  1FN7 A;  2D0B A;  3ASM A;  3I0W A;  1MPG A;  2DKA A;  1R4X A;  1KFI A;  4DUL A;  3DPU A;  3OLP A;  1NVP A;  1P5G X;  4TPS A;  1M3Q A;  3BKQ X;  3NA5 A;  1PCZ A;  1WQA A;  1VTL E;  2YA3 A;  2NWV A;  1TGH A;  5IYD P;  1B9K A;  2DKC A;  2FKM X;  3IH7 A;  5EPC A;  4EAI A;  1QN5 A;  3ENC A;  2HL9 A;  5IYC P;  4EAK A;  3CVT A;  4BJU A;  3F0Z A;  3OSE A;  2I5W A;  1Q9U A;  2HKP A;  2DKD A;  4EAJ A;  5HSH A;  2F7L A;  2Z8U A;  1LWY A;  3H1Z A;  3OSM A;  5IYB P;  1TUO A;  4MRQ A;  1UL7 A;  4Q11 A;  4IL8 A;  1P5D X;  1QN9 A;  2HZS A;  2NLV A;  1QN4 A;  2FGT A;  2JOI A;  3HS8 A;  1WJW A;  2MZ8 A;  3OST A;  3VN5 A;  4ROD B;  2IV9 A;  3N89 A;  1V5S A;  1YTF A;  1M3H A;  1E42 A;  4EJY A;  3D4V A;  1PCM X;  1NH2 A;  3CWT A;  5KL0 A;  1DIZ A;  4QG5 A;  3I0X A;  3KTU A;  3CWU A;  2YH5 A;  1XSZ A;  1PZD A;  1JFI C;  1KY6 A;  1C47 A;  2NOB A;  2D0C A;  1QN8 A;  1YQK A;  1PCJ X;  4EAL A;  3TDH A;  4ROE B;  2JHN A;  2PWW A;  2IV8 A;  2QLV A;  2MJ7 A;  1YTB A;  4C7P A;  2JPI A;  5AN4 A;  1LWW A;  5JN5 A;  1QNC A;  1QNE A;  3EIK A;  3OH9 A;  1T6A A;  1YQM A; 
#chains in the Genus database with same CATH homology
 1UL7 A;  2OOX A;  3T4N A;  4CFF A;  2V9J A;  1V5S A;  2Y8Q A;  2ZFD B;  2YA3 A;  2QRE A;  3TE5 A;  2QR1 A;  2EHB D;  2OOY A;  2V8Q A;  2QRD A;  4EAI A;  4EAK A;  2V92 A;  2QRC A;  4EAL A;  3TDH A;  2Y8L A;  2QLV A;  3OSE A;  4EAJ A;  4EAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...