2D0CA

Crystal structure of bst-rnase hiii in complex with mn2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords ribonuclease HIII
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0cA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0cA02
3LAKA 1CZBA 2GUIA 1XWLA 4DSIA 4KI6A 1NGMA 1U4BA 3I0SA 4TSXA 4Y1CA 4OLAA 2QXFA 4C8NA 1J53A 2HMIA 1W0HA 2FC0A 2IGIA 3ASMA 1KVAA 3O3GA 3OY9A 4O4GA 2KQ2A 4NYFA 4DF4A 3CFRA 3RMBA 2XY5A 4FJHA 1BI4B 3SUPA 2HVIA 2VWJA 1ZBUA 4CJ4A 3AA4A 4I7FA 2I5JA 1U48A 3O3HA 4HVJA 3KD5E 3PO5A 3F73A 2Z1JA 2D0BA 3T1AA 3NF8A 1T8EA 4DFPA 1RBUA 3NFAA 3OYFA 3PX6A 1TGOA 3ZCMA 1CZ9A 4Y1DA 1VTLE 1ASVA 1F21A 4FJIA 1SUQA 3LAMA 5KTQA 3V1OA 1QTPA 5FROA 4CJLA 3L3VA 4DSLA 4M3ZA 1IO2A 1QN7A 1EP4A 3QEIA 2ATQA 3HK2A 4EP5A 3QETA 4M3TA 4LH5A 4DQPA 4B8AB 4RW9A 1KRPA 2Z1IA 2G8IA 2HVHA 2G8UA 3C94A 1B9FA 1KTQA 1L3UA 4CJKA 4CJUA 4FCYA 3EYZA 4E7JA 3C6TA 2IAJA 2ZQBA 4DS5A 2RF2A 4OKKA 3VQ9A 4CHPA 4E7LA 2WOMA 3TARA 2DFHA 4WE1A 3NE6A 4E19A 1KFDA 1Q9YA 1TV6A 1YTFA 3E01A 1RT6A 1WN7A 5FRMA 5KI6A 4KHWA 4DLGA 1VTOA 4KB0A 4PUOA 5HROA 4FZYA 4O5BA 4AHRA 2GBZA 3ZT2A 3DM2A 3NBPA 4N47A 3LZIA 4CIEA 1T7PA 2A1SA 3IG1A 3B6OA 1HNVA 2IOCA 4J2DA 1HQEA 1S5JA 4N56A 3K59A 3PV8A 5C42A 4FYDA 3AO1A 3WNGA 1U45A 2IV9A 4CIFA 3ZSRA 3OYAA 3SYZA 1QNBA 4CJ5A 5SZTA 3ZSXA 4ZTJA 3M8PA 1ZYQA 4FJGA 1C1CA 2HNYA 4KHQA 2B6AA 3EIKA 2Z1HA 1VRUA 4CJTA 3SJJA 4B9VA 5J2MA 3ZSVA 5EU7A 4F3TA 5JS2A 4KKOA 4CEFA 2X6NA 4Z4HA 4IG3A 3ZSZA 3HPOA 3QIPA 4PA1A 3WNEA 1XC9A 1BIZA 4H4OA 3QNNA 2Y1JA 4CJRA 3QINA 1I3AA 2G8WA 1HMVA 3RMAA 3HO1A 1C1AA 2O4GA 3DOLA 2X6SA 1C0UA 3NH2A 4FM0A 3SQ4A 3OYDA 1NK9A 1Q9XA 4M3UA 1JLAA 4CF0A 3T3FA 2DY4A 1I39A 1RDBA 2HHWA 1S1UA 3CG7A 4IBNA 1Y97A 4CIGA 5T7BA 1HRHA 3LP2A 4HUFA 4CHZA 4DTPA 3LWLA 2XRIA 5HRSA 1KCFA 1KYDA 3MXMA 1DLOA 1JL2A 2X78A 2XO7A 4DMNA 1L3SA 3TAGA 3K5LA 4CECA 3PX0A 1QN6A 1LW0A 4G1QA 3TAPA 1J9AA 1VSHA 3TAMA 2G8HA 4CCHA 1D9DA 1ZBHA 4IKFA 3VA3A 3ZSYA 4WZSD 1GOAA 1QN3A 4RW7A 3TABA 4Q5VA 1L3TA 1U47A 2Y1IA 4Z4IA 3HP9A 3MEGA 4KFBA 5HRPA 1SKWA 2G8KA 4OJRA 3HYFA 3CFPA 3PY8A 4W5OA 3OS2A 2YNHA 3LWMA 4FJJA 2PY5A 5KRSA 4K8ZA 4OKJA 4IFVA 2F96A 4RW8A 4CEDA 4HTUA 1KYUA 1GOBA 1LWCA 2BANA 3TAQA 4BDPA 2F8TA 1RT7A 3QEPA 3NCIA 3AVIA 4C8OA 2PYLA 3S3OA 4FJ5A 3SPYA 3MXJA 1FKPA 2FBXA 1QSSA 1RT5A 2DFEA 4DU1A 1TKXA 4DSEA 3AVBA 1VOKA 1CXQA 4M41A 4BE1A 4K8XA 4EP4A 4FM1A 3DRRA 1QE1A 3SUOA 3VQCA 1NKCA 4HUEA 1ASUA 3WNFA 3F9KA 3ZSWA 1JL1A 1IH7A 2KW4A 2YNIA 4CF1A 4M3XA 2ZD1A 2WONA 4KHYA 4B3OA 1U04A 1WAFA 3PO4A 4FJ9A 3NDKA 3G0ZA 3P83D 4FXDA 3SUQA 1PZDA 5J2PA 2HHVA 2P1JA 3RR7A 2IC3A 3DLBA 3FFIA 1D3UA 1HPZA 5DK5A 3KLHA 3RMDA 1IG9A 1UWBA 2XY8A 5HP1A 3KD1E 3VA0A 4EZ6A 1NK8A 2MJ7A 4XIUA 4HHTA 1JLQA 4CEOA 3IAYA 2RKIA 3DRPA 1QN4A 4AHTA 1KLMA 1SKRA 1LWEA 2KTQA 1VSLA 4ID5A 2BE2A 4W5RA 1C9BB 4PWDA 3VQ6A 4ICLA 3S3MA 3OYNA 2RN2A 2Z1GA 1LAVA 4I2PA 1NOYA 4KAZA 3VQQA 3OC3C 3ISNC 3ZT0A 1RTJA 1TKZA 3DLRA 4DTMA 4KI4A 1C6VA 5CYMA 4B08A 3V9WA 4DU4A 4DSJA 3VN5A 4Z4EA 2YKMA 4FK4A 1B9KA 1VRTA 4C8KA 1D8YA 4CK3A 4OPJA 3NGZA 2JLEA 1S9EA 1WSFA 3MEEA 4CJ3A 3OVNA 1QTMA 3H1ZA 2HHQA 4N41A 3O4QA 1YVUA 1ASWA 1RILA 3OYJA 3NF9A 3D45A 4FVMA 3VQ4A 4BACA 4YNQA 4DTUA 1TAQA 4FJ7A 2XY6A 3NF6A 2KFZA 1LW2A 1J5OA 1IKYA 5JS1A 4CGGA 1QN5A 4B9TA 4FJXA 4Z4GA 3ZT4A 4DU3A 3DLHA 3CQ8A 1VSJA 1TBAB 3QO9A 1K6YA 1KVBA 4N5SA 1WSHA 4CE9A 1NK0A 3ALYA 4CJSA 1D5AA 4PQUA 4JRQA 3L2RA 3WNHA 4FJLA 4KTWA 4I2QA 2E6MA 2IS3A 2OPSA 4HCCA 3DYAA 3KJVA 3TAEA 2KFNA 1S6QA 1IKWA 3HXMA 1WSIA 5J1EA 1AISA 3SQ0A 4CGJA 1XI1A 1W9HA 3S3NA 1TK8A 2BGGA 1BQMA 3AA2A 3ZSOA 3RMCA 3ZT3A 4CK1A 5FDLA 1X9WA 1NJZA 4KHSA 1LWFA 4FLYA 4M3RA 4CF2A 4NCBA 4LD0A 4CF8A 3KK1A 2HHUA 1BCMA 3LP0A 3AVFA 4J2BA 3O3FA 3NF7A 1SL2A 1QN9A 3KLIA 4Z0UA 1YTAA 3HS9A 3KIOA 3AVAA 2E4LA 1C0MA 1REVA 2D5RA 2FBVA 1UOCA 3NHGA 4F3OA 3K5NA 4CEBA 3AO2A 3AVHA 4CGDA 1QSYA 2EHGA 3G10A 1C1BA 4IDKA 4BDYA 3UIQA 1VSKA 4L8RB 5CYQA 4CFBA 4BWMA 4FJ8A 2B4JA 3KTQA 1BHLA 2X74A 4ELUA 3JYTA 4KREA 3AVJA 2QK9A 1ZBFA 3AO3A 5KGXA 1QNAA 4JLHA 4UQGA 3V9SA 3BGRA 1NJXA 4DQSA 1HYVA 1IKVA 2HNDA 2Q3SA 1A5WA 3TANA 4J2AA 3KLFA 1IKXA 1RT2A 3RRGA 3HPGA 3V6DA 1W80A 4CFAA 2IDOA 4AILC 4FJNA 4FJMA 3MECA 2G30A 4N76A 3K58A 2VWKA 2BDPA 1QNEA 1BL3A 1EXQA 3AO5A 4BWJA 3KLEA 1EX4A 3QERA 1RT3A 3OS0A 3SCXA 1KFSA 4CEEA 3MXIA 2NUBA 2VG5A 1PCZA 2OPRA 3HVTA 4DG1A 1WNSA 3VQ8A 1C0TA 2E6LA 3OYLA 3HT3A 3L8BA 1QTSA 3QNOA 1TVRA 2OZMA 3L2VA 1S6PA 1RBSA 2OPQA 5J2NA 4W5QA 4OKEA 4M45A 4E7HA 1NK5A 4C8LA 4ROCB 5I3UA 3QEVA 1ZBIA 3VQAA 4DTNA 1O1WA 4KHNA 2XY7A 1Q8IA 5HRRA 4AH9A 1NK6A 2G8VA 4R5PA 4E1NA 2P5OA 4EZ9A 2AJQA 3OJUA 3HS8A 1BISA 1BQNA 4KHUA 4FM2A 1VSFA 4CK2A 3OJSA 4ELVA 4FW2A 3BDPA 3PUFA 4O55A 1GOCA 4O0IA 5CZ2A 4AHVA 1S1VA 4DTRA 1WSJA 3V9UA 4FLZA 3VQBA 2YKNA 2A1RA 1X9MA 4CEZA 2OYQA 3NH0A 3SQ2A 4CJQA 2ITGA 2VJ0A 4CJPA 3P5JA 1Z25A 1EETA 3C95A 5I42A 1NKBA 4OPKA 1X9SA 3LPTA 3SPZA 3VQDA 1NOZA 4DTJA 1RTHA 2LSNA 4FLVA 4DTSA 1RTDA 3EY1A 4AHCA 1A5VA 3LPUA 4CF9A 4B0AA 1RDAA 4LSLA 3OS1A 1KYFA 3LDSA 4W5NA 5HLFA 4ELTA 3KKRA 1KVCA 3P1GA 3NH1A 1UA1A 4H4MA 3NGYA 3K57A 1L3VA 1RBTA 3SV3A 2OZSA 1MP9A 3LALA 4GVMA 2OA8A 4Z4FA 3EZ5A 2JGUA 4CGHA 4DSKA 4KV8A 3SI6A 4GMJB 4O44A 4B9SA 1QNCA 1QS4A 4CHNA 4F8RA 1YTBA 2GV9A 4FK2A 4B9NA 4QAGA 1RTIA 4OVLA 4HCBA 3DLEA 3OYMA 4DLEA 3LP3A 1RNHA 4W5TA 1HNIA 3AVNA 3S9HA 1UAXA 4YFUA 4QCLA 4E1MA 1EKEA 4CHOA 4OGCA 3VQ7A 4CJWA 4B9MA 2RPIA 3VQPA 3AV9A 4J2EA 3IRXA 3QIOA 4CHQA 4FLWA 1NK4A 1DTTA 1NVPA 3L2UA 2PZSA 2HHXA 5J2QA 4H8KA 1T03A 5SWMA 1B9DA 3MEDA 1SKSA 4F4KA 4LSNA 1JLFA 4CJVA 2HHSA 4E7KA 3PX4A 5IYDP 4KPYA 3ULDA 4M3WA 2R7YA 3OYCA 3KK2A 3SUNA 5KGWA 1TK5A 4KRFA 3HM9A 1X1PA 4FJKA 2OPPA 2DFFA 2D0CA 3RR8A 3RWUA 1VOLB 1FXXA 1VSDA 4JS4A 4ID1A 1ZBLA 4CGIA 1R4XA 1XHZA 3V81A 1BCOA 3DI6A 4MQ3A 4KB1A 4BDZA 4DSFA 2VG6A 4F2RA 3ZSQA 3HJFA 1KLNA 1WLJA 4KTZA 4CESA 3OYHA 3SZ2A 5DMRA 4CFDA 2ZE2A 3L2WA 3V9XA 4DTXA 4DFMA 3D0PA 3SV4A 4RW6A 4M42A 4DTOA 3OCIA 2HNZA 1YT3A 4DFJA 3TWHA 1U49A 4DWIA 4OLBA 1TL1A 2P51A 3K5OA 3HSTB 1LV5A 4NCAA 4Q0BA 5E41A 4I9QA 1ITGA 1NH2A 1JLBA 1VK0A 2B5JA 3M8QA 1S1XA 4CFCA 3MAQA 1HJRA 1S1TA 4CHYA 4DF8A 3SNNA 5D3GA 2QKBA 2YNGA 1TAUA 3CM6A 4CEQA 2D0AA 1RDDA 1L5UA 2O4IA 4AHSA 1MU2A 3IS9A 4KO0A 3H08A 1TL3A 3DOKA 2XHBA 4DQQA 1G15A 1WSGA 4I9LA 1RBRA 4C8MA 4FZXC 3U3YA 4FK0A 3AO4A 3AVGA 1B92A 1LAWA 3B6PA 2QKKA 3K2PA 1T05A 1KY6A 1YTUA 1E42A 4FW1A 3U6FA 1CDWA 1FK9A 4AHUA 5K14A 5CY4A 3OYEA 4KTQA 1NJYA 3VQEA 4FLXA 1JLCA 3DRSA 2W42A 3OYIA 3OYKA 3AVLA 5C24A 1VSMA 1JXBA 3HVRA 1D9FA 4F2SA 2ETJA 4ZHRA 3LANA 1WSEA 1RBVA 3L2QA 4CJEA 4JRPA 1RT1A 3V1RA 3TAFA 4CERA 1RT4A 2EX3A 1VSIA 5FRNA 3QEXA 3SQ1A 1NJWA 2F8SA 4CEAA 3QEWA 2DTUA 4CGFA 1FKOA 4OGEA 1TK0A 4O0JA 2HHTA 1NKEA 1CXUA 2HB5A 2IV8A 3DLGA 1RM1A 3AVKA 1BIUA 1JLEA 5HRNA 3KK3A 2KZZA 4B9LA 3K5MA 3LZJA 4E89A 4B9UA 1BI4A 2YHAA 1UA0A 3QESA 2FBTA 2VG7A 3T19A 1R0AA 1N5YA 4DQIA 1HYZA 1DTQA 1XHXA 3O4NA 4FLTA 3I0RA 3THVA 1HQUA 1JFIC 3V4IA 4M3YA 4RW4A 3AA3A 1S1WA 1A5XA 2Z8UA 3HPHA 3M8SA 3CYMA 1JKHA 4RODB 2FBYA 3NAEA 3DMJA 4BE2A 4DS4A 5CZ1A 1VSEA 1KSPA 2YNFA 3L3UA 3ZT1A 4Z4CA 4LY7A 1TBPA 4MFBA 3U3GA 4E0DA 3V9ZA 1KY7A 4DFKA 4HUGA 1RCHA 3CFOA 4JS5A 4ROEB 4NCGA 3AVMA 3HP6A 1TKTA 4IFYA 4RG8A 1QN8A 1TGHA 3CM5A 3NGIA 1WAJA 2HW3A 3JSMA 3OYBA 1Z26A 3AA5X 3HL8A 5HBMA 1J54A 1JLGA 2YHBA 4GW6A 3TR8A 4DQRA 3OYGA 4ZTFA 1JXEA 4E3SA 4CJFA 1TKDA 2P5GA 3RTVA 4FLUA 1QQCA 4NYNA 4BE0A 3KLGA 3ITHA 5KRTA 2YV0X 1SL1A 1N6QA 1HYSA 3I8DA 1RDCA 3AVCA 2KZMA 3C6UA 3V1QA 3KKSA 3TI0A 5IYCP 1NK7A 1QHTA 5C25A 5IYBP 4FZZA 3DLKA 2G8FA 3A2FA 3M8RA 3QLHA 4E7IA 4PY5A 3RRHA 1CLQA 1S9GA 3LP1A 4LH4A 1QSLA 4QOZB 4IG0A 4B8CA 1SV5A 3VQ5A 1SL0A 1BGXT 2PYJA
chains in the Genus database with same CATH superfamily
3LAKA 1CZBA 1XWLA 4KI6A 5ADXA 3L4IA 2QXFA 2FC0A 2IGIA 3CIPA 1KVAA 3OY9A 4CBWA 4FJHA 2P9NA 2HVIA 4CJ4A 4I7FA 2I7NA 4HVJA 1T8EA 2Z1JA 3NF8A 2Q31A 4FOIA 3BF1A 3ZCMA 4Y1DA 4B1WB 1IBKK 3LAMA 3OH6A 3V1OA 4L3QA 1X3NA 4D7QA 2A40A 2NOBA 3MWPA 4LH5A 2Z1IA 1GLAG 2G8UA 4FCYA 1NU0A 5GIOA 2HBLA 2ZQBA 1BG3A 4OKKA 3TARA 5BR9A 5AJ3K 1KFDA 3VGMA 4A59A 1RT6A 2QW9A 3O5BA 5FRMA 4NLBA 5HROA 4O5BA 3VF6A 3C0BA 3DM2A 5LY3A 1T7PA 3IG1A 3K9KA 1BDGA 2P9KB 1S5JA 4DR2K 2E2NA 5C42A 4FYDA 4PL8A 1U45A 4JI7K 4PL7A 1QNBA 4R79A 4A2BA 3FZMA 2HNYA 2O8CA 4CJTA 4B9VA 3ZSVA 4CW7B 3QIPA 3U9DA 3QNNA 4CJRA 5C10A 3E9LA 2FSNA 3PSFA 1C0UA 4FM0A 3SQ4A 1NK9A 1SS6A 2V52B 1XMOK 2DY4A 1I39A 2HBKA 2HHWA 5BRHA 4CHZA 4JYAK 1Q86O 1ILYA 2G8HA 1J9AA 5HL7L 4CCHA 4HTLA 4IKFA 4Q5VA 1HNXK 1N39A 1L3TA 2Y1IA 3J8AA 3JS6A 1ZXOA 5GAGP 4KFBA 1SKWA 1OH8A 4OJRA 3HYFA 2A41A 3LWMA 4FJJA 4K8ZA 4C1NI 4OKJA 3TAQA 1NGFA 1BOTO 3NCIA 3QEPA 1NGEA 1WB9A 1QSSA 3CCSN 2FBXA 1RT5A 1TKXA 4B3RK 3M1FA 4CVNE 2GWKA 3OBYA 4JK7A 3UKRA 3HM8A 3WNFA 2NOHA 3F9KA 1JL1A 3G6EN 3PO4A 1WAFA 4RTFD 4JI4K 2Q2RA 3P83D 2VWBA 1E4FT 3EAYA 3RR7A 2VQEK 3FFIA 4A2AA 3CJBA 3R9PA 1UWBA 2XY8A 1YXQA 5HP1A 4EZ6A 4HHTA 1JLQA 4FWSA 3DRPA 3U4LA 1VSLA 3O6WA 1R59O 5AQMA 4BGAA 4C7PA 3N4PA 4PWDA 2IVPA 2RN2A 1OH5A 4KAZA 3VQQA 2AP1A 4FOEA 1TKZA 3L6QA 3V9WA 4FK4A 2HMPA 3KZBA 4CK3A 4N41A 3O4QA 2R5XA 1RILA 4Q11A 4H03B 3GDQA 4GV3A 1TAQA 3NF6A 4H5NA 1J5OA 1IKYA 4CGGA 4B9TA 3H45C 4DU3A 4EAGA 1S3XA 1VSJA 3QO9A 3EZWA 1Y64A 1D5AA 3WNHA 4WX8A 5AQXA 4I2QA 2E6MA 2IS3A 2OPSA 3DYAA 1U2VA 2O8EB 1NMNA 5AZIB 1WSIA 4BR2A 5J1EA 4ISGA 4CD3A 5KQ8A 2OTJN 4EAKA 1TK8A 3MX5A 2P9IB 3ZSOA 4CK1A 4IZ9A 2JOIA 2NNWA 4CF2A 4CF8A 3KK1A 3CERA 4YOTA 3AVFA 4J2BA 4YOWA 3F0ZA 4O8KA 4NLCA 4CZFA 3CMAN 2NZTA 3KIOA 4JKEA 2D5RA 5BREA 1UOCA 3NHGA 4F3OA 1IG8A 4CEBA 3FZLA 4CGDA 4WQ5A 1LOTB 1C1BA 3KK7A 4BDYA 1VSKA 4L8RB 5IT9O 4CFBA 3KHYA 1BHLA 2QM1A 2X74A 4KREA 1HJOA 3TSUA 1JDYA 4B3TK 4DV7K 4JLHA 3ATVA 4BRGA 4DQSA 4J2AA 2Q3SA 3VEXA 3V6DA 2V8QA 4MO5A 2Q0RA 3VF2A 3QMLA 1QNEA 1EX4A 4CEEA 1PCZA 4JHDB 3OYLA 3ZLJA 4DKWA 4CD1A 3L2VA 4DV5K 1K8KA 2FF6A 1RBSA 5J2NA 2E1ZA 3IKMA 4IDHA 3O9RA 5AQVA 5GAHP 1HX1A 1O1WA 3UKUB 4CBXA 5HRRA 4AH9A 1ATSA 3HS8A 1BQNA 4E1JA 1HU0A 2QXLA 1GOCA 5CZ2A 2CGJA 1X9MA 1IBLK 3AGRA 2OYQA 4GVEA 4LF6K 2ITGA 1IJJA 1Z25A 5I42A 2DPNA 3SPZA 5BR8K 3VQDA 2NRTA 1RTHA 2LSNA 4FLVA 3EY1A 4DV4K 1LWWA 3LPUA 4W5NA 2JWKA 1RDAA 3OS1A 3LDSA 5HLFA 1OVQA 4YOXA 1UA1A 1DGKN 3NGYA 4A5BA 1CZAN 2E5LK 3SV3A 2OZSA 4GVMA 5AFUA 2P9LA 2FKMX 1QNCA 4F8RA 1YTBA 2GV9A 1GLBG 4FK2A 4B9NA 4OVLA 3CWUA 3OYMA 4DLEA 4W5TA 3AAQA 4OGCA 4NO7A 4CJWA 4B9MA 1W97L 3QIOA 3HSCA 2P9PB 4CHQA 1NK4A 2D0PA 1MA9B 2PZSA 3L2UA 1W2BM 2HHXA 2QWMA 1VQON 1T03A 3DXKA 1B9DA 5SWMA 1SKSA 5M1QA 3D7EO 3D2FA 4M3WA 4KRFA 5KGWA 2YHWA 3W0LA 1X1PA 2OPPA 3RR8A 3M5RA 1DEJA 1VSDA 3FZKA 1KAZA 4JS4A 4KHNA 1BCOA 2ASPA 4FWKA 1T6CA 1X9JA 5KPRA 3HJFA 5F9CA 4DV2K 4DFMA 5DMRA 4CFDA 3L2WA 4C1NK 3SV4A 1YQLA 4DTOA 2D1KA 3TWHA 3GE1A 3CPWM 2W41A 3HSTB 4NCAA 1H1VA 5AQYA 1VQ4N 1HJRA 2ASOA 2FKFA 1TAUA 1IV0A 2O8BA 2E8AA 1OH6A 2D0AA 1RDDA 3CVTA 1MU2A 3H08A 1TL3A 2VGMA 3DOKA 1G15A 4C8MA 3AVGA 2P9SB 1B92A 1LAWA 3WXJA 2QKKA 2NOFA 1E42A 1P8ZA 2QWOA 3VQEA 3DRSA 4ISFA 2W42A 4IJNA 3JAMO 2O8BB 1EBMA 1JXBA 3HVRA 2ETJA 3LANA 1NBWA 3HI0A 3L2QA 4CJEA 3V1RA 1VSIA 1VAZA 3QEXA 5FRNA 2F8SA 5BMNA 3SMPA 4DULA 3OSMA 1KQSM 1CXUA 5HRNA 2IV8A 4WXAA 1JLEA 3AVKA 2KZZA 3VGKA 4E89A 3QESA 2VG7A 3T19A 1R0AA 1XHXA 3QFUA 4F9OA 1HQUA 3ID6A 4JI3K 3V4IA 1S1WA 3M8SA 3CYMA 3M6GA 3NAEA 3H1VX 3OSTA 2YNFA 4Z4CA 2UUAK 3R3LA 1TBPA 4A61A 1NGCA 3IUCA 4ROEB 4BRMA 4NCGA 5JLHA 1QHAA 3CM5A 5CR4A 3NGIA 1WAJA 2HW3A 3MN5A 3JSMA 3OYBA 5HBMA 4GW6A 1JXEA 1TKDA 1Z6RA 1SL1A 4WQ5C 3VTIA 3C6UA 3KKSA 5IYCP 1NK7A 1QHTA 4JNEA 2E2PA 3CCRN 4FZZA 3A2FA 3M8RA 1DIZA 3DJCA 2Y8QA 4JI1K 3NMUA 4BE1A 4IFEA 5EX5A 4DSIA 1NGMA 1U4BA 4Y1CA 5TKWA 4OLAA 2HMIA 1W0HA 3ASMA 3O8MA 4GKKK 2BH1A 3EO3A 1IBMK 5AQJA 2FUVA 1BI4B 1ZBUA 5ADXH 3MWTA 2I5JA 3O3HA 3KD5E 3PO5A 3AAPA 4H0VB 3ZEUB 5M1FA 1QQMA 3NFAA 1TGOA 5KTQA 1QTPA 1BA1A 5FROA 4M3ZA 4DSLA 1IO2A 3QEIA 2HL9A 4EP5A 1YVNA 4M3TA 3EE8A 4RW9A 2G8IA 1HR0K 2HVHA 1B9FA 1KTQA 4RWTA 1L3UA 4CJKA 4CJUA 3SMSA 3C6TA 3UKUA 4DUYK 4DS5A 4CHPA 4E7LA 4WE1A 4BC2A 2OOXA 3NE6A 1OH7A 1YJWN 2WTUA 4PKGA 5EXWA 4DLGA 1VTOA 3HZ6A 2GBZA 4KH6A 3VOVA 1BO5O 1DKGD 3LZIA 2D0OA 4N56A 3K59A 5EVZA 2IV9A 4CJ5A 3CWSA 4ZTJA 3M8PA 4PKIA 4H5VA 2Z1HA 3CWAA 2NOEA 2UXDK 1ATNA 3SJJA 5J2MA 4B1YB 5KPZA 3HPOA 2X6NA 4IG3A 1NGDA 3ZX2A 2G8WA 3RMAA 2O4GA 2QI2A 2X6SA 3NH2A 3WEEA 4DQ8A 1Q9XA 2CGKA 1T6AA 4BGBA 3E9PA 3BUZB 1HRHA 3LP2A 4DTPA 3O9TA 1M3HA 2XRIA 5HRSA 5DM7L 4GKJK 2V7ZA 4DMNA 1XNQK 2HL8A 2P9NB 5I9EB 3K5LA 1UT4A 3ENHA 3PX0A 1VSHA 3TAMA 2HSTA 4QS7A 1D9DA 4FPBA 3ZSYA 5BMPA 4WZSD 1GOAA 5LJVA 3TABA 4EAJA 2QLVA 4WYBA 3PMGA 3I56N 3CFPA 4Z94A 4W5OA 3OS2A 5JMVD 2F96A 1V4SA 4HTUA 4M63C 1YITN 1GOBA 1LWCA 2GELA 4B1UB 1YI2N 2F8TA 1P90A 1RT7A 3OH9A 4QS9A 5BPNA 4DU1A 1VOKA 1CXQA 3MCPA 1N34K 4K8XA 1QZ6A 2PFUA 4EP4A 3CI5A 1QQNA 3DRRA 2YA3A 4WCEL 5AQWA 2GUPA 4HUEA 2FSKA 3ZSWA 4KHYA 2Q0UA 4CF1A 3THYA 2O8FB 3G71N 4BVOA 1ESVA 3VEZA 4FJ9A 4K0KK 1PZDA 1NM1A 2NLXA 3THWB 3A8YA 3CHWA 1XMQK 5M1OA 5JICA 2IC3A 2F9WA 5DK5A 1J3MA 3RMDA 2BUPA 1IG9A 1PCMX 4X65K 5KL0A 4FWQA 4BRFA 3VA0A 3VESA 4XIUA 4X64K 3U8XA 4Y0WA 4EHUA 1KLMA 3RSEB 4W5RA 4JN4A 3VQ6A 3LDLA 4WFBL 3CD6N 1NOYA 1LAVA 3ISNC 2ZJRL 3ZT0A 4KI4A 1C47A 1YUWA 4DSJA 3DAWA 1JCEA 3VGLA 2ITMA 3ENOC 2GTDA 1KXPA 1S9EA 4CJ3A 2JHJA 3OVNA 3I55N 3WT0A 1YVUA 1ASWA 3BEXA 3K0SA 2FSJA 3D45A 3VQ4A 1Z05A 4FJ7A 2KFZA 1LW2A 4FJXA 4BRNA 3DLHA 1TBAB 1KVBA 3N4QA 1WSHA 4BC4A 4EIAA 4EJZA 4JRQA 4FSVA 4FJLA 4I8OA 4KTWA 3KJVA 1VQLN 3J80O 4IO8A 1AISA 4JKAA 3SQ0A 3CW7A 2CH5A 4LC9B 5FPNA 2OANA 4B3SK 3F2KA 3ZT3A 1NJZA 1LWFA 4CZGA 4M3RA 4FLYA 4FPAA 4MDBA 4CI6A 2HHUA 5AZJA 3G4SN 3OGDA 3NA5A 4X62K 4Z0UA 1M5Q1 3JXUA 3DXMB 3AO2A 3AVHA 1QSYA 3G10A 5AQHA 3UIQA 4IDKA 1N32K 5CYQA 3SAGA 3CJCA 5BPMA 4FJ8A 3W3DA 4QS8A 3NVKA 4BRPA 5AQZA 2NRZA 4RCHA 1HYVA 1RT2A 3RRGA 4CFAA 5KQDA 2CH6A 3HOTA 2G30A 3VENA 4N76A 1P5GX 2VWKA 3A5OC 4BWJA 3QERA 1RT3A 2H5AX 3CQXA 1KFSA 2NUBA 4JKFA 3PY8A 1C0TA 4OX9K 2OPQA 3BZCA 1YAGA 5AQTA 1QQOA 1Q9UA 4OKEA 1M1KO 1E3MA 4C8LA 2ASMA 3S41A 3THXB 4H5RA 5I3UA 3VQAA 1BWFO 3TPQA 1WBDA 2P5OA 2G8VA 4OPHA 4EZ9A 3SLCA 2AJQA 3WXKA 3OJUA 2VGNA 4ELVA 4FW2A 3BDPA 4O55A 3OSEA 2FXUA 4O0IA 3P38A 4K42A 4AHVA 4DV1K 4DTRA 1WSJA 4C23A 3I3WA 3VQBA 4FLZA 4BR0A 1Q82O 4CEZA 3SQ2A 1YIJN 4O8UA 1EETA 1NKBA 1K9MO 1T44A 4ILJA 1NOZA 3O1BA 4DTJA 2OCEA 4AHCA 1VKLA 1XSZA 3T1HK 4ELTA 3KKRA 1RFQA 4XH1A 3K57A 4BG9A 2OOYA 2P9IA 1RBTA 1MP9A 3D2FB 1RDWX 3EZ5A 4BRLA 4IXCA 5KPTA 4DSKA 1LWVA 5AZIA 3D6RA 1QS4A 4CHNA 1W7AA 1M3QA 3DLEA 3ZX3A 3RVCA 2E2OA 1HNIA 4E1MA 1EKEA 4CHOA 3IRXA 4CFFA 5EPCA 1NVPA 5J2QA 4H8KA 3F10A 4IOXA 1JLFA 3WEEB 3CVSA 4OPAA 3MDQA 4CJVA 4KPYA 4CZEA 1P5DX 5GINA 2WC9A 3RWUA 1FXXA 4CGIA 3DI6A 4KB1A 2VG6A 3Q7BA 5C2DA 1KLNA 4KTZA 5A2QO 3ENCA 2W40A 1YHQN 5AFUH 4OO1J 3OCIA 4GNIA 3THXA 1U49A 4DWIA 3F5TA 4OLBA 4WF9L 1LV5A 4YOVA 1JLBA 1N8RO 2FF3B 1S1TA 3SNNA 4LF5K 2YNGA 3ZYYX 4LFBK 4EAIA 3BKQX 3CCLN 5FPEA 4KO0A 4DQQA 5AQQA 3U9ZA 3A5MC 3AARA 1T05A 4YHHK 3K9JA 1YTUA 1CDWA 1FK9A 4AHUA 5K14A 5CY4A 4KHPK 4H5TA 3ZX0A 1JLCA 4FLXA 2EHBD 3OYKA 3AVLA 1VSMA 4F2SA 3DPTA 1RBVA 3VTHA 4TPSA 2HZSA 1RT1A 3P4IA 4BR4A 3TAFA 5LJWA 2EX3A 1NJWA 1S22A 1FKOA 4OGEA 3EKSA 2HHTA 4O0JA 2A42A 4BRIA 1LXTA 1KFIA 1BI4A 1UA0A 4FVUA 4LF9K 1N5YA 1NGHA 1HYZA 3DWLA 4V19S 5AQLA 1DTQA 1GLEG 5CE3A 1FW6A 1A5XA 2Z8UA 3HPHA 4J8FA 4ISEA 4BE2A 4DS4A 5CZ1A 3T7ZA 4MDAA 5MLCQ 4LY7A 3V9ZA 4DFKA 3CCQN 4LF4K 1VQ8N 3CFOA 1FN7A 2NWVA 4B1XB 1N3AA 5AQFA 1TKTA 1QN8A 3D2EA 1Z26A 3HL8A 1J54A 2YHBA 3TR8A 4DQRA 2H4LX 3OYGA 4E3SA 1K2YX 4CJFA 1WUAA 4NYNA 3VF4A 3J81O 1N6QA 4A57A 5C12A 3MX2A 3ID8A 3VERA 4DV3K 2G8FA 4E7IA 4PY5A 4FWPA 3RRHA 2P9KA 1N33K 3LP1A 2E2QA 4IG0A 4JAXA 4O5FA 1SL0A 3CC4N 3EL2A 2GUIA 4K41A 3I0SA 4DR3K 1J53A 1ZBSA 3O3GA 2YI1A 4O4GA 2KQ2A 4NYFA 1UL7A 2VWJA 3AA4A 3VPZA 3F73A 1UT7A 4FJIA 1SUQA 1V4TA 4B1ZA 1QN7A 1EP4A 2NLVA 3G25A 3MN7A 3CC7N 4B8AB 1HKBA 1KRPA 3LM9A 4E7JA 1TUYA 2IAJA 2O8FA 2WOMA 1D4XA 4NXMK 2I5WA 4XH5A 1Q9YA 2FGTA 1YTFA 3E01A 3TTDA 5KI6A 4PUOA 4FZYA 3TE5A 3P39A 2A1SA 1VQ7N 3B6OA 3BZKA 2IOCA 4J2DA 1HQEA 3M3ZA 5CHIA 3AO1A 2DKAA 5JLFA 3SYZA 3ZSRA 3ZSXA 4KHQA 1VRUA 4ILGB 1K73O 5EU7A 5JS2A 4KH4A 3WNEA 1XC9A 1BIZA 4H4OA 3ATUA 2Y1JA 1I3AA 1HMVA 5GIPA 2QWQA 2UU9K 1JCFA 3OYDA 1JLAA 1RDBA 1S1UA 4IBNA 3DXMA 3GG4A 3Q7CA 4CIGA 4DHYA 1WBBA 1KYDA 4MRQA 1DLOA 1JL2A 2X78A 1L3SA 4JKGB 2V9JA 4AQYK 2NRHA 5C2FA 4EALA 2ZM6K 1QN3A 1U47A 3HP9A 4JKGA 5HRPA 2JPIA 3C65A 3FFKB 1Q7YO 2G8KA 3H46O 2YNHA 5KRSA 2HBJA 4IFVA 4RW8A 1HNWK 1KYUA 3DLLL 4BDPA 3R8EA 4BRDA 3AVIA 1QZ5A 3ULEB 2PYLA 3S3OA 4NB4A 3SPYA 1FKPA 2DFEA 2KLAA 1ATRA 2HOEA 3FGUA 4M41A 4EAHD 2WFBA 4FM1A 1QE1A 3C6AA 3SUOA 1MWKA 1ASUA 1IH7A 2KW4A 2YNIA 2ZJQL 4M3XA 2ZD1A 2NRVA 1U04A 2W6LA 3NDKA 3G0ZA 1M90O 2P1JA 4FWMA 3DLBA 3IFRA 1MWMA 3CXCM 1KFQA 5AQIA 1E4GT 2MJ7A 5AQOA 1NK8A 5M1KA 1HLUA 3IAYA 1QN4A 1J5EK 1T6DA 1SKRA 1LWEA 4LF7K 2HKPA 4DR7K 1C9BB 4ICLA 4M7XA 2Z1GA 2Y8LA 1RTJA 4DTMA 4DU4A 3VN5A 4Z4EA 4OPJA 3NGZA 4B3MK 4CZJA 1K35A 3H1ZA 4CZHA 5LMUK 4BR9A 3NF9A 4DTUA 4BACA 3L4QA 4KH5A 2UXCK 4JI8K 4BQLA 5JS1A 1BA0A 3CQYA 3AGKA 3ZT4A 3C7NA 1C0FA 2VCPA 3ALYA 4CJSA 3LDOA 4CZLA 5F0XA 3L2RA 2A5XA 5AQUA 4BRKA 2KFNA 1S6QA 4B1VA 5BRDA 4H0YB 3QFPA 1QVGM 4CGJA 1VQKN 3SBTA 1W9HA 3HRGA 3S3NA 2BGGA 3AA2A 4MLHA 3RMCA 1X9WA 5FDLA 4NCBA 4LD0A 3PLAA 4BRCA 1NG9A 3LP0A 4CJ7A 3O3FA 3NF7A 1SL2A 1QN9A 1YTAA 4DV0K 3QDKA 3AVAA 3VETA 1C0MA 1REVA 2FBVA 3OA9A 4JK8A 4G9ZA 3KWIA 4PKHA 2EHGA 3D7QA 1NMDA 3WXIA 1U6ZA 3HBTA 4BWMA 4GV6A 3AVJA 2QK9A 3VEOA 2WUSA 5KGXA 2AA4A 4UQGA 1KC8O 4H0OA 2E1YA 3V9SA 3BGRA 4XH4A 1NJXA 3A5LC 1IKVA 5FPMA 3TANA 2BTFA 2KHOA 3EKUA 1KO9A 3IH7A 1VQ6N 4AILC 3MECA 2F9TA 1NGIA 3H3OB 3K58A 1KAXA 3MMVA 1BL3A 3AO5A 2IVNA 3SCXA 2A6AA 3CJAA 1NKEA 3VQ8A 2E6LA 3HT3A 1QTSA 5AN4A 1TVRA 1S6PA 3P31A 4W5QA 4E7HA 4M45A 2QRCA 4U67L 5GADP 4ROCB 4DV6K 1ZBIA 3I33A 4H0XB 4DTNA 1EO1A 3CJ9A 2XY7A 3E1YA 1Q8IA 1NGGA 1NGAA 1BISA 4FM2A 1VSFA 4CK2A 3OJSA 5GAEP 4UY8O 1S1VA 3V9UA 4BRQA 3TDHA 5JVHL 4CJPA 3P5JA 3C95A 4OPKA 5FPDA 3RSEA 1X9SA 3LPTA 4DTSA 1RTDA 4H0PA 1A5VA 2I7PA 4B0AA 4CF9A 4EHTA 4BROA 3CMEN 3TSPA 1TUUA 5AZJB 4IL8A 3FZFA 3NH1A 1YQRA 3ULEA 1GLFO 1C0GA 4FL9A 1L3VA 2Q1NA 4Z4FA 3SBGA 5F1XA 2CGLA 4CGHA 3I0WA 4BC5A 1FJGK 4KV8A 2P9LB 2NRRA 4QAGA 1RTIA 4IWVA 4QG5A 1RNHA 4NXNK 3AVNA 3ENOA 4JD2B 3PIOL 4I6MA 4QCLA 3VQ7A 2RPIA 3A0IX 3ZETA 4AF1A 4FLWA 2ZGZA 4MO4A 1DTTA 3O08A 2DKDA 3MEDA 3SJHA 4F4KA 3KTUA 1PVSA 4E7KA 5IYDP 2R7YA 1TK5A 4BG8A 2F7TA 3HM9A 4FJKA 3HTVA 1VOLB 4BJUA 1ZBLA 1R4XA 2ZJPL 4BDZA 4DSFA 1S72N 1G99A 1WLJA 4CESA 4DTXA 3SZ2A 4HJHA 3D0PA 2HNZA 4FWRA 1YT3A 4WFNL 4DFJA 3BF3A 1TL1A 2P51A 4Q0BA 2O8EA 3RSMA 4FWOA 4I9QA 5BN9A 1NH2A 1VK0A 3M8QA 3MAQA 1S1XA 2Z0FA 2QKBA 4IOAL 1YQKA 1NWKA 1L5UA 3VEWA 3THWA 2O4IA 4AM6A 2XHBA 4I9LA 2GX9A 4FZXC 4FK0A 3AO4A 3GBTA 3B6PA 4JV5K 3K2PA 1KY6A 4FWNA 1VQ9N 2P9SA 5BRFA 4KTQA 3OYEA 3CPEA 5HOOA 3SAFA 5E26A 1D9FA 1GLCG 3CJ1A 2PAVA 4CERA 1RT4A 3QEWA 4CGFA 1VHXA 1TK0A 1QVFM 2HB5A 3DLGA 4FWLA 3LM2A 4B9LA 3WQTA 3VEYA 2YHAA 1GLJO 1GLLO 1NNEA 3O4NA 3N89A 2WBNA 3I0RA 3TTCA 3WQUA 1JFIC 3THVA 2QWLA 3OTOK 1BUPA 3T1YK 3DMJA 2QA4N 1VSEA 1KSPA 3ZT1A 3EEQA 2PWWA 1KY7A 5IWAK 3ENBA 2QEXN 4JS5A 4DCHA 3AVMA 1NGBA 4IFYA 2IVOA 4RG8A 1TGHA 4GV9A 1OKJA 2P9PA 4I6MB 1LWYA 3AA5X 1JLGA 4YOYA 3D2EB 3LDPA 3WXLA 2P5GA 3RTVA 1VQMN 1YJNN 3KLGA 1HYSA 3I8DA 1RDCA 3CCUN 5C25A 3MCAB 5IYBP 3CCJN 3QLHA 1CLQA 3H6EA 1QSLA 4B8CA 1SV5A 3UB5A 2UYTA 2PYJA 5AR0A 3O80A 2NRWA 4TSXA 4C8NA 4FO0A 3LDQA 4DF4A 3CFRA 3RMBA 2XY5A 3SUPA 4LF8K 1WOQA 3F9MA 1U48A 2RE2A 2D0BA 3T1AA 3E9OA 4DFPA 1NGJA 1HNZK 1RBUA 4JI5K 3SK3A 3OYFA 3PX6A 2NOLA 1CZ9A 1VTLE 1ASVA 1F21A 1Q18A 2QRDA 2ZFDB 3CCVN 4WQ4A 4CJLA 3L3VA 3HK2A 2ATQA 4CZIA 3QETA 4DQPA 2RHKA 2ZGYA 3C94A 2PBDA 4JKCA 3H3NO 2NOIA 3EYZA 2HZMA 2RF2A 3VQ9A 2DFHA 4EJYA 4JKBA 4E19A 2F4VK 2H3GX 1TV6A 2ZWHA 1WN7A 4KHWA 4KB0A 2QWRA 3QBWA 4AHRA 3ZT2A 3NBPA 4N47A 2V7YA 4CIEA 1MDUB 2ZF5O 4CZMA 4A62A 4BR5A 1HNVA 5AQPA 1O13A 3PV8A 3WNGA 1VQNN 4CIFA 3OYAA 1J6ZA 5SZTA 1RDUA 2HF4A 3THYB 1ZYQA 1ZC6A 4M7YA 2V92A 1C1CA 1VQPN 5AQNA 2B6AA 3EIKA 4FJGA 4F3TA 4KKOA 4CEFA 4Z4HA 3ZSZA 4PA1A 3E66A 1Q81O 2E20A 4WQ4C 3QINA 3HO1A 1C1AA 2O8DA 3DOLA 4M3UA 1NJIO 3CCMN 4CF0A 3T3FA 1WQAA 5DM6L 5T7BA 3CG7A 1Y97A 4HUFA 5M1NA 2JWLA 3HOSA 3LWLA 1KCFA 3MXMA 2XO7A 3TAGA 4CECA 1QN6A 1LW0A 4G1QA 3TAPA 3BY5A 1ZBHA 3VA3A 3OBWA 4RW7A 3FLCO 4BR7A 4XEIA 1OVYA 1VQ5N 4Z4IA 3MEGA 2HHHK 2F7LA 4IJAA 2QREA 3TTFA 2PY5A 1U2VB 1YQMA 5LMNK 3DXKB 4CEDA 2BANA 3FZHA 3O4WA 4C8OA 4FJ5A 1WJWA 3MXJA 3NVMA 4DSEA 3AVBA 3MN6A 4DB3A 4WFAL 3ULXA 3C7NB 3VQCA 1NKCA 1EQYA 1KD1O 1RGIA 5E84A 5AQKA 2WONA 4B3OA 5HSHA 2LAEA 1DT9A 3MK6A 4FXDA 4JKDA 3SUQA 5J2PA 3FR0A 2HHVA 3J7AP 2DKCA 1D3UA 1HPZA 3KLHA 1MPGA 3KD1E 2YHYA 4A5AA 2P9UB 3C6HA 3R6MA 4CEOA 4PHTX 2RKIA 1V5SA 4AHTA 3CCEN 3C04A 4ID5A 2BE2A 4YY3K 3S3MA 3OYNA 4I2PA 2IIRA 3OC3C 2VYPA 4DR1K 3DLRA 1C6VA 5CYMA 4B08A 2YKMA 1B9KA 1BU6O 1VRTA 4C8KA 3MN9A 1D8YA 2JLEA 1WSFA 3MEEA 4U7BA 1QTMA 4B9QA 2HHQA 2Q97A 3OHRA 1KAYA 2UXBK 4JKHA 3OYJA 4ILHA 4FVMA 3PSIA 4YNQA 4DR4K 3CWTA 3BP8A 2XY6A 2FLOA 3TSQA 5BPLA 1QN5A 3WUHA 3CETA 4Z4GA 3CQ8A 1K6YA 4JHDA 5LL6Z 4N5SA 4CE9A 1NK0A 1SAZA 4PQUA 2HF3A 4GY2B 4HCCA 3KRMA 3IDHA 3TAEA 1IKWA 3HXMA 2JHNA 4IO9L 1HPMA 1XI1A 4JEPA 2V51B 1BQMA 2Q36A 4KHSA 3O1WA 4YOUA 4K25A 3O9UA 2QTDA 1BCMA 5AQSA 4CBUA 3KLIA 3T4NA 3IMXA 3QICA 4H0TB 4X66K 5C15A 3HS9A 2E4LA 3K5NA 2XHIA 1NLVA 4JI6K 2O3OA 2B4JA 3KTQA 4ELUA 3JYTA 1LCUA 2YJEA 1ZBFA 3AO3A 1QNAA 4BQZA 3CC2N 2HNDA 1A5WA 3KLFA 1IKXA 4LFCK 3HPGA 3CJ7A 1W80A 2IDOA 4FJNA 4FJMA 2BDPA 5H1SQ 1EXQA 3KLEA 4LFAK 2QWNA 4HWIA 3OS0A 3MXIA 2VG5A 5BN8A 2OPRA 3HVTA 4DG1A 1WNSA 4MLEA 3L8BA 2OZMA 3QNOA 4JI2K 3UW2A 4BRHA 5TKYA 3VMFB 1NK5A 3QEVA 2NVMA 3QBXA 2KKZA 1NK6A 4R5PA 4E1NA 4DR5K 4KHUA 3PUFA 1JCGA 3SAHA 4IEEA 1N36K 2YKNA 2A1RA 3NH0A 2NRXA 4CJQA 5JMVA 5JVGL 2VJ0A 4IOCL 3QB0A 1YJ9N 3KWGA 2J4RA 4LSLA 3DPUA 1KYFA 3UE5A 3O9SA 1JJ2M 1KVCA 3P1GA 4H5WA 4DR6K 4H4MA 1EWRA 4KBOA 3LALA 2OA8A 1HUXA 2JGUA 4EFHA 2UUCK 3SI6A 1PCJX 4GMJB 4O44A 5JN5A 4B9SA 3B8AX 3UKRB 4HCBA 3LP3A 3S9HA 3ZETB 1UAXA 4YFUA 1HKGA 1I94K 3VEVA 4JD2A 3VQPA 3AV9A 4J2EA 1EWQA 4YORA 2EWSA 3LL3A 2YX6A 4IEIA 3T69A 5B8HA 5ELZA 1EUVA 4LSNA 3H1QA 2HHSA 3PX4A 2O8DB 3EN9A 3RPJA 3O9QA 3ULDA 3SUNA 3OYCA 3KK2A 3D4VA 3AY9A 5FLXO 2DFFA 2D0CA 1SQKA 4BVPA 1TUOA 4JK9A 3PDKA 4ID1A 1XHZA 3V81A 4MQ3A 3OLPA 4F2RA 3L0QA 3ZSQA 2QR1A 3OYHA 1XUPO 2ZE2A 3V9XA 4M42A 4RW6A 3PIPL 1T3VA 3K5OA 5E41A 2UUBK 1ITGA 4BC3A 2B5JA 4K43A 4CFCA 5D3GA 4CHYA 4DF8A 4BREA 1TYQA 3CM6A 3R1XA 5M1PA 4CEQA 1HKCA 1XNRK 4AHSA 4JI0K 3IS9A 1XQSC 2VQFK 4AM7A 2A3ZA 2O8CB 1WSGA 1RBRA 3U3YA 3KVGA 2NOZA 4YDUA 3J7YP 4BY9C 3EE9A 4FW1A 5AQRA 3U6FA 1X3MA 1NJYA 4BRAA 3OYIA 1K8KB 1TYQB 5C24A 1SZ2A 4ZHRA 4CZKA 1WSEA 3FE1A 4JRPA 3GOIA 3SQ1A 3I8BA 4CEAA 2DTUA 3ZEUA 3OW2M 2E88A 1XC3A 3KK3A 1RM1A 1BIUA 5EOYA 5AQGA 2YCHA 3K5MA 3LZJA 4B9UA 3WXMB 1YF5L 2FBTA 2MZ8A 1K8AO 4DQIA 2P9UA 5EY4A 3A5NC 3J7ZO 3CF5L 3TU5A 4FLTA 2W6KA 4M3YA 4RW4A 3AA3A 2GEMA 1JKHA 4RODB 2FBYA 2D4WA 3I0XA 3L3UA 2HBMA 4MFBA 4E0DA 3U3GA 2YJFA 4DUZK 3SNSA 4HUGA 1RCHA 2GWJA 4YDUC 5F2RA 2YH5A 1GLDG 3LDNA 3HP6A 2QWPA 4ZTFA 4FLUA 1QQCA 2KTQA 4BE0A 5C0YA 3ITHA 5KRTA 2YV0X 3AVCA 2KZMA 3V1QA 3TI0A 1N3CA 3DLKA 2OTLN 3GL1A 1S9GA 4QOZB 4LH4A 1C4GA 2YHXA 3VQ5A 1BGXT 4D7RA
chains in the Genus database with same CATH topology
3LAKA 1CZBA 2GUIA 1XWLA 4DSIA 4KI6A 1NGMA 1U4BA 3I0SA 4TSXA 4Y1CA 4OLAA 2QXFA 4C8NA 1J53A 2HMIA 1W0HA 2FC0A 2IGIA 3ASMA 1KVAA 3O3GA 3OY9A 4O4GA 2KQ2A 4NYFA 4DF4A 3CFRA 3RMBA 2XY5A 4FJHA 1BI4B 3SUPA 2HVIA 2VWJA 1ZBUA 4CJ4A 3AA4A 4I7FA 2I5JA 1U48A 3O3HA 4HVJA 3KD5E 3PO5A 3F73A 2Z1JA 2D0BA 3T1AA 3NF8A 1T8EA 1UT7A 4DFPA 1RBUA 3NFAA 3OYFA 3PX6A 1TGOA 3ZCMA 2NOLA 1CZ9A 4Y1DA 1VTLE 1ASVA 1F21A 4FJIA 1SUQA 3LAMA 5KTQA 3V1OA 1QTPA 5FROA 4CJLA 3L3VA 4DSLA 4M3ZA 1QN7A 1IO2A 1EP4A 3QEIA 2ATQA 3HK2A 2NOBA 4EP5A 3QETA 4M3TA 4LH5A 4DQPA 4B8AB 4RW9A 1KRPA 2Z1IA 2G8IA 2HVHA 2G8UA 3C94A 1B9FA 1KTQA 1L3UA 4CJKA 4CJUA 4FCYA 2NOIA 3EYZA 4E7JA 2HZMA 3C6TA 2IAJA 2ZQBA 4DS5A 2RF2A 4OKKA 3VQ9A 4CHPA 4E7LA 2WOMA 3TARA 2DFHA 4EJYA 4WE1A 3NE6A 2I5WA 4E19A 1KFDA 1Q9YA 1TV6A 2FGTA 1YTFA 3E01A 1RT6A 1WN7A 5FRMA 5KI6A 4KHWA 4DLGA 1VTOA 4KB0A 4PUOA 5HROA 4FZYA 4O5BA 4AHRA 2GBZA 3ZT2A 3DM2A 3NBPA 4N47A 3LZIA 4CIEA 1T7PA 2A1SA 3IG1A 3B6OA 1HNVA 2IOCA 4J2DA 1HQEA 1S5JA 4N56A 3K59A 3PV8A 5C42A 4FYDA 3AO1A 3WNGA 1U45A 2IV9A 4CIFA 3ZSRA 3OYAA 3SYZA 1QNBA 4CJ5A 5SZTA 3ZSXA 4ZTJA 3M8PA 1ZYQA 4FJGA 4M42A 1C1CA 2HNYA 4KHQA 2B6AA 3EIKA 2NOEA 1VRUA 2Z1HA 4CJTA 3SJJA 4B9VA 5J2MA 3ZSVA 5EU7A 4F3TA 5JS2A 4KKOA 4CEFA 2X6NA 4Z4HA 4IG3A 3ZSZA 3HPOA 3QIPA 4PA1A 3WNEA 1XC9A 1BIZA 4H4OA 3QNNA 2Y1JA 4CJRA 3QINA 1I3AA 2G8WA 1HMVA 3RMAA 3HO1A 1C1AA 2O4GA 3DOLA 2X6SA 1C0UA 3NH2A 4FM0A 3SQ4A 3OYDA 1NK9A 1Q9XA 4M3UA 1JLAA 4CF0A 3T3FA 2DY4A 1I39A 1RDBA 2HHWA 1S1UA 3CG7A 4IBNA 1Y97A 4CIGA 5T7BA 1HRHA 3LP2A 4HUFA 4CHZA 4DTPA 1M3HA 3LWLA 2XRIA 5HRSA 1KCFA 1KYDA 3MXMA 1DLOA 1JL2A 2X78A 2XO7A 4DMNA 1L3SA 3TAGA 3K5LA 1UT4A 4CECA 3PX0A 1QN6A 1LW0A 4G1QA 3TAPA 1J9AA 1VSHA 3TAMA 2G8HA 4CCHA 1D9DA 1ZBHA 4IKFA 3VA3A 3ZSYA 4WZSD 1GOAA 1QN3A 4RW7A 3TABA 4Q5VA 1N39A 1U47A 1L3TA 2Y1IA 4Z4IA 3HP9A 3MEGA 4KFBA 5HRPA 1SKWA 2G8KA 4OJRA 3HYFA 3CFPA 3PY8A 4W5OA 3OS2A 2YNHA 3LWMA 4FJJA 2PY5A 5KRSA 4K8ZA 4OKJA 4IFVA 2F96A 1YQMA 4RW8A 4CEDA 4HTUA 1KYUA 1GOBA 1LWCA 2BANA 3TAQA 4BDPA 2F8TA 1RT7A 3QEPA 3NCIA 3AVIA 4C8OA 2PYLA 3S3OA 4FJ5A 3SPYA 3MXJA 1FKPA 2FBXA 1QSSA 1RT5A 2DFEA 4DU1A 1TKXA 4DSEA 3AVBA 1VOKA 1CXQA 4M41A 4BE1A 3ULXA 4K8XA 4EP4A 4FM1A 3DRRA 1QE1A 3SUOA 3VQCA 1NKCA 4HUEA 1ASUA 3WNFA 2NOHA 3F9KA 3ZSWA 1JL1A 1IH7A 2KW4A 2YNIA 4CF1A 4M3XA 2ZD1A 2WONA 4KHYA 4B3OA 1U04A 1WAFA 3PO4A 4FJ9A 2LAEA 3NDKA 3G0ZA 3P83D 4FXDA 3SUQA 1PZDA 5J2PA 2HHVA 2P1JA 3RR7A 2IC3A 3DLBA 3FFIA 1D3UA 1HPZA 5DK5A 3KLHA 3RMDA 1IG9A 1UWBA 2XY8A 5HP1A 3KD1E 3VA0A 4EZ6A 1NK8A 2MJ7A 4XIUA 4HHTA 1JLQA 4CEOA 3IAYA 2RKIA 3DRPA 1QN4A 4AHTA 1KLMA 1SKRA 1LWEA 2KTQA 1VSLA 4ID5A 2BE2A 4W5RA 1C9BB 4PWDA 3VQ6A 4ICLA 3S3MA 3OYNA 2RN2A 2Z1GA 1LAVA 4I2PA 1NOYA 4KAZA 3VQQA 3OC3C 3ISNC 3ZT0A 1RTJA 1TKZA 3DLRA 4DTMA 4KI4A 1C6VA 5CYMA 4B08A 3V9WA 4DU4A 4DSJA 3VN5A 4Z4EA 2YKMA 4FK4A 1B9KA 1VRTA 4C8KA 1D8YA 4CK3A 4OPJA 3NGZA 2JLEA 1S9EA 1WSFA 3MEEA 4CJ3A 3OVNA 1QTMA 3H1ZA 2HHQA 4N41A 3O4QA 1YVUA 1ASWA 1RILA 3OYJA 3NF9A 3D45A 4Q11A 4FVMA 3VQ4A 4YNQA 4BACA 4DTUA 1TAQA 4FJ7A 2XY6A 3NF6A 2KFZA 1LW2A 1J5OA 1IKYA 5JS1A 4CGGA 1QN5A 4B9TA 4FJXA 4Z4GA 3ZT4A 4DU3A 3DLHA 3CQ8A 1VSJA 1TBAB 3QO9A 1K6YA 1KVBA 4N5SA 1WSHA 4CE9A 1NK0A 3ALYA 4CJSA 1D5AA 4PQUA 4EJZA 4JRQA 3L2RA 3WNHA 4FJLA 4I8OA 4I2QA 2E6MA 2IS3A 2OPSA 4KTWA 3KRMA 3DYAA 4HCCA 3KJVA 3TAEA 2KFNA 1S6QA 1IKWA 3HXMA 1WSIA 5J1EA 1AISA 3SQ0A 4CGJA 1XI1A 1W9HA 3S3NA 1TK8A 2BGGA 1BQMA 3AA2A 3ZSOA 3RMCA 3ZT3A 4CK1A 5FDLA 2JOIA 1NJZA 1X9WA 4KHSA 1LWFA 4FLYA 4M3RA 4CF2A 4NCBA 4LD0A 4CF8A 3KK1A 2HHUA 1BCMA 3LP0A 3AVFA 4J2BA 3O3FA 3NF7A 1SL2A 3F0ZA 1QN9A 3KLIA 4Z0UA 1YTAA 3HS9A 3KIOA 3AVAA 2E4LA 1C0MA 1REVA 2D5RA 2FBVA 1UOCA 3NHGA 4F3OA 3K5NA 4CEBA 3AO2A 3AVHA 4CGDA 1QSYA 2EHGA 3G10A 2XHIA 1C1BA 4IDKA 4BDYA 3UIQA 1VSKA 4L8RB 5CYQA 4CFBA 4BWMA 2O3OA 2B4JA 3KTQA 1BHLA 2X74A 4ELUA 3JYTA 4FJ8A 4KREA 3AVJA 2QK9A 1ZBFA 3AO3A 5KGXA 1QNAA 4JLHA 4UQGA 3V9SA 3BGRA 1NJXA 4DQSA 1HYVA 1IKVA 2HNDA 2Q3SA 1A5WA 3TANA 4J2AA 3KLFA 1IKXA 1RT2A 3RRGA 3HPGA 3V6DA 1W80A 4CFAA 1KO9A 3IH7A 2IDOA 4AILC 4FJNA 4FJMA 3MECA 2G30A 4N76A 3K58A 2VWKA 2BDPA 1QNEA 1BL3A 1EXQA 3AO5A 4BWJA 3KLEA 1EX4A 3QERA 1RT3A 3OS0A 3SCXA 1KFSA 4CEEA 3MXIA 2NUBA 2VG5A 1PCZA 2OPRA 3HVTA 4DG1A 1WNSA 3VQ8A 1C0TA 2E6LA 3OYLA 3HT3A 3L8BA 1QTSA 5AN4A 1TVRA 3QNOA 2OZMA 3L2VA 1S6PA 1RBSA 2OPQA 5J2NA 4W5QA 4OKEA 4M45A 4E7HA 1NK5A 4C8LA 4ROCB 5I3UA 3QEVA 1ZBIA 3VQAA 4DTNA 1O1WA 4KHNA 2XY7A 1Q8IA 5HRRA 4AH9A 1NK6A 2G8VA 4R5PA 4E1NA 2P5OA 4EZ9A 2AJQA 3OJUA 3HS8A 1BISA 1BQNA 4KHUA 1HU0A 1VSFA 4CK2A 3OJSA 4FM2A 4ELVA 4FW2A 3BDPA 3PUFA 4O55A 1GOCA 4O0IA 5CZ2A 4AHVA 1S1VA 4DTRA 1WSJA 3V9UA 4FLZA 3VQBA 2YKNA 2A1RA 1X9MA 4CEZA 2OYQA 3NH0A 3SQ2A 4CJQA 2ITGA 2VJ0A 4CJPA 3P5JA 1Z25A 1EETA 3C95A 5I42A 1NKBA 4OPKA 1X9SA 3LPTA 3SPZA 3VQDA 1NOZA 4DTJA 1RTHA 2LSNA 4FLVA 4DTSA 1RTDA 3EY1A 4AHCA 1LWWA 1A5VA 3LPUA 4CF9A 4B0AA 1RDAA 4LSLA 3DPUA 1KYFA 3OS1A 3LDSA 4W5NA 5HLFA 4ELTA 3KKRA 1KVCA 3P1GA 3NH1A 1UA1A 1YQRA 4H4MA 3NGYA 3K57A 1L3VA 1RBTA 3SV3A 2OZSA 1MP9A 3LALA 4GVMA 2OA8A 4Z4FA 3EZ5A 2JGUA 4CGHA 4DSKA 3I0WA 1LWVA 4KV8A 3SI6A 4GMJB 4O44A 4B9SA 1QNCA 1QS4A 4CHNA 4F8RA 1YTBA 2GV9A 4FK2A 4B9NA 4QAGA 1RTIA 4OVLA 4HCBA 1M3QA 3DLEA 3OYMA 4DLEA 3LP3A 1RNHA 4W5TA 1HNIA 3AVNA 3S9HA 1UAXA 4YFUA 4QCLA 4E1MA 1EKEA 4CHOA 4OGCA 3VQ7A 4CJWA 4B9MA 2RPIA 3VQPA 3AV9A 4J2EA 3IRXA 3QIOA 4CHQA 4FLWA 1NK4A 1DTTA 1NVPA 3L2UA 2PZSA 2HHXA 5J2QA 4H8KA 1T03A 3F10A 1B9DA 5SWMA 3MEDA 1SKSA 4F4KA 4LSNA 1JLFA 3KTUA 4CJVA 2HHSA 4E7KA 3PX4A 5IYDP 4KPYA 3RPJA 3ULDA 4M3WA 2R7YA 3OYCA 3KK2A 3SUNA 5KGWA 1TK5A 4KRFA 3HM9A 1X1PA 4FJKA 2OPPA 2DFFA 2D0CA 3RR8A 3RWUA 1VOLB 1FXXA 1VSDA 4JS4A 4ID1A 1ZBLA 4CGIA 1R4XA 1XHZA 3V81A 1BCOA 3DI6A 4MQ3A 4KB1A 4BDZA 4DSFA 2VG6A 4F2RA 3ZSQA 3HJFA 1KLNA 1WLJA 4KTZA 4CESA 3OYHA 3SZ2A 5DMRA 4CFDA 2ZE2A 3L2WA 3V9XA 4DTXA 4DFMA 3D0PA 3SV4A 1YQLA 4RW6A 4DTOA 3OCIA 2HNZA 1YT3A 4DFJA 3TWHA 1U49A 4DWIA 4OLBA 1TL1A 2P51A 3K5OA 3HSTB 1LV5A 4NCAA 4Q0BA 5E41A 4I9QA 1ITGA 1NH2A 1JLBA 1VK0A 2B5JA 3M8QA 1S1XA 4CFCA 3MAQA 1HJRA 1S1TA 4CHYA 4DF8A 3SNNA 5D3GA 2QKBA 2YNGA 1TAUA 3CM6A 1YQKA 4CEQA 2D0AA 1RDDA 1L5UA 2O4IA 4AHSA 1MU2A 3IS9A 4KO0A 3H08A 1TL3A 3DOKA 2XHBA 4DQQA 1G15A 1WSGA 4I9LA 1RBRA 4C8MA 4FZXC 3U3YA 4FK0A 3AO4A 3AVGA 2NOZA 1B92A 1LAWA 3B6PA 2QKKA 3K2PA 1T05A 1KY6A 2NOFA 1YTUA 1E42A 4FW1A 3U6FA 1CDWA 1FK9A 4AHUA 5K14A 5CY4A 3OYEA 4KTQA 1NJYA 3VQEA 4FLXA 1JLCA 3DRSA 2W42A 3OYIA 3OYKA 3AVLA 1EBMA 5C24A 1VSMA 1JXBA 3HVRA 1D9FA 4F2SA 2ETJA 4ZHRA 3LANA 1WSEA 3DPTA 1RBVA 3L2QA 4TPSA 2HZSA 1RT1A 3V1RA 4CJEA 4CERA 4JRPA 3TAFA 1RT4A 2EX3A 1VSIA 5FRNA 3QEXA 3SQ1A 1NJWA 2F8SA 4CEAA 3QEWA 2DTUA 4CGFA 4DULA 3OSMA 1FKOA 4OGEA 4O0JA 1TK0A 1NKEA 2HHTA 1CXUA 2HB5A 2IV8A 3DLGA 1RM1A 3AVKA 1BIUA 1JLEA 5HRNA 3KK3A 2KZZA 4B9LA 3K5MA 3LZJA 4E89A 4B9UA 1BI4A 2YHAA 1UA0A 3QESA 2FBTA 2VG7A 3T19A 1R0AA 2MZ8A 1N5YA 4DQIA 1HYZA 1DTQA 1XHXA 3O4NA 3N89A 4FLTA 3I0RA 3THVA 1HQUA 1JFIC 3V4IA 4M3YA 4RW4A 3AA3A 1S1WA 1A5XA 2Z8UA 3HPHA 3M8SA 3CYMA 1JKHA 4RODB 2FBYA 3NAEA 3DMJA 4BE2A 4DS4A 5CZ1A 3OSTA 1VSEA 3I0XA 1KSPA 2YNFA 3L3UA 3ZT1A 4Z4CA 4LY7A 1TBPA 4MFBA 3U3GA 4E0DA 3V9ZA 1KY7A 4DFKA 3SNSA 4HUGA 1RCHA 3CFOA 1FN7A 4JS5A 1N3AA 2YH5A 4ROEB 4NCGA 3AVMA 3HP6A 1TKTA 4IFYA 4RG8A 1QN8A 1TGHA 3CM5A 3NGIA 1WAJA 2HW3A 1LWYA 3OYBA 3JSMA 1Z26A 3AA5X 3HL8A 5HBMA 1J54A 1JLGA 2YHBA 4GW6A 3TR8A 4DQRA 3OYGA 4ZTFA 1JXEA 4E3SA 4CJFA 1TKDA 2P5GA 3RTVA 4FLUA 1QQCA 4NYNA 4BE0A 3KLGA 3ITHA 5KRTA 2YV0X 1SL1A 1N6QA 1HYSA 3I8DA 1RDCA 3AVCA 2KZMA 3C6UA 3V1QA 3KKSA 1N3CA 3TI0A 5IYCP 1NK7A 1QHTA 5C25A 5IYBP 4FZZA 3DLKA 2G8FA 3A2FA 3M8RA 3QLHA 4E7IA 4PY5A 3RRHA 1CLQA 1S9GA 3LP1A 4LH4A 1QSLA 4QOZB 4IG0A 4B8CA 1SV5A 3VQ5A 1SL0A 1BGXT 2PYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAK A;  1CZB A;  2GUI A;  1XWL A;  4DSI A;  4KI6 A;  1NGM A;  1U4B A;  3I0S A;  4TSX A;  4Y1C A;  4OLA A;  2QXF A;  4C8N A;  1J53 A;  2HMI A;  1W0H A;  2FC0 A;  2IGI A;  3ASM A;  1KVA A;  3O3G A;  3OY9 A;  4O4G A;  2KQ2 A;  4NYF A;  4DF4 A;  3CFR A;  3RMB A;  2XY5 A;  4FJH A;  1BI4 B;  3SUP A;  2HVI A;  2VWJ A;  1ZBU A;  4CJ4 A;  3AA4 A;  4I7F A;  2I5J A;  1U48 A;  3O3H A;  4HVJ A;  3KD5 E;  3PO5 A;  3F73 A;  2Z1J A;  2D0B A;  3T1A A;  3NF8 A;  1T8E A;  4DFP A;  1RBU A;  3NFA A;  3OYF A;  3PX6 A;  1TGO A;  3ZCM A;  1CZ9 A;  4Y1D A;  1VTL E;  1ASV A;  1F21 A;  4FJI A;  1SUQ A;  3LAM A;  5KTQ A;  3V1O A;  1QTP A;  5FRO A;  4CJL A;  3L3V A;  4DSL A;  4M3Z A;  1IO2 A;  1QN7 A;  1EP4 A;  3QEI A;  2ATQ A;  3HK2 A;  4EP5 A;  3QET A;  4M3T A;  4LH5 A;  4DQP A;  4B8A B;  4RW9 A;  1KRP A;  2Z1I A;  2G8I A;  2HVH A;  2G8U A;  3C94 A;  1B9F A;  1KTQ A;  1L3U A;  4CJK A;  4CJU A;  4FCY A;  3EYZ A;  4E7J A;  3C6T A;  2IAJ A;  2ZQB A;  4DS5 A;  2RF2 A;  4OKK A;  3VQ9 A;  4CHP A;  4E7L A;  2WOM A;  3TAR A;  2DFH A;  4WE1 A;  3NE6 A;  4E19 A;  1KFD A;  1Q9Y A;  1TV6 A;  1YTF A;  3E01 A;  1RT6 A;  1WN7 A;  5FRM A;  5KI6 A;  4KHW A;  4DLG A;  1VTO A;  4KB0 A;  4PUO A;  5HRO A;  4FZY A;  4O5B A;  4AHR A;  2GBZ A;  3ZT2 A;  3DM2 A;  3NBP A;  4N47 A;  3LZI A;  4CIE A;  1T7P A;  2A1S A;  3IG1 A;  3B6O A;  1HNV A;  2IOC A;  4J2D A;  1HQE A;  1S5J A;  4N56 A;  3K59 A;  3PV8 A;  5C42 A;  4FYD A;  3AO1 A;  3WNG A;  1U45 A;  2IV9 A;  4CIF A;  3ZSR A;  3OYA A;  3SYZ A;  1QNB A;  4CJ5 A;  5SZT A;  3ZSX A;  4ZTJ A;  3M8P A;  1ZYQ A;  4FJG A;  1C1C A;  2HNY A;  4KHQ A;  2B6A A;  3EIK A;  2Z1H A;  1VRU A;  4CJT A;  3SJJ A;  4B9V A;  5J2M A;  3ZSV A;  5EU7 A;  4F3T A;  5JS2 A;  4KKO A;  4CEF A;  2X6N A;  4Z4H A;  4IG3 A;  3ZSZ A;  3HPO A;  3QIP A;  4PA1 A;  3WNE A;  1XC9 A;  1BIZ A;  4H4O A;  3QNN A;  2Y1J A;  4CJR A;  3QIN A;  1I3A A;  2G8W A;  1HMV A;  3RMA A;  3HO1 A;  1C1A A;  2O4G A;  3DOL A;  2X6S A;  1C0U A;  3NH2 A;  4FM0 A;  3SQ4 A;  3OYD A;  1NK9 A;  1Q9X A;  4M3U A;  1JLA A;  4CF0 A;  3T3F A;  2DY4 A;  1I39 A;  1RDB A;  2HHW A;  1S1U A;  3CG7 A;  4IBN A;  1Y97 A;  4CIG A;  5T7B A;  1HRH A;  3LP2 A;  4HUF A;  4CHZ A;  4DTP A;  3LWL A;  2XRI A;  5HRS A;  1KCF A;  1KYD A;  3MXM A;  1DLO A;  1JL2 A;  2X78 A;  2XO7 A;  4DMN A;  1L3S A;  3TAG A;  3K5L A;  4CEC A;  3PX0 A;  1QN6 A;  1LW0 A;  4G1Q A;  3TAP A;  1J9A A;  1VSH A;  3TAM A;  2G8H A;  4CCH A;  1D9D A;  1ZBH A;  4IKF A;  3VA3 A;  3ZSY A;  4WZS D;  1GOA A;  1QN3 A;  4RW7 A;  3TAB A;  4Q5V A;  1L3T A;  1U47 A;  2Y1I A;  4Z4I A;  3HP9 A;  3MEG A;  4KFB A;  5HRP A;  1SKW A;  2G8K A;  4OJR A;  3HYF A;  3CFP A;  3PY8 A;  4W5O A;  3OS2 A;  2YNH A;  3LWM A;  4FJJ A;  2PY5 A;  5KRS A;  4K8Z A;  4OKJ A;  4IFV A;  2F96 A;  4RW8 A;  4CED A;  4HTU A;  1KYU A;  1GOB A;  1LWC A;  2BAN A;  3TAQ A;  4BDP A;  2F8T A;  1RT7 A;  3QEP A;  3NCI A;  3AVI A;  4C8O A;  2PYL A;  3S3O A;  4FJ5 A;  3SPY A;  3MXJ A;  1FKP A;  2FBX A;  1QSS A;  1RT5 A;  2DFE A;  4DU1 A;  1TKX A;  4DSE A;  3AVB A;  1VOK A;  1CXQ A;  4M41 A;  4BE1 A;  4K8X A;  4EP4 A;  4FM1 A;  3DRR A;  1QE1 A;  3SUO A;  3VQC A;  1NKC A;  4HUE A;  1ASU A;  3WNF A;  3F9K A;  3ZSW A;  1JL1 A;  1IH7 A;  2KW4 A;  2YNI A;  4CF1 A;  4M3X A;  2ZD1 A;  2WON A;  4KHY A;  4B3O A;  1U04 A;  1WAF A;  3PO4 A;  4FJ9 A;  3NDK A;  3G0Z A;  3P83 D;  4FXD A;  3SUQ A;  1PZD A;  5J2P A;  2HHV A;  2P1J A;  3RR7 A;  2IC3 A;  3DLB A;  3FFI A;  1D3U A;  1HPZ A;  5DK5 A;  3KLH A;  3RMD A;  1IG9 A;  1UWB A;  2XY8 A;  5HP1 A;  3KD1 E;  3VA0 A;  4EZ6 A;  1NK8 A;  2MJ7 A;  4XIU A;  4HHT A;  1JLQ A;  4CEO A;  3IAY A;  2RKI A;  3DRP A;  1QN4 A;  4AHT A;  1KLM A;  1SKR A;  1LWE A;  2KTQ A;  1VSL A;  4ID5 A;  2BE2 A;  4W5R A;  1C9B B;  4PWD A;  3VQ6 A;  4ICL A;  3S3M A;  3OYN A;  2RN2 A;  2Z1G A;  1LAV A;  4I2P A;  1NOY A;  4KAZ A;  3VQQ A;  3OC3 C;  3ISN C;  3ZT0 A;  1RTJ A;  1TKZ A;  3DLR A;  4DTM A;  4KI4 A;  1C6V A;  5CYM A;  4B08 A;  3V9W A;  4DU4 A;  4DSJ A;  3VN5 A;  4Z4E A;  2YKM A;  4FK4 A;  1B9K A;  1VRT A;  4C8K A;  1D8Y A;  4CK3 A;  4OPJ A;  3NGZ A;  2JLE A;  1S9E A;  1WSF A;  3MEE A;  4CJ3 A;  3OVN A;  1QTM A;  3H1Z A;  2HHQ A;  4N41 A;  3O4Q A;  1YVU A;  1ASW A;  1RIL A;  3OYJ A;  3NF9 A;  3D45 A;  4FVM A;  3VQ4 A;  4BAC A;  4YNQ A;  4DTU A;  1TAQ A;  4FJ7 A;  2XY6 A;  3NF6 A;  2KFZ A;  1LW2 A;  1J5O A;  1IKY A;  5JS1 A;  4CGG A;  1QN5 A;  4B9T A;  4FJX A;  4Z4G A;  3ZT4 A;  4DU3 A;  3DLH A;  3CQ8 A;  1VSJ A;  1TBA B;  3QO9 A;  1K6Y A;  1KVB A;  4N5S A;  1WSH A;  4CE9 A;  1NK0 A;  3ALY A;  4CJS A;  1D5A A;  4PQU A;  4JRQ A;  3L2R A;  3WNH A;  4FJL A;  4KTW A;  4I2Q A;  2E6M A;  2IS3 A;  2OPS A;  4HCC A;  3DYA A;  3KJV A;  3TAE A;  2KFN A;  1S6Q A;  1IKW A;  3HXM A;  1WSI A;  5J1E A;  1AIS A;  3SQ0 A;  4CGJ A;  1XI1 A;  1W9H A;  3S3N A;  1TK8 A;  2BGG A;  1BQM A;  3AA2 A;  3ZSO A;  3RMC A;  3ZT3 A;  4CK1 A;  5FDL A;  1X9W A;  1NJZ A;  4KHS A;  1LWF A;  4FLY A;  4M3R A;  4CF2 A;  4NCB A;  4LD0 A;  4CF8 A;  3KK1 A;  2HHU A;  1BCM A;  3LP0 A;  3AVF A;  4J2B A;  3O3F A;  3NF7 A;  1SL2 A;  1QN9 A;  3KLI A;  4Z0U A;  1YTA A;  3HS9 A;  3KIO A;  3AVA A;  2E4L A;  1C0M A;  1REV A;  2D5R A;  2FBV A;  1UOC A;  3NHG A;  4F3O A;  3K5N A;  4CEB A;  3AO2 A;  3AVH A;  4CGD A;  1QSY A;  2EHG A;  3G10 A;  1C1B A;  4IDK A;  4BDY A;  3UIQ A;  1VSK A;  4L8R B;  5CYQ A;  4CFB A;  4BWM A;  4FJ8 A;  2B4J A;  3KTQ A;  1BHL A;  2X74 A;  4ELU A;  3JYT A;  4KRE A;  3AVJ A;  2QK9 A;  1ZBF A;  3AO3 A;  5KGX A;  1QNA A;  4JLH A;  4UQG A;  3V9S A;  3BGR A;  1NJX A;  4DQS A;  1HYV A;  1IKV A;  2HND A;  2Q3S A;  1A5W A;  3TAN A;  4J2A A;  3KLF A;  1IKX A;  1RT2 A;  3RRG A;  3HPG A;  3V6D A;  1W80 A;  4CFA A;  2IDO A;  4AIL C;  4FJN A;  4FJM A;  3MEC A;  2G30 A;  4N76 A;  3K58 A;  2VWK A;  2BDP A;  1QNE A;  1BL3 A;  1EXQ A;  3AO5 A;  4BWJ A;  3KLE A;  1EX4 A;  3QER A;  1RT3 A;  3OS0 A;  3SCX A;  1KFS A;  4CEE A;  3MXI A;  2NUB A;  2VG5 A;  1PCZ A;  2OPR A;  3HVT A;  4DG1 A;  1WNS A;  3VQ8 A;  1C0T A;  2E6L A;  3OYL A;  3HT3 A;  3L8B A;  1QTS A;  3QNO A;  1TVR A;  2OZM A;  3L2V A;  1S6P A;  1RBS A;  2OPQ A;  5J2N A;  4W5Q A;  4OKE A;  4M45 A;  4E7H A;  1NK5 A;  4C8L A;  4ROC B;  5I3U A;  3QEV A;  1ZBI A;  3VQA A;  4DTN A;  1O1W A;  4KHN A;  2XY7 A;  1Q8I A;  5HRR A;  4AH9 A;  1NK6 A;  2G8V A;  4R5P A;  4E1N A;  2P5O A;  4EZ9 A;  2AJQ A;  3OJU A;  3HS8 A;  1BIS A;  1BQN A;  4KHU A;  4FM2 A;  1VSF A;  4CK2 A;  3OJS A;  4ELV A;  4FW2 A;  3BDP A;  3PUF A;  4O55 A;  1GOC A;  4O0I A;  5CZ2 A;  4AHV A;  1S1V A;  4DTR A;  1WSJ A;  3V9U A;  4FLZ A;  3VQB A;  2YKN A;  2A1R A;  1X9M A;  4CEZ A;  2OYQ A;  3NH0 A;  3SQ2 A;  4CJQ A;  2ITG A;  2VJ0 A;  4CJP A;  3P5J A;  1Z25 A;  1EET A;  3C95 A;  5I42 A;  1NKB A;  4OPK A;  1X9S A;  3LPT A;  3SPZ A;  3VQD A;  1NOZ A;  4DTJ A;  1RTH A;  2LSN A;  4FLV A;  4DTS A;  1RTD A;  3EY1 A;  4AHC A;  1A5V A;  3LPU A;  4CF9 A;  4B0A A;  1RDA A;  4LSL A;  3OS1 A;  1KYF A;  3LDS A;  4W5N A;  5HLF A;  4ELT A;  3KKR A;  1KVC A;  3P1G A;  3NH1 A;  1UA1 A;  4H4M A;  3NGY A;  3K57 A;  1L3V A;  1RBT A;  3SV3 A;  2OZS A;  1MP9 A;  3LAL A;  4GVM A;  2OA8 A;  4Z4F A;  3EZ5 A;  2JGU A;  4CGH A;  4DSK A;  4KV8 A;  3SI6 A;  4GMJ B;  4O44 A;  4B9S A;  1QNC A;  1QS4 A;  4CHN A;  4F8R A;  1YTB A;  2GV9 A;  4FK2 A;  4B9N A;  4QAG A;  1RTI A;  4OVL A;  4HCB A;  3DLE A;  3OYM A;  4DLE A;  3LP3 A;  1RNH A;  4W5T A;  1HNI A;  3AVN A;  3S9H A;  1UAX A;  4YFU A;  4QCL A;  4E1M A;  1EKE A;  4CHO A;  4OGC A;  3VQ7 A;  4CJW A;  4B9M A;  2RPI A;  3VQP A;  3AV9 A;  4J2E A;  3IRX A;  3QIO A;  4CHQ A;  4FLW A;  1NK4 A;  1DTT A;  1NVP A;  3L2U A;  2PZS A;  2HHX A;  5J2Q A;  4H8K A;  1T03 A;  5SWM A;  1B9D A;  3MED A;  1SKS A;  4F4K A;  4LSN A;  1JLF A;  4CJV A;  2HHS A;  4E7K A;  3PX4 A;  5IYD P;  4KPY A;  3ULD A;  4M3W A;  2R7Y A;  3OYC A;  3KK2 A;  3SUN A;  5KGW A;  1TK5 A;  4KRF A;  3HM9 A;  1X1P A;  4FJK A;  2OPP A;  2DFF A;  2D0C A;  3RR8 A;  3RWU A;  1VOL B;  1FXX A;  1VSD A;  4JS4 A;  4ID1 A;  1ZBL A;  4CGI A;  1R4X A;  1XHZ A;  3V81 A;  1BCO A;  3DI6 A;  4MQ3 A;  4KB1 A;  4BDZ A;  4DSF A;  2VG6 A;  4F2R A;  3ZSQ A;  3HJF A;  1KLN A;  1WLJ A;  4KTZ A;  4CES A;  3OYH A;  3SZ2 A;  5DMR A;  4CFD A;  2ZE2 A;  3L2W A;  3V9X A;  4DTX A;  4DFM A;  3D0P A;  3SV4 A;  4RW6 A;  4M42 A;  4DTO A;  3OCI A;  2HNZ A;  1YT3 A;  4DFJ A;  3TWH A;  1U49 A;  4DWI A;  4OLB A;  1TL1 A;  2P51 A;  3K5O A;  3HST B;  1LV5 A;  4NCA A;  4Q0B A;  5E41 A;  4I9Q A;  1ITG A;  1NH2 A;  1JLB A;  1VK0 A;  2B5J A;  3M8Q A;  1S1X A;  4CFC A;  3MAQ A;  1HJR A;  1S1T A;  4CHY A;  4DF8 A;  3SNN A;  5D3G A;  2QKB A;  2YNG A;  1TAU A;  3CM6 A;  4CEQ A;  2D0A A;  1RDD A;  1L5U A;  2O4I A;  4AHS A;  1MU2 A;  3IS9 A;  4KO0 A;  3H08 A;  1TL3 A;  3DOK A;  2XHB A;  4DQQ A;  1G15 A;  1WSG A;  4I9L A;  1RBR A;  4C8M A;  4FZX C;  3U3Y A;  4FK0 A;  3AO4 A;  3AVG A;  1B92 A;  1LAW A;  3B6P A;  2QKK A;  3K2P A;  1T05 A;  1KY6 A;  1YTU A;  1E42 A;  4FW1 A;  3U6F A;  1CDW A;  1FK9 A;  4AHU A;  5K14 A;  5CY4 A;  3OYE A;  4KTQ A;  1NJY A;  3VQE A;  4FLX A;  1JLC A;  3DRS A;  2W42 A;  3OYI A;  3OYK A;  3AVL A;  5C24 A;  1VSM A;  1JXB A;  3HVR A;  1D9F A;  4F2S A;  2ETJ A;  4ZHR A;  3LAN A;  1WSE A;  1RBV A;  3L2Q A;  4CJE A;  4JRP A;  1RT1 A;  3V1R A;  3TAF A;  4CER A;  1RT4 A;  2EX3 A;  1VSI A;  5FRN A;  3QEX A;  3SQ1 A;  1NJW A;  2F8S A;  4CEA A;  3QEW A;  2DTU A;  4CGF A;  1FKO A;  4OGE A;  1TK0 A;  4O0J A;  2HHT A;  1NKE A;  1CXU A;  2HB5 A;  2IV8 A;  3DLG A;  1RM1 A;  3AVK A;  1BIU A;  1JLE A;  5HRN A;  3KK3 A;  2KZZ A;  4B9L A;  3K5M A;  3LZJ A;  4E89 A;  4B9U A;  1BI4 A;  2YHA A;  1UA0 A;  3QES A;  2FBT A;  2VG7 A;  3T19 A;  1R0A A;  1N5Y A;  4DQI A;  1HYZ A;  1DTQ A;  1XHX A;  3O4N A;  4FLT A;  3I0R A;  3THV A;  1HQU A;  1JFI C;  3V4I A;  4M3Y A;  4RW4 A;  3AA3 A;  1S1W A;  1A5X A;  2Z8U A;  3HPH A;  3M8S A;  3CYM A;  1JKH A;  4ROD B;  2FBY A;  3NAE A;  3DMJ A;  4BE2 A;  4DS4 A;  5CZ1 A;  1VSE A;  1KSP A;  2YNF A;  3L3U A;  3ZT1 A;  4Z4C A;  4LY7 A;  1TBP A;  4MFB A;  3U3G A;  4E0D A;  3V9Z A;  1KY7 A;  4DFK A;  4HUG A;  1RCH A;  3CFO A;  4JS5 A;  4ROE B;  4NCG A;  3AVM A;  3HP6 A;  1TKT A;  4IFY A;  4RG8 A;  1QN8 A;  1TGH A;  3CM5 A;  3NGI A;  1WAJ A;  2HW3 A;  3JSM A;  3OYB A;  1Z26 A;  3AA5 X;  3HL8 A;  5HBM A;  1J54 A;  1JLG A;  2YHB A;  4GW6 A;  3TR8 A;  4DQR A;  3OYG A;  4ZTF A;  1JXE A;  4E3S A;  4CJF A;  1TKD A;  2P5G A;  3RTV A;  4FLU A;  1QQC A;  4NYN A;  4BE0 A;  3KLG A;  3ITH A;  5KRT A;  2YV0 X;  1SL1 A;  1N6Q A;  1HYS A;  3I8D A;  1RDC A;  3AVC A;  2KZM A;  3C6U A;  3V1Q A;  3KKS A;  3TI0 A;  5IYC P;  1NK7 A;  1QHT A;  5C25 A;  5IYB P;  4FZZ A;  3DLK A;  2G8F A;  3A2F A;  3M8R A;  3QLH A;  4E7I A;  4PY5 A;  3RRH A;  1CLQ A;  1S9G A;  3LP1 A;  4LH4 A;  1QSL A;  4QOZ B;  4IG0 A;  4B8C A;  1SV5 A;  3VQ5 A;  1SL0 A;  1BGX T;  2PYJ A; 
#chains in the Genus database with same CATH topology
 3LAK A;  1CZB A;  1XWL A;  4KI6 A;  5ADX A;  3L4I A;  2QXF A;  2FC0 A;  2IGI A;  3CIP A;  1KVA A;  3OY9 A;  4CBW A;  4FJH A;  2P9N A;  2HVI A;  4CJ4 A;  4I7F A;  2I7N A;  4HVJ A;  1T8E A;  2Z1J A;  3NF8 A;  2Q31 A;  4FOI A;  3BF1 A;  3ZCM A;  4Y1D A;  4B1W B;  1IBK K;  3LAM A;  3OH6 A;  3V1O A;  4L3Q A;  1X3N A;  4D7Q A;  2A40 A;  2NOB A;  3MWP A;  4LH5 A;  2Z1I A;  1GLA G;  2G8U A;  4FCY A;  1NU0 A;  5GIO A;  2HBL A;  2ZQB A;  1BG3 A;  4OKK A;  3TAR A;  5BR9 A;  5AJ3 K;  1KFD A;  3VGM A;  4A59 A;  1RT6 A;  2QW9 A;  3O5B A;  5FRM A;  4NLB A;  5HRO A;  4O5B A;  3VF6 A;  3C0B A;  3DM2 A;  5LY3 A;  1T7P A;  3IG1 A;  3K9K A;  1BDG A;  2P9K B;  1S5J A;  4DR2 K;  2E2N A;  5C42 A;  4FYD A;  4PL8 A;  1U45 A;  4JI7 K;  4PL7 A;  1QNB A;  4R79 A;  4A2B A;  3FZM A;  2HNY A;  2O8C A;  4CJT A;  4B9V A;  3ZSV A;  4CW7 B;  3QIP A;  3U9D A;  3QNN A;  4CJR A;  5C10 A;  3E9L A;  2FSN A;  3PSF A;  1C0U A;  4FM0 A;  3SQ4 A;  1NK9 A;  1SS6 A;  2V52 B;  1XMO K;  2DY4 A;  1I39 A;  2HBK A;  2HHW A;  5BRH A;  4CHZ A;  4JYA K;  1Q86 O;  1ILY A;  2G8H A;  1J9A A;  5HL7 L;  4CCH A;  4HTL A;  4IKF A;  4Q5V A;  1HNX K;  1N39 A;  1L3T A;  2Y1I A;  3J8A A;  3JS6 A;  1ZXO A;  5GAG P;  4KFB A;  1SKW A;  1OH8 A;  4OJR A;  3HYF A;  2A41 A;  3LWM A;  4FJJ A;  4K8Z A;  4C1N I;  4OKJ A;  3TAQ A;  1NGF A;  1BOT O;  3NCI A;  3QEP A;  1NGE A;  1WB9 A;  1QSS A;  3CCS N;  2FBX A;  1RT5 A;  1TKX A;  4B3R K;  3M1F A;  4CVN E;  2GWK A;  3OBY A;  4JK7 A;  3UKR A;  3HM8 A;  3WNF A;  2NOH A;  3F9K A;  1JL1 A;  3G6E N;  3PO4 A;  1WAF A;  4RTF D;  4JI4 K;  2Q2R A;  3P83 D;  2VWB A;  1E4F T;  3EAY A;  3RR7 A;  2VQE K;  3FFI A;  4A2A A;  3CJB A;  3R9P A;  1UWB A;  2XY8 A;  1YXQ A;  5HP1 A;  4EZ6 A;  4HHT A;  1JLQ A;  4FWS A;  3DRP A;  3U4L A;  1VSL A;  3O6W A;  1R59 O;  5AQM A;  4BGA A;  4C7P A;  3N4P A;  4PWD A;  2IVP A;  2RN2 A;  1OH5 A;  4KAZ A;  3VQQ A;  2AP1 A;  4FOE A;  1TKZ A;  3L6Q A;  3V9W A;  4FK4 A;  2HMP A;  3KZB A;  4CK3 A;  4N41 A;  3O4Q A;  2R5X A;  1RIL A;  4Q11 A;  4H03 B;  3GDQ A;  4GV3 A;  1TAQ A;  3NF6 A;  4H5N A;  1J5O A;  1IKY A;  4CGG A;  4B9T A;  3H45 C;  4DU3 A;  4EAG A;  1S3X A;  1VSJ A;  3QO9 A;  3EZW A;  1Y64 A;  1D5A A;  3WNH A;  4WX8 A;  5AQX A;  4I2Q A;  2E6M A;  2IS3 A;  2OPS A;  3DYA A;  1U2V A;  2O8E B;  1NMN A;  5AZI B;  1WSI A;  4BR2 A;  5J1E A;  4ISG A;  4CD3 A;  5KQ8 A;  2OTJ N;  4EAK A;  1TK8 A;  3MX5 A;  2P9I B;  3ZSO A;  4CK1 A;  4IZ9 A;  2JOI A;  2NNW A;  4CF2 A;  4CF8 A;  3KK1 A;  3CER A;  4YOT A;  3AVF A;  4J2B A;  4YOW A;  3F0Z A;  4O8K A;  4NLC A;  4CZF A;  3CMA N;  2NZT A;  3KIO A;  4JKE A;  2D5R A;  5BRE A;  1UOC A;  3NHG A;  4F3O A;  1IG8 A;  4CEB A;  3FZL A;  4CGD A;  4WQ5 A;  1LOT B;  1C1B A;  3KK7 A;  4BDY A;  1VSK A;  4L8R B;  5IT9 O;  4CFB A;  3KHY A;  1BHL A;  2QM1 A;  2X74 A;  4KRE A;  1HJO A;  3TSU A;  1JDY A;  4B3T K;  4DV7 K;  4JLH A;  3ATV A;  4BRG A;  4DQS A;  4J2A A;  2Q3S A;  3VEX A;  3V6D A;  2V8Q A;  4MO5 A;  2Q0R A;  3VF2 A;  3QML A;  1QNE A;  1EX4 A;  4CEE A;  1PCZ A;  4JHD B;  3OYL A;  3ZLJ A;  4DKW A;  4CD1 A;  3L2V A;  4DV5 K;  1K8K A;  2FF6 A;  1RBS A;  5J2N A;  2E1Z A;  3IKM A;  4IDH A;  3O9R A;  5AQV A;  5GAH P;  1HX1 A;  1O1W A;  3UKU B;  4CBX A;  5HRR A;  4AH9 A;  1ATS A;  3HS8 A;  1BQN A;  4E1J A;  1HU0 A;  2QXL A;  1GOC A;  5CZ2 A;  2CGJ A;  1X9M A;  1IBL K;  3AGR A;  2OYQ A;  4GVE A;  4LF6 K;  2ITG A;  1IJJ A;  1Z25 A;  5I42 A;  2DPN A;  3SPZ A;  5BR8 K;  3VQD A;  2NRT A;  1RTH A;  2LSN A;  4FLV A;  3EY1 A;  4DV4 K;  1LWW A;  3LPU A;  4W5N A;  2JWK A;  1RDA A;  3OS1 A;  3LDS A;  5HLF A;  1OVQ A;  4YOX A;  1UA1 A;  1DGK N;  3NGY A;  4A5B A;  1CZA N;  2E5L K;  3SV3 A;  2OZS A;  4GVM A;  5AFU A;  2P9L A;  2FKM X;  1QNC A;  4F8R A;  1YTB A;  2GV9 A;  1GLB G;  4FK2 A;  4B9N A;  4OVL A;  3CWU A;  3OYM A;  4DLE A;  4W5T A;  3AAQ A;  4OGC A;  4NO7 A;  4CJW A;  4B9M A;  1W97 L;  3QIO A;  3HSC A;  2P9P B;  4CHQ A;  1NK4 A;  2D0P A;  1MA9 B;  2PZS A;  3L2U A;  1W2B M;  2HHX A;  2QWM A;  1VQO N;  1T03 A;  3DXK A;  1B9D A;  5SWM A;  1SKS A;  5M1Q A;  3D7E O;  3D2F A;  4M3W A;  4KRF A;  5KGW A;  2YHW A;  3W0L A;  1X1P A;  2OPP A;  3RR8 A;  3M5R A;  1DEJ A;  1VSD A;  3FZK A;  1KAZ A;  4JS4 A;  4KHN A;  1BCO A;  2ASP A;  4FWK A;  1T6C A;  1X9J A;  5KPR A;  3HJF A;  5F9C A;  4DV2 K;  4DFM A;  5DMR A;  4CFD A;  3L2W A;  4C1N K;  3SV4 A;  1YQL A;  4DTO A;  2D1K A;  3TWH A;  3GE1 A;  3CPW M;  2W41 A;  3HST B;  4NCA A;  1H1V A;  5AQY A;  1VQ4 N;  1HJR A;  2ASO A;  2FKF A;  1TAU A;  1IV0 A;  2O8B A;  2E8A A;  1OH6 A;  2D0A A;  1RDD A;  3CVT A;  1MU2 A;  3H08 A;  1TL3 A;  2VGM A;  3DOK A;  1G15 A;  4C8M A;  3AVG A;  2P9S B;  1B92 A;  1LAW A;  3WXJ A;  2QKK A;  2NOF A;  1E42 A;  1P8Z A;  2QWO A;  3VQE A;  3DRS A;  4ISF A;  2W42 A;  4IJN A;  3JAM O;  2O8B B;  1EBM A;  1JXB A;  3HVR A;  2ETJ A;  3LAN A;  1NBW A;  3HI0 A;  3L2Q A;  4CJE A;  3V1R A;  1VSI A;  1VAZ A;  3QEX A;  5FRN A;  2F8S A;  5BMN A;  3SMP A;  4DUL A;  3OSM A;  1KQS M;  1CXU A;  5HRN A;  2IV8 A;  4WXA A;  1JLE A;  3AVK A;  2KZZ A;  3VGK A;  4E89 A;  3QES A;  2VG7 A;  3T19 A;  1R0A A;  1XHX A;  3QFU A;  4F9O A;  1HQU A;  3ID6 A;  4JI3 K;  3V4I A;  1S1W A;  3M8S A;  3CYM A;  3M6G A;  3NAE A;  3H1V X;  3OST A;  2YNF A;  4Z4C A;  2UUA K;  3R3L A;  1TBP A;  4A61 A;  1NGC A;  3IUC A;  4ROE B;  4BRM A;  4NCG A;  5JLH A;  1QHA A;  3CM5 A;  5CR4 A;  3NGI A;  1WAJ A;  2HW3 A;  3MN5 A;  3JSM A;  3OYB A;  5HBM A;  4GW6 A;  1JXE A;  1TKD A;  1Z6R A;  1SL1 A;  4WQ5 C;  3VTI A;  3C6U A;  3KKS A;  5IYC P;  1NK7 A;  1QHT A;  4JNE A;  2E2P A;  3CCR N;  4FZZ A;  3A2F A;  3M8R A;  1DIZ A;  3DJC A;  2Y8Q A;  4JI1 K;  3NMU A;  4BE1 A;  4IFE A;  5EX5 A;  4DSI A;  1NGM A;  1U4B A;  4Y1C A;  5TKW A;  4OLA A;  2HMI A;  1W0H A;  3ASM A;  3O8M A;  4GKK K;  2BH1 A;  3EO3 A;  1IBM K;  5AQJ A;  2FUV A;  1BI4 B;  1ZBU A;  5ADX H;  3MWT A;  2I5J A;  3O3H A;  3KD5 E;  3PO5 A;  3AAP A;  4H0V B;  3ZEU B;  5M1F A;  1QQM A;  3NFA A;  1TGO A;  5KTQ A;  1QTP A;  1BA1 A;  5FRO A;  4M3Z A;  4DSL A;  1IO2 A;  3QEI A;  2HL9 A;  4EP5 A;  1YVN A;  4M3T A;  3EE8 A;  4RW9 A;  2G8I A;  1HR0 K;  2HVH A;  1B9F A;  1KTQ A;  4RWT A;  1L3U A;  4CJK A;  4CJU A;  3SMS A;  3C6T A;  3UKU A;  4DUY K;  4DS5 A;  4CHP A;  4E7L A;  4WE1 A;  4BC2 A;  2OOX A;  3NE6 A;  1OH7 A;  1YJW N;  2WTU A;  4PKG A;  5EXW A;  4DLG A;  1VTO A;  3HZ6 A;  2GBZ A;  4KH6 A;  3VOV A;  1BO5 O;  1DKG D;  3LZI A;  2D0O A;  4N56 A;  3K59 A;  5EVZ A;  2IV9 A;  4CJ5 A;  3CWS A;  4ZTJ A;  3M8P A;  4PKI A;  4H5V A;  2Z1H A;  3CWA A;  2NOE A;  2UXD K;  1ATN A;  3SJJ A;  5J2M A;  4B1Y B;  5KPZ A;  3HPO A;  2X6N A;  4IG3 A;  1NGD A;  3ZX2 A;  2G8W A;  3RMA A;  2O4G A;  2QI2 A;  2X6S A;  3NH2 A;  3WEE A;  4DQ8 A;  1Q9X A;  2CGK A;  1T6A A;  4BGB A;  3E9P A;  3BUZ B;  1HRH A;  3LP2 A;  4DTP A;  3O9T A;  1M3H A;  2XRI A;  5HRS A;  5DM7 L;  4GKJ K;  2V7Z A;  4DMN A;  1XNQ K;  2HL8 A;  2P9N B;  5I9E B;  3K5L A;  1UT4 A;  3ENH A;  3PX0 A;  1VSH A;  3TAM A;  2HST A;  4QS7 A;  1D9D A;  4FPB A;  3ZSY A;  5BMP A;  4WZS D;  1GOA A;  5LJV A;  3TAB A;  4EAJ A;  2QLV A;  4WYB A;  3PMG A;  3I56 N;  3CFP A;  4Z94 A;  4W5O A;  3OS2 A;  5JMV D;  2F96 A;  1V4S A;  4HTU A;  4M63 C;  1YIT N;  1GOB A;  1LWC A;  2GEL A;  4B1U B;  1YI2 N;  2F8T A;  1P90 A;  1RT7 A;  3OH9 A;  4QS9 A;  5BPN A;  4DU1 A;  1VOK A;  1CXQ A;  3MCP A;  1N34 K;  4K8X A;  1QZ6 A;  2PFU A;  4EP4 A;  3CI5 A;  1QQN A;  3DRR A;  2YA3 A;  4WCE L;  5AQW A;  2GUP A;  4HUE A;  2FSK A;  3ZSW A;  4KHY A;  2Q0U A;  4CF1 A;  3THY A;  2O8F B;  3G71 N;  4BVO A;  1ESV A;  3VEZ A;  4FJ9 A;  4K0K K;  1PZD A;  1NM1 A;  2NLX A;  3THW B;  3A8Y A;  3CHW A;  1XMQ K;  5M1O A;  5JIC A;  2IC3 A;  2F9W A;  5DK5 A;  1J3M A;  3RMD A;  2BUP A;  1IG9 A;  1PCM X;  4X65 K;  5KL0 A;  4FWQ A;  4BRF A;  3VA0 A;  3VES A;  4XIU A;  4X64 K;  3U8X A;  4Y0W A;  4EHU A;  1KLM A;  3RSE B;  4W5R A;  4JN4 A;  3VQ6 A;  3LDL A;  4WFB L;  3CD6 N;  1NOY A;  1LAV A;  3ISN C;  2ZJR L;  3ZT0 A;  4KI4 A;  1C47 A;  1YUW A;  4DSJ A;  3DAW A;  1JCE A;  3VGL A;  2ITM A;  3ENO C;  2GTD A;  1KXP A;  1S9E A;  4CJ3 A;  2JHJ A;  3OVN A;  3I55 N;  3WT0 A;  1YVU A;  1ASW A;  3BEX A;  3K0S A;  2FSJ A;  3D45 A;  3VQ4 A;  1Z05 A;  4FJ7 A;  2KFZ A;  1LW2 A;  4FJX A;  4BRN A;  3DLH A;  1TBA B;  1KVB A;  3N4Q A;  1WSH A;  4BC4 A;  4EIA A;  4EJZ A;  4JRQ A;  4FSV A;  4FJL A;  4I8O A;  4KTW A;  3KJV A;  1VQL N;  3J80 O;  4IO8 A;  1AIS A;  4JKA A;  3SQ0 A;  3CW7 A;  2CH5 A;  4LC9 B;  5FPN A;  2OAN A;  4B3S K;  3F2K A;  3ZT3 A;  1NJZ A;  1LWF A;  4CZG A;  4M3R A;  4FLY A;  4FPA A;  4MDB A;  4CI6 A;  2HHU A;  5AZJ A;  3G4S N;  3OGD A;  3NA5 A;  4X62 K;  4Z0U A;  1M5Q 1;  3JXU A;  3DXM B;  3AO2 A;  3AVH A;  1QSY A;  3G10 A;  5AQH A;  3UIQ A;  4IDK A;  1N32 K;  5CYQ A;  3SAG A;  3CJC A;  5BPM A;  4FJ8 A;  3W3D A;  4QS8 A;  3NVK A;  4BRP A;  5AQZ A;  2NRZ A;  4RCH A;  1HYV A;  1RT2 A;  3RRG A;  4CFA A;  5KQD A;  2CH6 A;  3HOT A;  2G30 A;  3VEN A;  4N76 A;  1P5G X;  2VWK A;  3A5O C;  4BWJ A;  3QER A;  1RT3 A;  2H5A X;  3CQX A;  1KFS A;  2NUB A;  4JKF A;  3PY8 A;  1C0T A;  4OX9 K;  2OPQ A;  3BZC A;  1YAG A;  5AQT A;  1QQO A;  1Q9U A;  4OKE A;  1M1K O;  1E3M A;  4C8L A;  2ASM A;  3S41 A;  3THX B;  4H5R A;  5I3U A;  3VQA A;  1BWF O;  3TPQ A;  1WBD A;  2P5O A;  2G8V A;  4OPH A;  4EZ9 A;  3SLC A;  2AJQ A;  3WXK A;  3OJU A;  2VGN A;  4ELV A;  4FW2 A;  3BDP A;  4O55 A;  3OSE A;  2FXU A;  4O0I A;  3P38 A;  4K42 A;  4AHV A;  4DV1 K;  4DTR A;  1WSJ A;  4C23 A;  3I3W A;  3VQB A;  4FLZ A;  4BR0 A;  1Q82 O;  4CEZ A;  3SQ2 A;  1YIJ N;  4O8U A;  1EET A;  1NKB A;  1K9M O;  1T44 A;  4ILJ A;  1NOZ A;  3O1B A;  4DTJ A;  2OCE A;  4AHC A;  1VKL A;  1XSZ A;  3T1H K;  4ELT A;  3KKR A;  1RFQ A;  4XH1 A;  3K57 A;  4BG9 A;  2OOY A;  2P9I A;  1RBT A;  1MP9 A;  3D2F B;  1RDW X;  3EZ5 A;  4BRL A;  4IXC A;  5KPT A;  4DSK A;  1LWV A;  5AZI A;  3D6R A;  1QS4 A;  4CHN A;  1W7A A;  1M3Q A;  3DLE A;  3ZX3 A;  3RVC A;  2E2O A;  1HNI A;  4E1M A;  1EKE A;  4CHO A;  3IRX A;  4CFF A;  5EPC A;  1NVP A;  5J2Q A;  4H8K A;  3F10 A;  4IOX A;  1JLF A;  3WEE B;  3CVS A;  4OPA A;  3MDQ A;  4CJV A;  4KPY A;  4CZE A;  1P5D X;  5GIN A;  2WC9 A;  3RWU A;  1FXX A;  4CGI A;  3DI6 A;  4KB1 A;  2VG6 A;  3Q7B A;  5C2D A;  1KLN A;  4KTZ A;  5A2Q O;  3ENC A;  2W40 A;  1YHQ N;  5AFU H;  4OO1 J;  3OCI A;  4GNI A;  3THX A;  1U49 A;  4DWI A;  3F5T A;  4OLB A;  4WF9 L;  1LV5 A;  4YOV A;  1JLB A;  1N8R O;  2FF3 B;  1S1T A;  3SNN A;  4LF5 K;  2YNG A;  3ZYY X;  4LFB K;  4EAI A;  3BKQ X;  3CCL N;  5FPE A;  4KO0 A;  4DQQ A;  5AQQ A;  3U9Z A;  3A5M C;  3AAR A;  1T05 A;  4YHH K;  3K9J A;  1YTU A;  1CDW A;  1FK9 A;  4AHU A;  5K14 A;  5CY4 A;  4KHP K;  4H5T A;  3ZX0 A;  1JLC A;  4FLX A;  2EHB D;  3OYK A;  3AVL A;  1VSM A;  4F2S A;  3DPT A;  1RBV A;  3VTH A;  4TPS A;  2HZS A;  1RT1 A;  3P4I A;  4BR4 A;  3TAF A;  5LJW A;  2EX3 A;  1NJW A;  1S22 A;  1FKO A;  4OGE A;  3EKS A;  2HHT A;  4O0J A;  2A42 A;  4BRI A;  1LXT A;  1KFI A;  1BI4 A;  1UA0 A;  4FVU A;  4LF9 K;  1N5Y A;  1NGH A;  1HYZ A;  3DWL A;  4V19 S;  5AQL A;  1DTQ A;  1GLE G;  5CE3 A;  1FW6 A;  1A5X A;  2Z8U A;  3HPH A;  4J8F A;  4ISE A;  4BE2 A;  4DS4 A;  5CZ1 A;  3T7Z A;  4MDA A;  5MLC Q;  4LY7 A;  3V9Z A;  4DFK A;  3CCQ N;  4LF4 K;  1VQ8 N;  3CFO A;  1FN7 A;  2NWV A;  4B1X B;  1N3A A;  5AQF A;  1TKT A;  1QN8 A;  3D2E A;  1Z26 A;  3HL8 A;  1J54 A;  2YHB A;  3TR8 A;  4DQR A;  2H4L X;  3OYG A;  4E3S A;  1K2Y X;  4CJF A;  1WUA A;  4NYN A;  3VF4 A;  3J81 O;  1N6Q A;  4A57 A;  5C12 A;  3MX2 A;  3ID8 A;  3VER A;  4DV3 K;  2G8F A;  4E7I A;  4PY5 A;  4FWP A;  3RRH A;  2P9K A;  1N33 K;  3LP1 A;  2E2Q A;  4IG0 A;  4JAX A;  4O5F A;  1SL0 A;  3CC4 N;  3EL2 A;  2GUI A;  4K41 A;  3I0S A;  4DR3 K;  1J53 A;  1ZBS A;  3O3G A;  2YI1 A;  4O4G A;  2KQ2 A;  4NYF A;  1UL7 A;  2VWJ A;  3AA4 A;  3VPZ A;  3F73 A;  1UT7 A;  4FJI A;  1SUQ A;  1V4T A;  4B1Z A;  1QN7 A;  1EP4 A;  2NLV A;  3G25 A;  3MN7 A;  3CC7 N;  4B8A B;  1HKB A;  1KRP A;  3LM9 A;  4E7J A;  1TUY A;  2IAJ A;  2O8F A;  2WOM A;  1D4X A;  4NXM K;  2I5W A;  4XH5 A;  1Q9Y A;  2FGT A;  1YTF A;  3E01 A;  3TTD A;  5KI6 A;  4PUO A;  4FZY A;  3TE5 A;  3P39 A;  2A1S A;  1VQ7 N;  3B6O A;  3BZK A;  2IOC A;  4J2D A;  1HQE A;  3M3Z A;  5CHI A;  3AO1 A;  2DKA A;  5JLF A;  3SYZ A;  3ZSR A;  3ZSX A;  4KHQ A;  1VRU A;  4ILG B;  1K73 O;  5EU7 A;  5JS2 A;  4KH4 A;  3WNE A;  1XC9 A;  1BIZ A;  4H4O A;  3ATU A;  2Y1J A;  1I3A A;  1HMV A;  5GIP A;  2QWQ A;  2UU9 K;  1JCF A;  3OYD A;  1JLA A;  1RDB A;  1S1U A;  4IBN A;  3DXM A;  3GG4 A;  3Q7C A;  4CIG A;  4DHY A;  1WBB A;  1KYD A;  4MRQ A;  1DLO A;  1JL2 A;  2X78 A;  1L3S A;  4JKG B;  2V9J A;  4AQY K;  2NRH A;  5C2F A;  4EAL A;  2ZM6 K;  1QN3 A;  1U47 A;  3HP9 A;  4JKG A;  5HRP A;  2JPI A;  3C65 A;  3FFK B;  1Q7Y O;  2G8K A;  3H46 O;  2YNH A;  5KRS A;  2HBJ A;  4IFV A;  4RW8 A;  1HNW K;  1KYU A;  3DLL L;  4BDP A;  3R8E A;  4BRD A;  3AVI A;  1QZ5 A;  3ULE B;  2PYL A;  3S3O A;  4NB4 A;  3SPY A;  1FKP A;  2DFE A;  2KLA A;  1ATR A;  2HOE A;  3FGU A;  4M41 A;  4EAH D;  2WFB A;  4FM1 A;  1QE1 A;  3C6A A;  3SUO A;  1MWK A;  1ASU A;  1IH7 A;  2KW4 A;  2YNI A;  2ZJQ L;  4M3X A;  2ZD1 A;  2NRV A;  1U04 A;  2W6L A;  3NDK A;  3G0Z A;  1M90 O;  2P1J A;  4FWM A;  3DLB A;  3IFR A;  1MWM A;  3CXC M;  1KFQ A;  5AQI A;  1E4G T;  2MJ7 A;  5AQO A;  1NK8 A;  5M1K A;  1HLU A;  3IAY A;  1QN4 A;  1J5E K;  1T6D A;  1SKR A;  1LWE A;  4LF7 K;  2HKP A;  4DR7 K;  1C9B B;  4ICL A;  4M7X A;  2Z1G A;  2Y8L A;  1RTJ A;  4DTM A;  4DU4 A;  3VN5 A;  4Z4E A;  4OPJ A;  3NGZ A;  4B3M K;  4CZJ A;  1K35 A;  3H1Z A;  4CZH A;  5LMU K;  4BR9 A;  3NF9 A;  4DTU A;  4BAC A;  3L4Q A;  4KH5 A;  2UXC K;  4JI8 K;  4BQL A;  5JS1 A;  1BA0 A;  3CQY A;  3AGK A;  3ZT4 A;  3C7N A;  1C0F A;  2VCP A;  3ALY A;  4CJS A;  3LDO A;  4CZL A;  5F0X A;  3L2R A;  2A5X A;  5AQU A;  4BRK A;  2KFN A;  1S6Q A;  4B1V A;  5BRD A;  4H0Y B;  3QFP A;  1QVG M;  4CGJ A;  1VQK N;  3SBT A;  1W9H A;  3HRG A;  3S3N A;  2BGG A;  3AA2 A;  4MLH A;  3RMC A;  1X9W A;  5FDL A;  4NCB A;  4LD0 A;  3PLA A;  4BRC A;  1NG9 A;  3LP0 A;  4CJ7 A;  3O3F A;  3NF7 A;  1SL2 A;  1QN9 A;  1YTA A;  4DV0 K;  3QDK A;  3AVA A;  3VET A;  1C0M A;  1REV A;  2FBV A;  3OA9 A;  4JK8 A;  4G9Z A;  3KWI A;  4PKH A;  2EHG A;  3D7Q A;  1NMD A;  3WXI A;  1U6Z A;  3HBT A;  4BWM A;  4GV6 A;  3AVJ A;  2QK9 A;  3VEO A;  2WUS A;  5KGX A;  2AA4 A;  4UQG A;  1KC8 O;  4H0O A;  2E1Y A;  3V9S A;  3BGR A;  4XH4 A;  1NJX A;  3A5L C;  1IKV A;  5FPM A;  3TAN A;  2BTF A;  2KHO A;  3EKU A;  1KO9 A;  3IH7 A;  1VQ6 N;  4AIL C;  3MEC A;  2F9T A;  1NGI A;  3H3O B;  3K58 A;  1KAX A;  3MMV A;  1BL3 A;  3AO5 A;  2IVN A;  3SCX A;  2A6A A;  3CJA A;  1NKE A;  3VQ8 A;  2E6L A;  3HT3 A;  1QTS A;  5AN4 A;  1TVR A;  1S6P A;  3P31 A;  4W5Q A;  4E7H A;  4M45 A;  2QRC A;  4U67 L;  5GAD P;  4ROC B;  4DV6 K;  1ZBI A;  3I33 A;  4H0X B;  4DTN A;  1EO1 A;  3CJ9 A;  2XY7 A;  3E1Y A;  1Q8I A;  1NGG A;  1NGA A;  1BIS A;  4FM2 A;  1VSF A;  4CK2 A;  3OJS A;  5GAE P;  4UY8 O;  1S1V A;  3V9U A;  4BRQ A;  3TDH A;  5JVH L;  4CJP A;  3P5J A;  3C95 A;  4OPK A;  5FPD A;  3RSE A;  1X9S A;  3LPT A;  4DTS A;  1RTD A;  4H0P A;  1A5V A;  2I7P A;  4B0A A;  4CF9 A;  4EHT A;  4BRO A;  3CME N;  3TSP A;  1TUU A;  5AZJ B;  4IL8 A;  3FZF A;  3NH1 A;  1YQR A;  3ULE A;  1GLF O;  1C0G A;  4FL9 A;  1L3V A;  2Q1N A;  4Z4F A;  3SBG A;  5F1X A;  2CGL A;  4CGH A;  3I0W A;  4BC5 A;  1FJG K;  4KV8 A;  2P9L B;  2NRR A;  4QAG A;  1RTI A;  4IWV A;  4QG5 A;  1RNH A;  4NXN K;  3AVN A;  3ENO A;  4JD2 B;  3PIO L;  4I6M A;  4QCL A;  3VQ7 A;  2RPI A;  3A0I X;  3ZET A;  4AF1 A;  4FLW A;  2ZGZ A;  4MO4 A;  1DTT A;  3O08 A;  2DKD A;  3MED A;  3SJH A;  4F4K A;  3KTU A;  1PVS A;  4E7K A;  5IYD P;  2R7Y A;  1TK5 A;  4BG8 A;  2F7T A;  3HM9 A;  4FJK A;  3HTV A;  1VOL B;  4BJU A;  1ZBL A;  1R4X A;  2ZJP L;  4BDZ A;  4DSF A;  1S72 N;  1G99 A;  1WLJ A;  4CES A;  4DTX A;  3SZ2 A;  4HJH A;  3D0P A;  2HNZ A;  4FWR A;  1YT3 A;  4WFN L;  4DFJ A;  3BF3 A;  1TL1 A;  2P51 A;  4Q0B A;  2O8E A;  3RSM A;  4FWO A;  4I9Q A;  5BN9 A;  1NH2 A;  1VK0 A;  3M8Q A;  3MAQ A;  1S1X A;  2Z0F A;  2QKB A;  4IOA L;  1YQK A;  1NWK A;  1L5U A;  3VEW A;  3THW A;  2O4I A;  4AM6 A;  2XHB A;  4I9L A;  2GX9 A;  4FZX C;  4FK0 A;  3AO4 A;  3GBT A;  3B6P A;  4JV5 K;  3K2P A;  1KY6 A;  4FWN A;  1VQ9 N;  2P9S A;  5BRF A;  4KTQ A;  3OYE A;  3CPE A;  5HOO A;  3SAF A;  5E26 A;  1D9F A;  1GLC G;  3CJ1 A;  2PAV A;  4CER A;  1RT4 A;  3QEW A;  4CGF A;  1VHX A;  1TK0 A;  1QVF M;  2HB5 A;  3DLG A;  4FWL A;  3LM2 A;  4B9L A;  3WQT A;  3VEY A;  2YHA A;  1GLJ O;  1GLL O;  1NNE A;  3O4N A;  3N89 A;  2WBN A;  3I0R A;  3TTC A;  3WQU A;  1JFI C;  3THV A;  2QWL A;  3OTO K;  1BUP A;  3T1Y K;  3DMJ A;  2QA4 N;  1VSE A;  1KSP A;  3ZT1 A;  3EEQ A;  2PWW A;  1KY7 A;  5IWA K;  3ENB A;  2QEX N;  4JS5 A;  4DCH A;  3AVM A;  1NGB A;  4IFY A;  2IVO A;  4RG8 A;  1TGH A;  4GV9 A;  1OKJ A;  2P9P A;  4I6M B;  1LWY A;  3AA5 X;  1JLG A;  4YOY A;  3D2E B;  3LDP A;  3WXL A;  2P5G A;  3RTV A;  1VQM N;  1YJN N;  3KLG A;  1HYS A;  3I8D A;  1RDC A;  3CCU N;  5C25 A;  3MCA B;  5IYB P;  3CCJ N;  3QLH A;  1CLQ A;  3H6E A;  1QSL A;  4B8C A;  1SV5 A;  3UB5 A;  2UYT A;  2PYJ A;  5AR0 A;  3O80 A;  2NRW A;  4TSX A;  4C8N A;  4FO0 A;  3LDQ A;  4DF4 A;  3CFR A;  3RMB A;  2XY5 A;  3SUP A;  4LF8 K;  1WOQ A;  3F9M A;  1U48 A;  2RE2 A;  2D0B A;  3T1A A;  3E9O A;  4DFP A;  1NGJ A;  1HNZ K;  1RBU A;  4JI5 K;  3SK3 A;  3OYF A;  3PX6 A;  2NOL A;  1CZ9 A;  1VTL E;  1ASV A;  1F21 A;  1Q18 A;  2QRD A;  2ZFD B;  3CCV N;  4WQ4 A;  4CJL A;  3L3V A;  3HK2 A;  2ATQ A;  4CZI A;  3QET A;  4DQP A;  2RHK A;  2ZGY A;  3C94 A;  2PBD A;  4JKC A;  3H3N O;  2NOI A;  3EYZ A;  2HZM A;  2RF2 A;  3VQ9 A;  2DFH A;  4EJY A;  4JKB A;  4E19 A;  2F4V K;  2H3G X;  1TV6 A;  2ZWH A;  1WN7 A;  4KHW A;  4KB0 A;  2QWR A;  3QBW A;  4AHR A;  3ZT2 A;  3NBP A;  4N47 A;  2V7Y A;  4CIE A;  1MDU B;  2ZF5 O;  4CZM A;  4A62 A;  4BR5 A;  1HNV A;  5AQP A;  1O13 A;  3PV8 A;  3WNG A;  1VQN N;  4CIF A;  3OYA A;  1J6Z A;  5SZT A;  1RDU A;  2HF4 A;  3THY B;  1ZYQ A;  1ZC6 A;  4M7Y A;  2V92 A;  1C1C A;  1VQP N;  5AQN A;  2B6A A;  3EIK A;  4FJG A;  4F3T A;  4KKO A;  4CEF A;  4Z4H A;  3ZSZ A;  4PA1 A;  3E66 A;  1Q81 O;  2E20 A;  4WQ4 C;  3QIN A;  3HO1 A;  1C1A A;  2O8D A;  3DOL A;  4M3U A;  1NJI O;  3CCM N;  4CF0 A;  3T3F A;  1WQA A;  5DM6 L;  5T7B A;  3CG7 A;  1Y97 A;  4HUF A;  5M1N A;  2JWL A;  3HOS A;  3LWL A;  1KCF A;  3MXM A;  2XO7 A;  3TAG A;  4CEC A;  1QN6 A;  1LW0 A;  4G1Q A;  3TAP A;  3BY5 A;  1ZBH A;  3VA3 A;  3OBW A;  4RW7 A;  3FLC O;  4BR7 A;  4XEI A;  1OVY A;  1VQ5 N;  4Z4I A;  3MEG A;  2HHH K;  2F7L A;  4IJA A;  2QRE A;  3TTF A;  2PY5 A;  1U2V B;  1YQM A;  5LMN K;  3DXK B;  4CED A;  2BAN A;  3FZH A;  3O4W A;  4C8O A;  4FJ5 A;  1WJW A;  3MXJ A;  3NVM A;  4DSE A;  3AVB A;  3MN6 A;  4DB3 A;  4WFA L;  3ULX A;  3C7N B;  3VQC A;  1NKC A;  1EQY A;  1KD1 O;  1RGI A;  5E84 A;  5AQK A;  2WON A;  4B3O A;  5HSH A;  2LAE A;  1DT9 A;  3MK6 A;  4FXD A;  4JKD A;  3SUQ A;  5J2P A;  3FR0 A;  2HHV A;  3J7A P;  2DKC A;  1D3U A;  1HPZ A;  3KLH A;  1MPG A;  3KD1 E;  2YHY A;  4A5A A;  2P9U B;  3C6H A;  3R6M A;  4CEO A;  4PHT X;  2RKI A;  1V5S A;  4AHT A;  3CCE N;  3C04 A;  4ID5 A;  2BE2 A;  4YY3 K;  3S3M A;  3OYN A;  4I2P A;  2IIR A;  3OC3 C;  2VYP A;  4DR1 K;  3DLR A;  1C6V A;  5CYM A;  4B08 A;  2YKM A;  1B9K A;  1BU6 O;  1VRT A;  4C8K A;  3MN9 A;  1D8Y A;  2JLE A;  1WSF A;  3MEE A;  4U7B A;  1QTM A;  4B9Q A;  2HHQ A;  2Q97 A;  3OHR A;  1KAY A;  2UXB K;  4JKH A;  3OYJ A;  4ILH A;  4FVM A;  3PSI A;  4YNQ A;  4DR4 K;  3CWT A;  3BP8 A;  2XY6 A;  2FLO A;  3TSQ A;  5BPL A;  1QN5 A;  3WUH A;  3CET A;  4Z4G A;  3CQ8 A;  1K6Y A;  4JHD A;  5LL6 Z;  4N5S A;  4CE9 A;  1NK0 A;  1SAZ A;  4PQU A;  2HF3 A;  4GY2 B;  4HCC A;  3KRM A;  3IDH A;  3TAE A;  1IKW A;  3HXM A;  2JHN A;  4IO9 L;  1HPM A;  1XI1 A;  4JEP A;  2V51 B;  1BQM A;  2Q36 A;  4KHS A;  3O1W A;  4YOU A;  4K25 A;  3O9U A;  2QTD A;  1BCM A;  5AQS A;  4CBU A;  3KLI A;  3T4N A;  3IMX A;  3QIC A;  4H0T B;  4X66 K;  5C15 A;  3HS9 A;  2E4L A;  3K5N A;  2XHI A;  1NLV A;  4JI6 K;  2O3O A;  2B4J A;  3KTQ A;  4ELU A;  3JYT A;  1LCU A;  2YJE A;  1ZBF A;  3AO3 A;  1QNA A;  4BQZ A;  3CC2 N;  2HND A;  1A5W A;  3KLF A;  1IKX A;  4LFC K;  3HPG A;  3CJ7 A;  1W80 A;  2IDO A;  4FJN A;  4FJM A;  2BDP A;  5H1S Q;  1EXQ A;  3KLE A;  4LFA K;  2QWN A;  4HWI A;  3OS0 A;  3MXI A;  2VG5 A;  5BN8 A;  2OPR A;  3HVT A;  4DG1 A;  1WNS A;  4MLE A;  3L8B A;  2OZM A;  3QNO A;  4JI2 K;  3UW2 A;  4BRH A;  5TKY A;  3VMF B;  1NK5 A;  3QEV A;  2NVM A;  3QBX A;  2KKZ A;  1NK6 A;  4R5P A;  4E1N A;  4DR5 K;  4KHU A;  3PUF A;  1JCG A;  3SAH A;  4IEE A;  1N36 K;  2YKN A;  2A1R A;  3NH0 A;  2NRX A;  4CJQ A;  5JMV A;  5JVG L;  2VJ0 A;  4IOC L;  3QB0 A;  1YJ9 N;  3KWG A;  2J4R A;  4LSL A;  3DPU A;  1KYF A;  3UE5 A;  3O9S A;  1JJ2 M;  1KVC A;  3P1G A;  4H5W A;  4DR6 K;  4H4M A;  1EWR A;  4KBO A;  3LAL A;  2OA8 A;  1HUX A;  2JGU A;  4EFH A;  2UUC K;  3SI6 A;  1PCJ X;  4GMJ B;  4O44 A;  5JN5 A;  4B9S A;  3B8A X;  3UKR B;  4HCB A;  3LP3 A;  3S9H A;  3ZET B;  1UAX A;  4YFU A;  1HKG A;  1I94 K;  3VEV A;  4JD2 A;  3VQP A;  3AV9 A;  4J2E A;  1EWQ A;  4YOR A;  2EWS A;  3LL3 A;  2YX6 A;  4IEI A;  3T69 A;  5B8H A;  5ELZ A;  1EUV A;  4LSN A;  3H1Q A;  2HHS A;  3PX4 A;  2O8D B;  3EN9 A;  3RPJ A;  3O9Q A;  3ULD A;  3SUN A;  3OYC A;  3KK2 A;  3D4V A;  3AY9 A;  5FLX O;  2DFF A;  2D0C A;  1SQK A;  4BVP A;  1TUO A;  4JK9 A;  3PDK A;  4ID1 A;  1XHZ A;  3V81 A;  4MQ3 A;  3OLP A;  4F2R A;  3L0Q A;  3ZSQ A;  2QR1 A;  3OYH A;  1XUP O;  2ZE2 A;  3V9X A;  4M42 A;  4RW6 A;  3PIP L;  1T3V A;  3K5O A;  5E41 A;  2UUB K;  1ITG A;  4BC3 A;  2B5J A;  4K43 A;  4CFC A;  5D3G A;  4CHY A;  4DF8 A;  4BRE A;  1TYQ A;  3CM6 A;  3R1X A;  5M1P A;  4CEQ A;  1HKC A;  1XNR K;  4AHS A;  4JI0 K;  3IS9 A;  1XQS C;  2VQF K;  4AM7 A;  2A3Z A;  2O8C B;  1WSG A;  1RBR A;  3U3Y A;  3KVG A;  2NOZ A;  4YDU A;  3J7Y P;  4BY9 C;  3EE9 A;  4FW1 A;  5AQR A;  3U6F A;  1X3M A;  1NJY A;  4BRA A;  3OYI A;  1K8K B;  1TYQ B;  5C24 A;  1SZ2 A;  4ZHR A;  4CZK A;  1WSE A;  3FE1 A;  4JRP A;  3GOI A;  3SQ1 A;  3I8B A;  4CEA A;  2DTU A;  3ZEU A;  3OW2 M;  2E88 A;  1XC3 A;  3KK3 A;  1RM1 A;  1BIU A;  5EOY A;  5AQG A;  2YCH A;  3K5M A;  3LZJ A;  4B9U A;  3WXM B;  1YF5 L;  2FBT A;  2MZ8 A;  1K8A O;  4DQI A;  2P9U A;  5EY4 A;  3A5N C;  3J7Z O;  3CF5 L;  3TU5 A;  4FLT A;  2W6K A;  4M3Y A;  4RW4 A;  3AA3 A;  2GEM A;  1JKH A;  4ROD B;  2FBY A;  2D4W A;  3I0X A;  3L3U A;  2HBM A;  4MFB A;  4E0D A;  3U3G A;  2YJF A;  4DUZ K;  3SNS A;  4HUG A;  1RCH A;  2GWJ A;  4YDU C;  5F2R A;  2YH5 A;  1GLD G;  3LDN A;  3HP6 A;  2QWP A;  4ZTF A;  4FLU A;  1QQC A;  2KTQ A;  4BE0 A;  5C0Y A;  3ITH A;  5KRT A;  2YV0 X;  3AVC A;  2KZM A;  3V1Q A;  3TI0 A;  1N3C A;  3DLK A;  2OTL N;  3GL1 A;  1S9G A;  4QOZ B;  4LH4 A;  1C4G A;  2YHX A;  3VQ5 A;  1BGX T;  4D7R A; 
#chains in the Genus database with same CATH homology
 3LAK A;  1CZB A;  2GUI A;  1XWL A;  4DSI A;  4KI6 A;  1NGM A;  1U4B A;  3I0S A;  4TSX A;  4Y1C A;  4OLA A;  2QXF A;  4C8N A;  1J53 A;  2HMI A;  1W0H A;  2FC0 A;  2IGI A;  3ASM A;  1KVA A;  3O3G A;  3OY9 A;  4O4G A;  2KQ2 A;  4NYF A;  4DF4 A;  3CFR A;  3RMB A;  2XY5 A;  4FJH A;  1BI4 B;  3SUP A;  2HVI A;  2VWJ A;  1ZBU A;  4CJ4 A;  3AA4 A;  4I7F A;  2I5J A;  1U48 A;  3O3H A;  4HVJ A;  3KD5 E;  3PO5 A;  3F73 A;  2Z1J A;  2D0B A;  3T1A A;  3NF8 A;  1T8E A;  1UT7 A;  4DFP A;  1RBU A;  3NFA A;  3OYF A;  3PX6 A;  1TGO A;  3ZCM A;  2NOL A;  1CZ9 A;  4Y1D A;  1VTL E;  1ASV A;  1F21 A;  4FJI A;  1SUQ A;  3LAM A;  5KTQ A;  3V1O A;  1QTP A;  5FRO A;  4CJL A;  3L3V A;  4DSL A;  4M3Z A;  1QN7 A;  1IO2 A;  1EP4 A;  3QEI A;  2ATQ A;  3HK2 A;  2NOB A;  4EP5 A;  3QET A;  4M3T A;  4LH5 A;  4DQP A;  4B8A B;  4RW9 A;  1KRP A;  2Z1I A;  2G8I A;  2HVH A;  2G8U A;  3C94 A;  1B9F A;  1KTQ A;  1L3U A;  4CJK A;  4CJU A;  4FCY A;  2NOI A;  3EYZ A;  4E7J A;  2HZM A;  3C6T A;  2IAJ A;  2ZQB A;  4DS5 A;  2RF2 A;  4OKK A;  3VQ9 A;  4CHP A;  4E7L A;  2WOM A;  3TAR A;  2DFH A;  4EJY A;  4WE1 A;  3NE6 A;  2I5W A;  4E19 A;  1KFD A;  1Q9Y A;  1TV6 A;  2FGT A;  1YTF A;  3E01 A;  1RT6 A;  1WN7 A;  5FRM A;  5KI6 A;  4KHW A;  4DLG A;  1VTO A;  4KB0 A;  4PUO A;  5HRO A;  4FZY A;  4O5B A;  4AHR A;  2GBZ A;  3ZT2 A;  3DM2 A;  3NBP A;  4N47 A;  3LZI A;  4CIE A;  1T7P A;  2A1S A;  3IG1 A;  3B6O A;  1HNV A;  2IOC A;  4J2D A;  1HQE A;  1S5J A;  4N56 A;  3K59 A;  3PV8 A;  5C42 A;  4FYD A;  3AO1 A;  3WNG A;  1U45 A;  2IV9 A;  4CIF A;  3ZSR A;  3OYA A;  3SYZ A;  1QNB A;  4CJ5 A;  5SZT A;  3ZSX A;  4ZTJ A;  3M8P A;  1ZYQ A;  4FJG A;  4M42 A;  1C1C A;  2HNY A;  4KHQ A;  2B6A A;  3EIK A;  2NOE A;  1VRU A;  2Z1H A;  4CJT A;  3SJJ A;  4B9V A;  5J2M A;  3ZSV A;  5EU7 A;  4F3T A;  5JS2 A;  4KKO A;  4CEF A;  2X6N A;  4Z4H A;  4IG3 A;  3ZSZ A;  3HPO A;  3QIP A;  4PA1 A;  3WNE A;  1XC9 A;  1BIZ A;  4H4O A;  3QNN A;  2Y1J A;  4CJR A;  3QIN A;  1I3A A;  2G8W A;  1HMV A;  3RMA A;  3HO1 A;  1C1A A;  2O4G A;  3DOL A;  2X6S A;  1C0U A;  3NH2 A;  4FM0 A;  3SQ4 A;  3OYD A;  1NK9 A;  1Q9X A;  4M3U A;  1JLA A;  4CF0 A;  3T3F A;  2DY4 A;  1I39 A;  1RDB A;  2HHW A;  1S1U A;  3CG7 A;  4IBN A;  1Y97 A;  4CIG A;  5T7B A;  1HRH A;  3LP2 A;  4HUF A;  4CHZ A;  4DTP A;  1M3H A;  3LWL A;  2XRI A;  5HRS A;  1KCF A;  1KYD A;  3MXM A;  1DLO A;  1JL2 A;  2X78 A;  2XO7 A;  4DMN A;  1L3S A;  3TAG A;  3K5L A;  1UT4 A;  4CEC A;  3PX0 A;  1QN6 A;  1LW0 A;  4G1Q A;  3TAP A;  1J9A A;  1VSH A;  3TAM A;  2G8H A;  4CCH A;  1D9D A;  1ZBH A;  4IKF A;  3VA3 A;  3ZSY A;  4WZS D;  1GOA A;  1QN3 A;  4RW7 A;  3TAB A;  4Q5V A;  1N39 A;  1U47 A;  1L3T A;  2Y1I A;  4Z4I A;  3HP9 A;  3MEG A;  4KFB A;  5HRP A;  1SKW A;  2G8K A;  4OJR A;  3HYF A;  3CFP A;  3PY8 A;  4W5O A;  3OS2 A;  2YNH A;  3LWM A;  4FJJ A;  2PY5 A;  5KRS A;  4K8Z A;  4OKJ A;  4IFV A;  2F96 A;  1YQM A;  4RW8 A;  4CED A;  4HTU A;  1KYU A;  1GOB A;  1LWC A;  2BAN A;  3TAQ A;  4BDP A;  2F8T A;  1RT7 A;  3QEP A;  3NCI A;  3AVI A;  4C8O A;  2PYL A;  3S3O A;  4FJ5 A;  3SPY A;  3MXJ A;  1FKP A;  2FBX A;  1QSS A;  1RT5 A;  2DFE A;  4DU1 A;  1TKX A;  4DSE A;  3AVB A;  1VOK A;  1CXQ A;  4M41 A;  4BE1 A;  3ULX A;  4K8X A;  4EP4 A;  4FM1 A;  3DRR A;  1QE1 A;  3SUO A;  3VQC A;  1NKC A;  4HUE A;  1ASU A;  3WNF A;  2NOH A;  3F9K A;  3ZSW A;  1JL1 A;  1IH7 A;  2KW4 A;  2YNI A;  4CF1 A;  4M3X A;  2ZD1 A;  2WON A;  4KHY A;  4B3O A;  1U04 A;  1WAF A;  3PO4 A;  4FJ9 A;  2LAE A;  3NDK A;  3G0Z A;  3P83 D;  4FXD A;  3SUQ A;  1PZD A;  5J2P A;  2HHV A;  2P1J A;  3RR7 A;  2IC3 A;  3DLB A;  3FFI A;  1D3U A;  1HPZ A;  5DK5 A;  3KLH A;  3RMD A;  1IG9 A;  1UWB A;  2XY8 A;  5HP1 A;  3KD1 E;  3VA0 A;  4EZ6 A;  1NK8 A;  2MJ7 A;  4XIU A;  4HHT A;  1JLQ A;  4CEO A;  3IAY A;  2RKI A;  3DRP A;  1QN4 A;  4AHT A;  1KLM A;  1SKR A;  1LWE A;  2KTQ A;  1VSL A;  4ID5 A;  2BE2 A;  4W5R A;  1C9B B;  4PWD A;  3VQ6 A;  4ICL A;  3S3M A;  3OYN A;  2RN2 A;  2Z1G A;  1LAV A;  4I2P A;  1NOY A;  4KAZ A;  3VQQ A;  3OC3 C;  3ISN C;  3ZT0 A;  1RTJ A;  1TKZ A;  3DLR A;  4DTM A;  4KI4 A;  1C6V A;  5CYM A;  4B08 A;  3V9W A;  4DU4 A;  4DSJ A;  3VN5 A;  4Z4E A;  2YKM A;  4FK4 A;  1B9K A;  1VRT A;  4C8K A;  1D8Y A;  4CK3 A;  4OPJ A;  3NGZ A;  2JLE A;  1S9E A;  1WSF A;  3MEE A;  4CJ3 A;  3OVN A;  1QTM A;  3H1Z A;  2HHQ A;  4N41 A;  3O4Q A;  1YVU A;  1ASW A;  1RIL A;  3OYJ A;  3NF9 A;  3D45 A;  4Q11 A;  4FVM A;  3VQ4 A;  4YNQ A;  4BAC A;  4DTU A;  1TAQ A;  4FJ7 A;  2XY6 A;  3NF6 A;  2KFZ A;  1LW2 A;  1J5O A;  1IKY A;  5JS1 A;  4CGG A;  1QN5 A;  4B9T A;  4FJX A;  4Z4G A;  3ZT4 A;  4DU3 A;  3DLH A;  3CQ8 A;  1VSJ A;  1TBA B;  3QO9 A;  1K6Y A;  1KVB A;  4N5S A;  1WSH A;  4CE9 A;  1NK0 A;  3ALY A;  4CJS A;  1D5A A;  4PQU A;  4EJZ A;  4JRQ A;  3L2R A;  3WNH A;  4FJL A;  4I8O A;  4I2Q A;  2E6M A;  2IS3 A;  2OPS A;  4KTW A;  3KRM A;  3DYA A;  4HCC A;  3KJV A;  3TAE A;  2KFN A;  1S6Q A;  1IKW A;  3HXM A;  1WSI A;  5J1E A;  1AIS A;  3SQ0 A;  4CGJ A;  1XI1 A;  1W9H A;  3S3N A;  1TK8 A;  2BGG A;  1BQM A;  3AA2 A;  3ZSO A;  3RMC A;  3ZT3 A;  4CK1 A;  5FDL A;  2JOI A;  1NJZ A;  1X9W A;  4KHS A;  1LWF A;  4FLY A;  4M3R A;  4CF2 A;  4NCB A;  4LD0 A;  4CF8 A;  3KK1 A;  2HHU A;  1BCM A;  3LP0 A;  3AVF A;  4J2B A;  3O3F A;  3NF7 A;  1SL2 A;  3F0Z A;  1QN9 A;  3KLI A;  4Z0U A;  1YTA A;  3HS9 A;  3KIO A;  3AVA A;  2E4L A;  1C0M A;  1REV A;  2D5R A;  2FBV A;  1UOC A;  3NHG A;  4F3O A;  3K5N A;  4CEB A;  3AO2 A;  3AVH A;  4CGD A;  1QSY A;  2EHG A;  3G10 A;  2XHI A;  1C1B A;  4IDK A;  4BDY A;  3UIQ A;  1VSK A;  4L8R B;  5CYQ A;  4CFB A;  4BWM A;  2O3O A;  2B4J A;  3KTQ A;  1BHL A;  2X74 A;  4ELU A;  3JYT A;  4FJ8 A;  4KRE A;  3AVJ A;  2QK9 A;  1ZBF A;  3AO3 A;  5KGX A;  1QNA A;  4JLH A;  4UQG A;  3V9S A;  3BGR A;  1NJX A;  4DQS A;  1HYV A;  1IKV A;  2HND A;  2Q3S A;  1A5W A;  3TAN A;  4J2A A;  3KLF A;  1IKX A;  1RT2 A;  3RRG A;  3HPG A;  3V6D A;  1W80 A;  4CFA A;  1KO9 A;  3IH7 A;  2IDO A;  4AIL C;  4FJN A;  4FJM A;  3MEC A;  2G30 A;  4N76 A;  3K58 A;  2VWK A;  2BDP A;  1QNE A;  1BL3 A;  1EXQ A;  3AO5 A;  4BWJ A;  3KLE A;  1EX4 A;  3QER A;  1RT3 A;  3OS0 A;  3SCX A;  1KFS A;  4CEE A;  3MXI A;  2NUB A;  2VG5 A;  1PCZ A;  2OPR A;  3HVT A;  4DG1 A;  1WNS A;  3VQ8 A;  1C0T A;  2E6L A;  3OYL A;  3HT3 A;  3L8B A;  1QTS A;  5AN4 A;  1TVR A;  3QNO A;  2OZM A;  3L2V A;  1S6P A;  1RBS A;  2OPQ A;  5J2N A;  4W5Q A;  4OKE A;  4M45 A;  4E7H A;  1NK5 A;  4C8L A;  4ROC B;  5I3U A;  3QEV A;  1ZBI A;  3VQA A;  4DTN A;  1O1W A;  4KHN A;  2XY7 A;  1Q8I A;  5HRR A;  4AH9 A;  1NK6 A;  2G8V A;  4R5P A;  4E1N A;  2P5O A;  4EZ9 A;  2AJQ A;  3OJU A;  3HS8 A;  1BIS A;  1BQN A;  4KHU A;  1HU0 A;  1VSF A;  4CK2 A;  3OJS A;  4FM2 A;  4ELV A;  4FW2 A;  3BDP A;  3PUF A;  4O55 A;  1GOC A;  4O0I A;  5CZ2 A;  4AHV A;  1S1V A;  4DTR A;  1WSJ A;  3V9U A;  4FLZ A;  3VQB A;  2YKN A;  2A1R A;  1X9M A;  4CEZ A;  2OYQ A;  3NH0 A;  3SQ2 A;  4CJQ A;  2ITG A;  2VJ0 A;  4CJP A;  3P5J A;  1Z25 A;  1EET A;  3C95 A;  5I42 A;  1NKB A;  4OPK A;  1X9S A;  3LPT A;  3SPZ A;  3VQD A;  1NOZ A;  4DTJ A;  1RTH A;  2LSN A;  4FLV A;  4DTS A;  1RTD A;  3EY1 A;  4AHC A;  1LWW A;  1A5V A;  3LPU A;  4CF9 A;  4B0A A;  1RDA A;  4LSL A;  3DPU A;  1KYF A;  3OS1 A;  3LDS A;  4W5N A;  5HLF A;  4ELT A;  3KKR A;  1KVC A;  3P1G A;  3NH1 A;  1UA1 A;  1YQR A;  4H4M A;  3NGY A;  3K57 A;  1L3V A;  1RBT A;  3SV3 A;  2OZS A;  1MP9 A;  3LAL A;  4GVM A;  2OA8 A;  4Z4F A;  3EZ5 A;  2JGU A;  4CGH A;  4DSK A;  3I0W A;  1LWV A;  4KV8 A;  3SI6 A;  4GMJ B;  4O44 A;  4B9S A;  1QNC A;  1QS4 A;  4CHN A;  4F8R A;  1YTB A;  2GV9 A;  4FK2 A;  4B9N A;  4QAG A;  1RTI A;  4OVL A;  4HCB A;  1M3Q A;  3DLE A;  3OYM A;  4DLE A;  3LP3 A;  1RNH A;  4W5T A;  1HNI A;  3AVN A;  3S9H A;  1UAX A;  4YFU A;  4QCL A;  4E1M A;  1EKE A;  4CHO A;  4OGC A;  3VQ7 A;  4CJW A;  4B9M A;  2RPI A;  3VQP A;  3AV9 A;  4J2E A;  3IRX A;  3QIO A;  4CHQ A;  4FLW A;  1NK4 A;  1DTT A;  1NVP A;  3L2U A;  2PZS A;  2HHX A;  5J2Q A;  4H8K A;  1T03 A;  3F10 A;  1B9D A;  5SWM A;  3MED A;  1SKS A;  4F4K A;  4LSN A;  1JLF A;  3KTU A;  4CJV A;  2HHS A;  4E7K A;  3PX4 A;  5IYD P;  4KPY A;  3RPJ A;  3ULD A;  4M3W A;  2R7Y A;  3OYC A;  3KK2 A;  3SUN A;  5KGW A;  1TK5 A;  4KRF A;  3HM9 A;  1X1P A;  4FJK A;  2OPP A;  2DFF A;  2D0C A;  3RR8 A;  3RWU A;  1VOL B;  1FXX A;  1VSD A;  4JS4 A;  4ID1 A;  1ZBL A;  4CGI A;  1R4X A;  1XHZ A;  3V81 A;  1BCO A;  3DI6 A;  4MQ3 A;  4KB1 A;  4BDZ A;  4DSF A;  2VG6 A;  4F2R A;  3ZSQ A;  3HJF A;  1KLN A;  1WLJ A;  4KTZ A;  4CES A;  3OYH A;  3SZ2 A;  5DMR A;  4CFD A;  2ZE2 A;  3L2W A;  3V9X A;  4DTX A;  4DFM A;  3D0P A;  3SV4 A;  1YQL A;  4RW6 A;  4DTO A;  3OCI A;  2HNZ A;  1YT3 A;  4DFJ A;  3TWH A;  1U49 A;  4DWI A;  4OLB A;  1TL1 A;  2P51 A;  3K5O A;  3HST B;  1LV5 A;  4NCA A;  4Q0B A;  5E41 A;  4I9Q A;  1ITG A;  1NH2 A;  1JLB A;  1VK0 A;  2B5J A;  3M8Q A;  1S1X A;  4CFC A;  3MAQ A;  1HJR A;  1S1T A;  4CHY A;  4DF8 A;  3SNN A;  5D3G A;  2QKB A;  2YNG A;  1TAU A;  3CM6 A;  1YQK A;  4CEQ A;  2D0A A;  1RDD A;  1L5U A;  2O4I A;  4AHS A;  1MU2 A;  3IS9 A;  4KO0 A;  3H08 A;  1TL3 A;  3DOK A;  2XHB A;  4DQQ A;  1G15 A;  1WSG A;  4I9L A;  1RBR A;  4C8M A;  4FZX C;  3U3Y A;  4FK0 A;  3AO4 A;  3AVG A;  2NOZ A;  1B92 A;  1LAW A;  3B6P A;  2QKK A;  3K2P A;  1T05 A;  1KY6 A;  2NOF A;  1YTU A;  1E42 A;  4FW1 A;  3U6F A;  1CDW A;  1FK9 A;  4AHU A;  5K14 A;  5CY4 A;  3OYE A;  4KTQ A;  1NJY A;  3VQE A;  4FLX A;  1JLC A;  3DRS A;  2W42 A;  3OYI A;  3OYK A;  3AVL A;  1EBM A;  5C24 A;  1VSM A;  1JXB A;  3HVR A;  1D9F A;  4F2S A;  2ETJ A;  4ZHR A;  3LAN A;  1WSE A;  3DPT A;  1RBV A;  3L2Q A;  4TPS A;  2HZS A;  1RT1 A;  3V1R A;  4CJE A;  4CER A;  4JRP A;  3TAF A;  1RT4 A;  2EX3 A;  1VSI A;  5FRN A;  3QEX A;  3SQ1 A;  1NJW A;  2F8S A;  4CEA A;  3QEW A;  2DTU A;  4CGF A;  4DUL A;  3OSM A;  1FKO A;  4OGE A;  4O0J A;  1TK0 A;  1NKE A;  2HHT A;  1CXU A;  2HB5 A;  2IV8 A;  3DLG A;  1RM1 A;  3AVK A;  1BIU A;  1JLE A;  5HRN A;  3KK3 A;  2KZZ A;  4B9L A;  3K5M A;  3LZJ A;  4E89 A;  4B9U A;  1BI4 A;  2YHA A;  1UA0 A;  3QES A;  2FBT A;  2VG7 A;  3T19 A;  1R0A A;  2MZ8 A;  1N5Y A;  4DQI A;  1HYZ A;  1DTQ A;  1XHX A;  3O4N A;  3N89 A;  4FLT A;  3I0R A;  3THV A;  1HQU A;  1JFI C;  3V4I A;  4M3Y A;  4RW4 A;  3AA3 A;  1S1W A;  1A5X A;  2Z8U A;  3HPH A;  3M8S A;  3CYM A;  1JKH A;  4ROD B;  2FBY A;  3NAE A;  3DMJ A;  4BE2 A;  4DS4 A;  5CZ1 A;  3OST A;  1VSE A;  3I0X A;  1KSP A;  2YNF A;  3L3U A;  3ZT1 A;  4Z4C A;  4LY7 A;  1TBP A;  4MFB A;  3U3G A;  4E0D A;  3V9Z A;  1KY7 A;  4DFK A;  3SNS A;  4HUG A;  1RCH A;  3CFO A;  1FN7 A;  4JS5 A;  1N3A A;  2YH5 A;  4ROE B;  4NCG A;  3AVM A;  3HP6 A;  1TKT A;  4IFY A;  4RG8 A;  1QN8 A;  1TGH A;  3CM5 A;  3NGI A;  1WAJ A;  2HW3 A;  1LWY A;  3OYB A;  3JSM A;  1Z26 A;  3AA5 X;  3HL8 A;  5HBM A;  1J54 A;  1JLG A;  2YHB A;  4GW6 A;  3TR8 A;  4DQR A;  3OYG A;  4ZTF A;  1JXE A;  4E3S A;  4CJF A;  1TKD A;  2P5G A;  3RTV A;  4FLU A;  1QQC A;  4NYN A;  4BE0 A;  3KLG A;  3ITH A;  5KRT A;  2YV0 X;  1SL1 A;  1N6Q A;  1HYS A;  3I8D A;  1RDC A;  3AVC A;  2KZM A;  3C6U A;  3V1Q A;  3KKS A;  1N3C A;  3TI0 A;  5IYC P;  1NK7 A;  1QHT A;  5C25 A;  5IYB P;  4FZZ A;  3DLK A;  2G8F A;  3A2F A;  3M8R A;  3QLH A;  4E7I A;  4PY5 A;  3RRH A;  1CLQ A;  1S9G A;  3LP1 A;  4LH4 A;  1QSL A;  4QOZ B;  4IG0 A;  4B8C A;  1SV5 A;  3VQ5 A;  1SL0 A;  1BGX T;  2PYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...