2D0CA

Crystal structure of bst-rnase hiii in complex with mn2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
b'SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0cA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0cA02
4G1QA 4C8NA 3U3YA 3OJSA 1KYDA 1JKHA 4HTUA 3V9SA 4BE1A 3TAGA 2G8FA 4N41A 4FM1A 3VQ5A 4KI4A 4CHPA 2QKKA 4DSJA 2YKNA 3DRRA 3TAMA 2HHSA 5T7BA 1T8EA 2O4IA 4CHYA 4FM0A 3DRSA 3FFIA 2ATQA 4E3SA 1KFDA 5EU7A 2KFZA 1RNHA 1JLCA 4N56A 1KY6A 1Y97A 5J1EA 1DTTA 4FW1A 4IFVA 3LAKA 4KHUA 4CIEA 1VSFA 1HPZA 4B9LA 4LSNA 3OYNA 4CF0A 4LD0A 1KSPA 4FJ9A 4OLBA 1C6VA 3O3FA 4C8MA 4W5QA 3KK2A 2YHBA 3QEVA 1NJZA 3QIOA 3V1RA 3AVIA 1FKPA 2FBYA 1DTQA 3OY9A 1QSLA 3RMDA 2A1RA 4J2DA 1LWCA 1C0UA 3D45A 3T19A 3ZSZA 4E7KA 1QN5A 4NCGA 3QEXA 1QSYA 4E7IA 2Z1GA 2BGGA 4KV8A 4MQ3A 4FZXC 4PWDA 2ZQBA 1EXQA 2Y1JA 1U49A 1Q9YA 4K8ZA 2AJQA 3AO4A 3SPZA 4B8AB 1GOAA 3SV4A 3KD5E 3KLHA 4AILC 1LWEA 1RTHA 4J2BA 3NGIA 3RRGA 4CJVA 1KLMA 3AO1A 1U48A 2LSNA 2DFHA 4YNQA 4CEDA 5J2MA 2ZD1A 1HRHA 4RG8A 1EETA 1ITGA 4AHCA 3KTQA 4RW4A 4FJMA 3OYDA 1WN7A 4Q5VA 1R0AA 1KY7A 1I3AA 4L8RB 1BQMA 5CZ1A 3AVHA 3NH0A 3T3FA 1RTIA 1RDAA 3SUNA 1VSHA 1Q9XA 2P5GA 4EZ9A 2DFEA 4Z4FA 2WONA 3SQ2A 3NF6A 1S6PA 5KGWA 3ALYA 4CJ3A 3L2QA 3K5LA 3ZSVA 1WAFA 2D0AA 4Y1CA 1RCHA 3L2UA 3HYFA 1SKRA 5C24A 1S9GA 3I0SA 3V81A 4DS4A 1LWFA 3PX6A 4DTMA 4M42A 4CFBA 3OYLA 3LPUA 4CF2A 3LPTA 4CJKA 4BDPA 4PY5A 2X74A 1QHTA 4JLHA 5CZ2A 2HHVA 3RR8A 3VA0A 3K5MA 1QNAA 2ETJA 3MXMA 4F2SA 3BGRA 1BGXT 4KFBA 4FCYA 1TKDA 1RT6A 4IFYA 3ZSWA 4EP5A 3CFRA 2FBXA 1TK0A 4CHOA 3KLFA 4CF9A 1NK5A 1NKEA 1CXUA 3I0RA 3MEDA 1B92A 1SKWA 3RMBA 1YTAA 3PO5A 1HYSA 1BI4B 1NGMA 3DI6A 4FLXA 4CGHA 2E6MA 1QN3A 3OYFA 4DTNA 3V1QA 3MXJA 4CCHA 1EKEA 2Y1IA 4ROCB 1B9FA 3NGYA 4DU1A 3SQ4A 3QEPA 5I42A 4W5NA 3QESA 3DRPA 4H8KA 4YFUA 5IYBP 2OZSA 5IYCP 2VWKA 3AA5X 1L3VA 3QERA 1TVRA 4I2QA 3NGZA 3HM9A 2D5RA 3S3MA 3LAMA 4Z4HA 2HHTA 1LAWA 4FK2A 2GBZA 1B9KA 3SQ0A 4ROEB 3MEEA 3HPOA 4AHTA 1L3UA 3OYMA 2YV0X 3AVCA 4HUFA 4GVMA 3EIKA 3OJUA 3TAFA 3L3UA 3KLEA 2I5JA 4FJKA 1X9SA 1VTOA 4BWMA 1E42A 4BDZA 4RW9A 4DTJA 4DQIA 4CJ5A 1IG9A 4CGGA 4B9TA 4QCLA 3MEGA 4CK3A 1KYFA 4DMNA 5HRNA 1TV6A 1BL3A 2NUBA 3P5JA 1VRUA 1QS4A 4OGEA 5HRPA 2WOMA 1A5WA 4CJEA 4N5SA 4OPKA 4CHNA 4DU3A 1J54A 4CEAA 2PZSA 2G30A 3OCIA 4CFCA 2G8IA 4EP4A 4KI6A 5SZTA 3ZSXA 3VQEA 4J2AA 1TGOA 2E4LA 4C8OA 2OPQA 3LZJA 1JLBA 4HUGA 2VG5A 3LP3A 5HLFA 1NOYA 3AO3A 4C8KA 2KTQA 1NOZA 1S6QA 3M8QA 3OYIA 3P1GA 4DSIA 3SPYA 1IO2A 4R5PA 1EP4A 1XWLA 2RN2A 1C1BA 4PUOA 1G15A 3V6DA 1AISA 3QNOA 3ZT2A 5CY4A 2ITGA 4RW7A 2HNDA 1KLNA 1D3UA 4OGCA 4M3RA 1S9EA 1QNEA 1MP9A 2B4JA 1BISA 4AHRA 2RF2A 3BDPA 3U3GA 3WNHA 1WSIA 4O4GA 4OKJA 4DTXA 3TI0A 2OA8A 1S1WA 3KK1A 4KHSA 3L8BA 3AA2A 4QAGA 3AA4A 2VWJA 3VQ4A 4B9SA 1L5UA 3HO1A 4CEEA 3L2RA 3L2VA 2IC3A 3HP9A 2JLEA 2XO7A 3NE6A 3QEIA 4ELUA 1HNVA 4B08A 4LH5A 1VOLB 3EYZA 4Z4EA 4RODB 4CECA 3IRXA 5HP1A 4KTZA 4E0DA 4FXDA 3ZT0A 1LW2A 4M3WA 5HRSA 3EZ5A 3OYAA 1WSGA 4Q0BA 3JSMA 4JRQA 1NK4A 4B9VA 1YTBA 1YTFA 4FJIA 4JS4A 1K6YA 1W0HA 3HL8A 3DLEA 3VQBA 2IV8A 3B6OA 5I3UA 1UWBA 1RTDA 4DSKA 1HQUA 1UOCA 3LP0A 3HJFA 1RT1A 3AVBA 3VN5A 4ELTA 4FK4A 3O4NA 2P5OA 4FJGA 4I9QA 3RMCA 3NF8A 1HQEA 1KTQA 4AH9A 1FXXA 1VSEA 3NBPA 4M41A 3AO2A 3L3VA 1QN9A 5HBMA 4IKFA 4CESA 2OPPA 2EX3A 3VQ9A 3K58A 4O5BA 1NK9A 1RILA 3AO5A 3TAPA 1SUQA 1KVBA 1X9MA 1NK7A 3O3HA 3DLKA 1VSKA 3S3NA 1O1WA 3SUOA 2G8WA 4M3UA 4M3TA 3WNGA 4CFDA 4OPJA 1QTPA 4OKEA 1C0TA 2Z1HA 1ASWA 4M3XA 2VG6A 1XHXA 3AV9A 1J53A 4ID5A 3TR8A 4ID1A 4CJFA 4CJLA 4KB0A 3IAYA 1NK0A 1ZBFA 4I9LA 1ZBIA 4KTWA 3V9WA 2HHQA 1QE1A 2HNZA 5J2NA 5E41A 5HROA 1WAJA 2BDPA 2X78A 3CYMA 2QKBA 4FJ7A 3HSTB 3DYAA 3ISNC 3PY8A 5D3GA 3TANA 4FLWA 1RDBA 3SCXA 1S1TA 3QINA 1F21A 4H4OA 4KO0A 4LH4A 4WE1A 4DSLA 3PX4A 3U6FA 2HW3A 4E89A 1S1VA 3AVNA 4CJQA 1SV5A 1RM1A 3TWHA 5KRSA 2FBTA 2BANA 1WSEA 4CJUA 4E7JA 1T03A 1IKWA 4ZHRA 1U4BA 3E01A 3TARA 1REVA 4NYFA 4C8LA 3HS8A 3DOKA 2F8TA 1YT3A 4W5TA 3KLGA 3P83D 4B0AA 1RT5A 2Z1JA 3OYEA 4E1MA 3LDSA 5K14A 3ZSYA 1FK9A 4DTUA 4ZTFA 4KKOA 2D0BA 2O4GA 5FDLA 1HMVA 5KRTA 4PQUA 4DFPA 4HHTA 3AVLA 5CYQA 3RMAA 1NVPA 4E7HA 3ITHA 5IYDP 4KHQA 2BE2A 3SUPA 3THVA 4B8CA 3LWLA 3MXIA 4DF8A 3QEWA 4CF1A 2PYJA 2IGIA 2IS3A 3CFPA 4E1NA 1D9FA 3MECA 3AVMA 1QTMA 2QK9A 4DFKA 1JXBA 3K57A 4F3TA 4IDKA 1BI4A 4CF8A 1U47A 3WNEA 5JS2A 4DWIA 4I2PA 5JS1A 4CGFA 3PV8A 2Z1IA 4O44A 1CZBA 3HS9A 2Z8UA 4BACA 1LV5A 3SYZA 2E6LA 1D8YA 4N76A 3VQCA 4AHVA 1RDCA 3ZT4A 1JFIC 1QN7A 3HK2A 4JS5A 1TBAB 1IKVA 1WLJA 2YNHA 3LALA 2XHBA 1BCOA 3KLIA 2RKIA 1RT7A 3MAQA 2IDOA 1RBTA 1C9BB 3VQPA 3OS0A 2X6NA 5KTQA 3K59A 3NAEA 3M8RA 1D9DA 1PZDA 2IV9A 3OC3C 4W5RA 1X9WA 2G8UA 1T7PA 2OZMA 4DF4A 3DLHA 4KB1A 1NKCA 4DQRA 4UQGA 4BDYA 3H08A 4CK2A 3KIOA 1UAXA 2Q3SA 1NH2A 4DQPA 4FK0A 1BIUA 1TAQA 4FLVA 4OVLA 2XY7A 3TAQA 3F73A 4BE2A 4FZYA 2DFFA 1KCFA 2FBVA 2VG7A 3AVAA 2XY6A 3UIQA 1CLQA 3C6UA 1IKXA 4LSLA 1B9DA 4DSEA 1NKBA 4CJRA 3QO9A 1BIZA 1UA0A 2HHUA 1D5AA 3IG1A 4DFMA 5FRMA 1LW0A 3AA3A 4CK1A 4DTOA 4J2EA 2KZMA 1RT4A 2HNYA 3VQ7A 4KREA 1J9AA 3NH2A 3PO4A 1S1UA 1QN4A 4GMJB 3OYBA 3K5NA 3NF9A 4O0JA 3ASMA 1QNCA 1TL1A 3M8PA 3I8DA 1TAUA 3O4QA 4Z4GA 3QIPA 1RBRA 1I39A 2HHWA 1RT2A 3G10A 4CGIA 1TK8A 4NYNA 5DMRA 2KQ2A 2XRIA 2XY8A 1IKYA 4F8RA 3ZSRA 3LP1A 1TKZA 5C25A 4GW6A 4CJSA 3OS2A 3NCIA 3ZT1A 3LWMA 4B3OA 2ZE2A 4AHSA 3B6PA 4FM2A 4FJLA 3OS1A 2YNGA 1DLOA 4MFBA 1LAVA 4DTPA 3LZIA 4NCAA 4OJRA 1C0MA 3A2FA 4O0IA 2YNFA 1TL3A 3AVJA 4DLGA 4DFJA 1KYUA 3KKRA 1TKXA 2HVHA 2DTUA 3OYHA 1Z25A 4QOZB 4Y1DA 2YKMA 4HCBA 1BQNA 1QTSA 1X1PA 1Z26A 5J2QA 4KHYA 1IH7A 4ICLA 4Z4CA 2QXFA 1RBSA 3SI6A 1GOBA 2RPIA 3VQAA 3IS9A 3KK3A 5SWMA 3TAEA 1TKTA 2OYQA 4HCCA 1ZBUA 4B9UA 4ELVA 1WNSA 4CGDA 3C95A 3K2PA 1TK5A 4FJ5A 4B9MA 4FYDA 4ZTJA 3NHGA 1NJXA 2KW4A 3DLRA 1SKSA 4Z0UA 3OVNA 2VJ0A 1CDWA 1EX4A 2G8KA 3DLBA 1JLQA 1C1CA 2GUIA 3SNNA 2P51A 5CYMA 3S9HA 4CERA 1L3TA 3F9KA 1VSLA 1SL2A 4W5OA 3SZ2A 3ULDA 4LY7A 3QNNA 1XI1A 1U45A 1HYZA 1KVCA 4CIFA 2IAJA 3OYGA 3ZSQA 1N5YA 4H4MA 4KPYA 3G0ZA 4HVJA 2R7YA 1JXEA 1SL1A 4CEOA 1QSSA 4N47A 3SJJA 1VSJA 4KHWA 2XY5A 3JYTA 4Z4IA 3V9ZA 4AHUA 1VSIA 4FVMA 4M45A 3CG7A 1C1AA 4CJ4A 3C6TA 3AVGA 1RDDA 5DK5A 2F8SA 4DQSA 3H1ZA 2KZZA 1RBUA 1XHZA 1U04A 2MJ7A 1ZBLA 4FZZA 1TBPA 3T1AA 3V9UA 1VSMA 1VOKA 3WNFA 3D0PA 4DSFA 1J5OA 2HMIA 3VA3A 3O3GA 3V4IA 3PX0A 3S3OA 1UA1A 2YNIA 4KAZA 1RTJA 2HHXA 4DTRA 4KRFA 1FKOA 1GOCA 1SL0A 3HVRA 3QETA 4KTQA 2B5JA 3SV3A 3CM5A 1T05A 4BWJA 2PYLA 1BHLA 4FJ8A 4I7FA 3NDKA 4NCBA 2D0CA 1JL1A 1NK6A 3VQ6A 3OYCA 1TGHA 4CJTA 4FLZA 3HPGA 5FROA 1QQCA 4IG3A 1WSFA 2OPSA 2X6SA 3OYJA 4FLUA 4TSXA 3DM2A 4EZ6A 3HXMA 1RBVA 1A5VA 1QN6A 4IG0A 3KKSA 4FJHA 2KFNA 4FW2A 1ASUA 2W42A 2F96A 4DS5A 4F2RA 4KHNA 2FC0A 2G8HA 1WSJA 2B6AA 3LANA 5HRRA 4E19A 1VRTA 4CEQA 4DU4A 4WZSD 1KVAA 4M3ZA 1JL2A 2A1SA 4CEZA 1NJYA 1VSDA 4CJPA 2PY5A 3RRHA 2DY4A 3PUFA 3TABA 2HB5A 3KJVA 4FJXA 3AVFA 5KI6A 3VQDA 4CE9A 1HNIA 4DTSA 4FJNA 1L3SA 1KRPA 1JLFA 4DG1A 4F4KA 3HPHA 4RW8A 4DLEA 3HT3A 1CZ9A 3NH1A 3DOLA 2YHAA 1QN8A 1HYVA 1W9HA 4CFAA 1JLGA 3CM6A 4FLYA 3SUQA 3KD1E 4FJJA 1Q8IA 3HVTA 1JLAA 1PCZA 3OYKA 3CFOA 1CXQA 1QNBA 1WSHA 2IOCA 3HP6A 1XC9A 3VQ8A 1A5XA 2OPRA 4OKKA 3DMJA 1VTLE 2JGUA 3V1OA 4CGJA 3LP2A 3ZT3A 4CEBA 5KGXA 3RWUA 3RTVA 4OLAA 3K5OA 4CJWA 2P1JA 4O55A 1S5JA 1BCMA 5J2PA 4HUEA 1YTUA 5FRNA 3DLGA 5C42A 4IBNA 1NK8A 4CEFA 1RT3A 1W80A 1MU2A 4JRPA 4B9NA 1YVUA 1ZYQA 3RR7A 4E7LA 4XIUA 1N6QA 4RW6A 1NJWA 1ASVA 3AVKA 3VQQA 1HJRA 2GV9A 4M3YA 2G8VA 3C94A 4CHQA 3EY1A 2HVIA 4PA1A 3L2WA 3V9XA 1R4XA 3QLHA 1KFSA 4CHZA 3M8SA 4FLTA 2EHGA 1JLEA 3NF7A 3ZSOA 4BE0A 3SQ1A 4CIGA 1ZBHA 4DQQA 3CQ8A 4K8XA 1S1XA 3ZCMA 3NFAA 4F3OA 1VK0A
chains in the Genus database with same CATH superfamily
4G1QA 1TYQB 2D4WA 3CQYA 1QQMA 5EOYA 3TAGA 2DKAA 2O8DA 4N41A 1XQSC 1YF5L 2KKZA 2QKKA 2HHSA 3O9TA 5T7BA 4BRGA 3FFIA 2KFZA 1RNHA 4N56A 1Y97A 2YI1A 4FW1A 3F9MA 5EY4A 2AP1A 4B9LA 1C6VA 3KWGA 2E2NA 2P9UB 3DPUA 4I6MB 2A1RA 3ENHA 3T19A 4E7KA 4E7IA 2Z1GA 2Y1JA 4K8ZA 2AJQA 3KD5E 1GOAA 4AILC 3C6HA 3NGIA 3O1BA 1YXQA 1KLMA 4AM6A 2DFHA 2ZD1A 3WT0A 4AHCA 1KC8O 4BRQA 1WN7A 2QI2A 3T3FA 4Z4FA 2JWLA 3F2KA 3NF6A 4JKHA 4YOXA 2D1KA 4CJ3A 4CZEA 3L2QA 1WAFA 3I33A 3VTHA 3L2UA 3HYFA 1SKRA 5KL0A 3I0SA 3AAPA 4CZMA 5BR8K 4M42A 3RSEB 2X74A 1KXPA 2YJFA 3MXMA 2ETJA 4BRLA 3BGRA 1BGXT 1HNZK 5AQYA 4KFBA 4FCYA 4IFYA 1EBMA 2GELA 4EP5A 1T6DA 3KLFA 1SKWA 4JKGA 2NRRA 3MEDA 1HYSA 4QS8A 1VQMN 1BI4B 3UE5A 2E6MA 3KWIA 3HZ6A 4DR1K 3MXJA 3CC2N 3SQ4A 3NGYA 4Z94A 4W5NA 3QEPA 2NOEA 2HZSA 3PMGA 3DRPA 3K9KA 5IYCP 2Y8QA 3VEWA 3J8AA 4RCHA 3NGZA 3LAMA 4XEIA 4K43A 2OTLN 2QWOA 3OYMA 1NBWA 3OSMA 3AVCA 3FFKB 1DGKN 3OJUA 2I5JA 5B8HA 3R1XA 1OVQA 4BDZA 2WBNA 1IG9A 4CK3A 4FWMA 2NUBA 4JK9A 1M90O 1SZ2A 4OGEA 4N5SA 2WOMA 1VQNN 3O9UA 3VGKA 2QREA 3OCIA 2GTDA 4M7YA 5SZTA 4KI6A 3W0LA 4J2AA 3QICA 4HUGA 4FOEA 2GWJA 1U2VA 2V52B 1NOYA 3AO3A 4C8KA 3M8QA 1S6QA 2GEMA 4R5PA 5CHIA 5KPRA 3A5LC 1G15A 1OH6A 1MWKA 1YITN 3QNOA 3R9PA 4JKBA 5CY4A 2R5XA 2NRHA 4RW7A 2E1YA 3JXUA 3G6EN 3ZETA 1D3UA 4OGCA 3UW2A 1QNEA 1MP9A 3MDQA 4AHRA 3BDPA 2HSTA 1WSIA 3TI0A 1WOQA 3AA2A 4QAGA 4DV5K 1L5UA 1EWQA 3HP9A 5BREA 4ELUA 1ESVA 1HNVA 4LH5A 2RE2A 1QHAA 1RDUA 5HP1A 5BPLA 4J8FA 2FKFA 3OYAA 4ILJA 1YTBA 4BRMA 1YTFA 4FPBA 1C47A 5IT9O 1NGFA 3VQBA 3OTOK 1HQUA 1RT1A 4WYBA 2BUPA 4ELTA 3ZYYX 3SBGA 4M63C 5HBMA 4IKFA 4GKKK 2EX3A 3Q7BA 1NK9A 1RILA 1NG9A 3AO5A 3TAPA 1SUQA 3O3HA 1VQ8N 3DLKA 3S3NA 4M3UA 3QMLA 4JK8A 5GAGP 1QTPA 2Z1HA 1ASWA 2O8CB 3EO3A 3C04A 1XMOK 4CJFA 2NOHA 1J53A 4ID1A 3QBXA 4KB0A 2NRWA 3IAYA 1Z6RA 2EHBD 2X78A 5AQKA 4B3TK 1HUXA 3ISNC 2UXBK 1S1TA 4H4OA 1F21A 4LH4A 1VQ4N 1KD1O 4WE1A 4JHDB 1FN7A 1S22A 2P9IA 4CZLA 4CJQA 3TWHA 2WTUA 4CJUA 1WSEA 1N3CA 4O8KA 4JD2A 3CCQN 3VMFB 5GAHP 5BMNA 1REVA 1W97L 2JOIA 3HO1A 1GLJO 4E1MA 4D7RA 1FK9A 4ZTFA 4KKOA 2O4GA 1OVYA 3MWTA 4E7HA 2BE2A 3HSCA 4B8CA 3LWLA 4JAXA 4DF8A 4E1NA 3MECA 3FZLA 1QTMA 2QK9A 1UT4A 4F3TA 4CF8A 1K2YX 3GDQA 1BG3A 4R79A 3GE1A 3IH7A 3PV8A 2P9SA 2E6LA 3G25A 4AHVA 3ZT4A 1QN7A 3HK2A 1BCOA 4A5BA 2VQFK 2IDOA 1RBTA 1DKGD 4JKEA 2X6NA 5AQSA 3C7NB 1X9WA 4LF9K 4KB1A 1W2BM 5A2QO 4CK2A 4GV6A 1NGCA 1ILYA 1TAQA 2NZTA 4MO5A 4OVLA 4MO4A 4U7BA 3F73A 4BE2A 4B3MK 2DKDA 3ZX0A 3UIQA 5AQIA 2QTDA 3R3LA 5JVHL 2CGKA 4CZIA 3A5MC 2LAEA 4B1UB 5FRMA 4J2EA 5BRFA 1RT4A 5F2RA 3SNSA 3O1WA 3PO4A 4GMJB 1TAUA 3NF9A 1GLEG 2NRVA 3SJHA 1GLFO 4Z4GA 3QIPA 1I39A 2UUCK 1IBLK 4QG5A 3ZSRA 5BRDA 2Q36A 3TE5A 1GLLO 1VAZA 3ZT1A 3WXIA 1TYQA 4BGBA 4AHSA 1KFQA 4H5VA 4MFBA 3TSUA 4DTPA 4IWVA 4DLGA 2DTUA 1YIJN 3OYHA 1Z25A 2YKMA 1BQNA 1Z26A 5J2QA 2QXFA 3SI6A 3VQAA 3TAEA 2P9UA 4DV1K 4I6MA 4B9UA 4EJZA 3C95A 3TTCA 3HBTA 1NJXA 1VQON 3DLRA 2G8KA 2VJ0A 2GUIA 1VHXA 1DEJA 3GG4A 4BRFA 4CERA 4DB3A 3CVTA 3F9KA 3L4QA 5HOOA 4LY7A 1XI1A 3THYA 5KPZA 2HZMA 1JXEA 3CPEA 3ENOA 4CEOA 3SJJA 2O8BB 2WFBA 4CZJA 3JYTA 4FOIA 4GVEA 3CPWM 4FVMA 3CERA 4M45A 2GWKA 2YA3A 3C6TA 3AVGA 1RDDA 5DK5A 4DQSA 2KZZA 1XHZA 5LJWA 5IWAK 2NOLA 2MJ7A 1ZBLA 1Q7YO 1EO1A 4CD1A 1Z05A 1TBPA 2EWSA 5LY3A 1VOKA 3VF4A 2HMIA 4KAZA 3TU5A 2QR1A 4DTRA 4A59A 1GOCA 1SL0A 3SV3A 4BWJA 1BHLA 3CHWA 1LOTB 2D0CA 1JL1A 4FWKA 5MLCQ 1TGHA 4CJTA 4G9ZA 4TSXA 3HRGA 1NGEA 3DLLL 4FW2A 3AGKA 4RWTA 2G8HA 5C10A 3LANA 3ENOC 3Q7CA 4NB4A 3QDKA 3EAYA 1SQKA 3VEYA 5M1KA 3RRHA 3VEOA 4CE9A 1HNIA 3AY9A 4EIAA 4F4KA 4LFAK 3WUHA 4H0PA 4DLEA 1Q81O 1CZ9A 1G99A 4BQLA 3NH1A 1Q8IA 4JI2K 1JLAA 4OKKA 3RWUA 2JGUA 3J7ZO 3RSMA 3FGUA 2E20A 4A57A 1BCMA 3CWSA 5FRNA 4BC4A 4IBNA 5C42A 4CEFA 4E7LA 1LWVA 3VQQA 3CF5L 1T3VA 3TSQA 3JS6A 3ZSOA 4BE0A 4QS9A 3L6QA 2P9LA 3CI5A 5AJ3K 3NFAA 4KPYA 4C8NA 3U3YA 1LWYA 1JKHA 4HTUA 3V9SA 2YH5A 3N89A 3MK6A 1HLUA 4GNIA 4CHPA 3FE1A 5AZJB 3TAMA 2Z0FA 4RTFD 4CHYA 1IBMK 4E3SA 3H6EA 2ZM6K 1DTTA 3I0XA 4IFVA 2V7YA 1EUVA 4OLBA 2P9PB 2O3OA 3KK2A 1NJZA 4ISFA 3OY9A 3RMDA 1LWCA 5C2DA 3F5TA 3QEXA 2UU9K 1NGGA 2BGGA 4MQ3A 4PWDA 2ZQBA 1U49A 4HJHA 5I9EB 3NMUA 3KLHA 1LWEA 4J2BA 3RRGA 4CJVA 4GV9A 1N32K 4CEDA 5J2MA 1HRHA 4RG8A 5AQNA 3CCLN 3ENBA 5TKWA 3KTQA 1VQ6N 3FZFA 4Q5VA 1IG8A 1BQMA 3NH0A 2P5GA 1VSHA 4H03B 2DFEA 1XNQK 4BR5A 2A5XA 3WEEA 4JD2B 2D0AA 3WXLA 5C24A 1S9GA 1LWFA 5KPTA 5AQUA 4CF2A 3LPTA 3VF2A 4B3SK 4PY5A 1QHTA 3VETA 3RR8A 3K5MA 1N3AA 1QNAA 2OOXA 3TSPA 2O8EB 1TKDA 3OGDA 1RT6A 1P5GX 3CFRA 4X65K 3MX2A 4H5NA 3U9DA 3EEQA 4CHOA 4M7XA 3M5RA 1NK5A 4A62A 3I0RA 1B92A 1YTAA 2QWLA 3FR0A 1QVGM 2FLOA 4DTNA 3AGRA 1EKEA 5I42A 1YJWN 1P5DX 4H8KA 4YFUA 1YVNA 5FPMA 3AA5X 1VQPN 3QERA 5JICA 2UYTA 1K9MO 3VGMA 4Z4HA 1LAWA 2GBZA 4CJ7A 4ROEB 4WFBL 2YV0X 1NGDA 2W41A 5AQQA 3H45C 2Q31A 3L3UA 3TAFA 3PLAA 4FJKA 2FF3B 1KO9A 4DTJA 1YQLA 4JI5K 2BTFA 4B9TA 3MEGA 4WX8A 1I94K 3I56N 4YOTA 1OH8A 5JN5A 1VRUA 1JCEA 4FWOA 4BR4A 5HRPA 2ZJRL 4DU3A 4FWNA 4CHNA 3J81O 5ELZA 4CFCA 4BG8A 3ZSXA 3A5NC 4BRDA 3C7NA 1TGOA 2E4LA 3T1YK 3OH9A 4JI7K 2VG5A 2YJEA 3LP3A 4B1XB 2Q1NA 5CR4A 3P1GA 4HTLA 3SPYA 3ZLJA 2NOZA 4PUOA 2ASPA 1NJIO 4CD3A 2HNDA 3U8XA 5LJVA 1KLNA 2FSKA 1S9EA 4CCHA 4BJUA 3WNHA 3CMAN 4DTXA 2OA8A 1S1WA 3KK1A 2D0OA 3CETA 3VEZA 3L2VA 1GLCG 1HNWK 2JLEA 3P4IA 2XO7A 2QRCA 1VOLB 4RODB 4KTZA 3ZT0A 1HKCA 4Q0BA 1WSGA 3E9PA 3SAFA 1NK4A 4B9VA 1BDGA 3CCVN 5GIOA 4JS4A 4YOVA 3HL8A 5I3UA 1RGIA 3QFUA 2NRXA 3LP0A 3HJFA 1WUAA 3BZKA 3CC7N 1T44A 3AVBA 3CJ7A 3NF8A 1HQEA 1KTQA 2XHIA 1PCMX 2A40A 1VSEA 3THYB 2FSJA 3L3VA 1X3MA 3GL1A 4CESA 2OPPA 5AQFA 3VQ9A 3K58A 3EN9A 3VF6A 1VSKA 1O1WA 3SUOA 4OPJA 4DV4K 1C0TA 2ZFDB 3TR8A 4BRPA 1NK0A 1ZBFA 3V9WA 4NLCA 2HNZA 4GV3A 5HROA 2BDPA 2QKBA 2O8BA 3I3WA 3HSTB 3H3OB 3L4IA 5M1QA 3LL3A 1BA1A 1IJJA 2CGLA 3SCXA 3QINA 3ID6A 3U6FA 2HW3A 4H0XB 5M1OA 5KRSA 3OW2M 1N34K 4LF7K 5BR9A 4MDAA 2F8TA 1YT3A 2YHWA 4W5TA 3DLBA 4DTUA 5K14A 1UA0A 5E26A 1SL2A 4PQUA 2D0BA 5KRTA 4HHTA 5CYQA 4A5AA 2V9JA 5IYDP 3SUPA 3IDHA 3TTDA 4AF1A 1LXTA 4CF1A 4PKGA 2NWVA 4AM7A 1BWFO 4DHYA 3EKUA 3KTUA 1YJ9N 3SBTA 3SYZA 2OOYA 2HHHK 1M3QA 1TBAB 2YNHA 2XHBA 1U6ZA 3THWB 1RT7A 1C9BB 1UT7A 4NXNK 4W5RA 4DF4A 1V5SA 1NKCA 4JNEA 4DQRA 4UQGA 3H08A 5JMVD 3KIOA 2Q3SA 2I7PA 2IVOA 3CJAA 3HOTA 1NH2A 4DQPA 2UXDK 2P9LB 4FZYA 2QXLA 2FBVA 2E2PA 2VG7A 1E3MA 4BQZA 4LSLA 1IKXA 4BRHA 4DSEA 1KAZA 3OH6A 2HHUA 3S41A 1D5AA 3IG1A 3AA3A 5HL7L 2KZMA 4IEEA 3NH2A 3OYBA 3K5NA 4O0JA 1TL1A 5BPMA 4OX9K 2JWKA 2WUSA 1RBRA 1OH5A 2HHWA 5DMRA 1T6AA 1DIZA 3MN9A 4F8RA 3LP1A 1TKZA 4GW6A 4CJSA 3H1QA 1K8KB 4B3OA 3QBWA 1N8RO 1YUWA 4BC2A 3E1YA 3OS1A 2YNGA 5F1XA 5AZJA 2JPIA 1LAVA 2H4LX 5BPNA 1NMNA 4OJRA 1C0MA 3A2FA 4O0IA 2YNFA 5TKYA 3CJ1A 1TKXA 3HTVA 3KKRA 2NOIA 1QTSA 4LC9B 1IH7A 2V7ZA 5AQPA 2P9PA 1GOBA 2RPIA 2UXCK 4B1YB 1ZBUA 4ELVA 2E2OA 2F9WA 4CGDA 4FJ5A 4ZTJA 3NHGA 1R59O 1SKSA 5M1NA 3WEEB 1C1CA 5CYMA 5LMUK 5E84A 2Q0RA 4BR0A 4W5OA 4BG9A 3DXKB 1HYZA 1KVCA 1NMDA 2IAJA 4H5RA 3G0ZA 1SL1A 3CWAA 4N47A 4H0TB 2XY5A 1LWWA 4AHUA 4PKIA 2A6AA 3H1ZA 3D7EO 3V9UA 1VSMA 3D0PA 4JI6K 2YNIA 1RTJA 3ZX2A 1T05A 2PYLA 3CM5A 3U4LA 4I7FA 2IIRA 3NDKA 4IG3A 3OYJA 4FLUA 4EZ6A 2YCHA 2O8EA 3HXMA 4BRIA 1QN6A 3KKSA 1Q82O 4FJHA 2KFNA 2W42A 4DS5A 2HBKA 3O4WA 2Y8LA 4CEQA 1NNEA 4WZSD 2O8FB 4EAJA 1JL2A 4B1WB 3O5BA 2A1SA 3P31A 4BGAA 1HPMA 5C12A 1VSDA 3DAWA 2ZGYA 4CJPA 3OHRA 4D7QA 5H1SQ 4DV0K 4FJXA 2V8QA 4H0YB 3SAGA 1RFQA 1JLFA 5KQ8A 2V92A 4YY3K 3HPHA 4RW8A 2JHJA 3HT3A 2YHAA 4FLYA 4H0OA 3CM6A 2ITMA 4YDUC 3CFOA 1NU0A 2IOCA 3HP6A 1VTLE 3LP2A 3ZT3A 5BN9A 4I8OA 1YQMA 1YTUA 4O5FA 3M1FA 2GX9A 1RT3A 1YHQN 2HMPA 3RR7A 4NLBA 4XIUA 5GINA 3I8BA 1NGAA 2G8VA 3EY1A 2HVIA 3THXB 1KFSA 1R4XA 3AARA 4U67L 4FLTA 2F7TA 2PFUA 4DQQA 4DG1A 3T4NA 1J5EK 3OJSA 1KYDA 5AQGA 4JK7A 1ZBSA 3W3DA 3VQ5A 1YQRA 5JVGL 2YKNA 4JI8K 2O4IA 3DRSA 2ATQA 3CJ9A 1KY6A 4MRQA 5BRHA 3EKSA 3LAKA 4KHUA 4CIEA 1VSFA 1HPZA 3RVCA 4LSNA 3O3FA 2YHBA 3QEVA 3V1RA 3AVIA 3M6GA 1Y64A 2DKCA 4NCGA 1QSYA 2F4VK 4KV8A 1EXQA 3D2FB 3SPZA 4B8AB 5ADXA 3MN5A 4X64K 4CBUA 2LSNA 2ZJQL 3LM9A 4IOCL 4KHPK 4PL7A 1C0GA 3D6RA 4BC3A 1ITGA 3SK3A 3OYDA 2HBJA 3CCJN 3ULXA 1OH7A 1KY7A 1I3AA 3MN7A 4L8RB 5CZ1A 1ZXOA 4HWIA 2WONA 4XH4A 3E9LA 5KGWA 4BREA 4JKDA 3ZSVA 2YX6A 3CJBA 3V81A 3PX6A 4CZHA 4CFBA 1N33K 3IMXA 3O9QA 2FKMX 4CJKA 3CCMN 4DR5K 4BDPA 5CZ2A 4JLHA 2HHVA 1HKGA 1BU6O 4K42A 5GAEP 2VGMA 1PCJX 4AQYK 4BY9C 3BZCA 4CF9A 1CXUA 2W6LA 2D0PA 3NA5A 2QWRA 3H1VX 4FL9A 3DI6A 4CGHA 3V1QA 4BROA 2Y1IA 3N4PA 4DU1A 4JI0K 2ASOA 4EALA 2E2QA 1NGJA 5IYBP 2CGJA 1YI2N 2VWKA 1L3VA 1TVRA 1TUUA 3HM9A 1K8AO 1K35A 4B3RK 3J7YP 3MEEA 3HPOA 1ATSA 4AHTA 4X66K 1L3UA 4PKHA 4GVMA 3EIKA 3KLEA 2FUVA 3UB5A 4BWMA 4DQIA 4CJ5A 4B9QA 3QFPA 4QCLA 1V4SA 4DMNA 3THWA 1QS4A 4CJEA 4OPKA 2G30A 4EP4A 4LF6K 5AR0A 1JLBA 3ULEB 2YHYA 3MMVA 3ATUA 5HLFA 3EZWA 2KTQA 1J6ZA 1EP4A 2RN2A 1AISA 3RPJA 3ZT2A 4CI6A 2ITGA 1C4GA 3JAMO 4FK2A 2GUPA 4O4GA 4OKJA 3A0IX 4KHSA 1J3MA 3AA4A 4CBWA 2VWJA 4B9SA 4A61A 3L2RA 3U9ZA 3QEIA 5AQOA 1DT9A 3ID8A 3TPQA 4CECA 3IRXA 1QQNA 4E0DA 4M3WA 3PSFA 2HOEA 5HRSA 3EZ5A 3JSMA 3I55N 1K8KA 4FJIA 1VQ9N 1W0HA 4ILGB 4DSKA 3DPTA 4FWQA 1RTDA 1UWBA 1UOCA 4FK4A 1FJGK 2P5OA 4FJGA 4I9QA 1QZ5A 5DM6L 2E5LK 1FXXA 3B8AX 3NBPA 2P9NB 4M41A 2HF3A 3E66A 5AFUA 1YAGA 3LDPA 5FPDA 4OO1J 2QWMA 1X9MA 1KVBA 1C0FA 4GY2B 2G8WA 3BY5A 4CFDA 3ZEUB 2QWPA 2VGNA 4BRCA 4M3XA 1XHXA 3AV9A 4ID5A 4CJLA 3FLCO 1ZBIA 5HSHA 4K0KK 4KTWA 2HHQA 1QE1A 3CCSN 2FXUA 1WBBA 3DXKA 5J2NA 4DR4K 1W7AA 3CCEN 3LDLA 1O13A 4KO0A 3UKUA 3AVNA 2Q2RA 1M3HA 1RM1A 1HR0K 2BANA 4EAHD 4E7JA 1HJOA 4ZHRA 1U4BA 3TARA 1K73O 4NYFA 4C8LA 3HS8A 3DOKA 3J80O 1VQ7N 3KLGA 3GBTA 4B0AA 1RT5A 3OYEA 3LDSA 3ZSYA 3MWPA 1TK8A 5FDLA 4V19S 1V4TA 4DFPA 3RMAA 1TUYA 1NVPA 3ITHA 4Q11A 1T6CA 5M1FA 4F9OA 2NOFA 2PYJA 2IS3A 4IOAL 4IZ9A 4DR6K 3LDQA 3K57A 4DWIA 4YOWA 5JS2A 4I2PA 2ZJPL 4CGFA 2Z1IA 4O44A 1LV5A 2O8FA 4N76A 3BP8A 3VQCA 1JFIC 4B1ZA 3LALA 3KLIA 3MAQA 1BA0A 5KTQA 3NAEA 2UUAK 1D9DA 3M8RA 4DUYK 2IV9A 2G8UA 3UKRB 1T7PA 1JCGA 2YHXA 3DLHA 3NVKA 4BDYA 1BUPA 4FK0A 1BIUA 3TAQA 2DFFA 3AVAA 2XY6A 3TDHA 4H0VB 1B9DA 1NKBA 4MLHA 1NM1A 4CJRA 3QO9A 2HBMA 3CIPA 4DFMA 2QEXN 4CK1A 4DTOA 4BRKA 2HNYA 1GLAG 4CVNE 4NXMK 1J9AA 1BOTO 4JN4A 3M8PA 3I8DA 4EHTA 3O4QA 1RT2A 3THXA 3CC4N 4BRAA 2XRIA 2XY8A 1IKYA 4WQ4A 5C25A 3LWMA 2ZE2A 2NNWA 3BEXA 3CMEN 3B6PA 3CCUN 3CD6N 3O6WA 1DLOA 4UY8O 3HI0A 4WFAL 3L0QA 4NCAA 3AVJA 1KYUA 5AQJA 4QOZB 4HCBA 1X1PA 1JJ2M 4ICLA 4Z4CA 2OTJN 1RBSA 4YOUA 3J7AP 3KK3A 5DM7L 1QVFM 3SAHA 4HCCA 3ENCA 2FF6A 4Z0UA 3OVNA 1CDWA 5JLFA 4DR2K 1JLQA 3D2FA 2P51A 3S9HA 2ASMA 1L3TA 3QNNA 1MDUB 4WQ4C 1U45A 4DUZK 3GOIA 3WXJA 3DXMB 1JCFA 1CZAN 3VEVA 4H4MA 3ZSQA 3KRMA 1HU0A 2R7YA 1QSSA 1VSJA 4KHWA 4Z4IA 1IV0A 1VSIA 4CJ4A 1C1AA 2QLVA 2F8SA 2ZF5O 3PIPL 1RBUA 3F0ZA 4L3QA 5AQRA 2PBDA 4FZZA 2VWBA 3A8YA 3T1AA 2PWWA 4DSFA 3V4IA 3O3GA 3PX0A 3S3OA 1UA1A 1FKOA 3QETA 1YJNN 4KTQA 4FJ8A 4NCBA 1XSZA 4XH1A 4BVPA 1NK6A 3C65A 1KAXA 3KHYA 3OYCA 1PVSA 5FROA 1WSFA 2OPSA 2X6SA 3BKQX 4JEPA 2P9KB 3DM2A 1RBVA 3K9JA 1EWRA 4MDBA 4F2RA 2F96A 4KHNA 1WSJA 1NGBA 2B6AA 3OA9A 2AA4A 4DV6K 1VRTA 4FWSA 4DCHA 1KVAA 4K25A 4M3ZA 3IKMA 5AZIB 4B1VA 4CBXA 2W40A 2DY4A 3PUFA 3CVSA 4FWLA 3KJVA 3TABA 1X3NA 3AVFA 3VQDA 1JDYA 4EAGA 3CQXA 2NLXA 4DTSA 1L3SA 2A41A 3EE9A 3LDOA 1KRPA 3SLCA 4X62K 1ATRA 4XH5A 4CFAA 1QN8A 1HYVA 1W9HA 2NRZA 5C2FA 3HVTA 1PCZA 4EFHA 1CXQA 1QNBA 5LMNK 2KLAA 1XC9A 2IVNA 4JYAK 4DKWA 4Y0WA 2IVPA 2OPRA 3VQ8A 5KGXA 3O9SA 2CH5A 4CJWA 1XC3A 1S5JA 4MLEA 1VQKN 3DLGA 3OSTA 4B9NA 1W80A 4JRPA 1N6QA 4RW6A 1NJWA 1ASVA 3AVKA 2GV9A 2J4RA 4M3YA 3ULEA 3C94A 3SMPA 4CHQA 5KQDA 3ZX3A 4CZFA 4K41A 3L2WA 3QLHA 3V9XA 1JLEA 1XNRK 4F3OA 4BE1A 2G8FA 4FM1A 4KI4A 3OSEA 4DSJA 3DRRA 1X9JA 1T8EA 4WCEL 2QA4N 4FM0A 1KFDA 5EU7A 1JLCA 5J1EA 2FSNA 2QW9A 1GLDG 4IO8A 3OYNA 4CF0A 4LD0A 4C1NK 1KSPA 4FJ9A 4C8MA 4W5QA 3MCAB 3QIOA 4EJYA 1FKPA 2FBYA 1DTQA 1QSLA 2H5AX 4J2DA 1C0UA 3D45A 3ZSZA 1QN5A 4FZXC 1Q9YA 4LFCK 4CZKA 2NRTA 3AO4A 3SV4A 4FO0A 1RTHA 4JV5K 3AO1A 1U48A 4WF9L 2P9NA 4YNQA 1D4XA 1EETA 3T69A 4RW4A 4FJMA 5C15A 1R0AA 3C6AA 2HKPA 4KBOA 3AVHA 1RTIA 1RDAA 3SUNA 3UKUB 1Q9XA 4EZ9A 2HBLA 2JHNA 1GLBG 3ZEUA 1S6PA 3BF1A 4BR9A 3SQ2A 3ALYA 3K5LA 4Y1CA 1RCHA 3C0BA 5EXWA 2QM1A 4E1JA 1WB9A 4DS4A 4DTMA 1VQ5N 5F9CA 3OYLA 3LPUA 4YDUA 4IFEA 3VA0A 4F2SA 1ATNA 1HNXK 3LDNA 4WFNL 3H3NO 3ZSWA 2FBXA 2HL8A 1TK0A 1LCUA 1NKEA 3D2EA 4QS7A 3RMBA 3PO5A 1NGMA 4CW7B 4FLXA 1QN3A 4OPHA 3OYFA 4A2AA 4ROCB 1B9FA 4EHUA 3QESA 2DPNA 3OBWA 1XMQK 1WJWA 4LF5K 2OZSA 4I2QA 2D5RA 1NGIA 3S3MA 1QQOA 2HHTA 1B9KA 3SQ0A 5AQLA 4LF4K 3D7QA 4HUFA 4DR7K 2MZ8A 4EAIA 1MA9B 1X9SA 1VTOA 1S72N 1E42A 5LL6Z 4RW9A 2F7LA 4BRNA 4CGGA 1H1VA 3OLPA 1KYFA 2WC9A 3CWUA 5HRNA 1TV6A 1BL3A 3P5JA 1TUOA 1VKLA 1A5WA 1KAYA 1WBDA 1J54A 4CEAA 2PZSA 2G8IA 2RHKA 3VQEA 3UKRA 4C8OA 2OPQA 3LZJA 1ZC6A 4IL8A 2NVMA 5JMVA 1NOZA 3OYIA 3EE8A 3PDKA 4DSIA 3R8EA 4EAKA 1IO2A 2NLVA 1XWLA 1C1BA 3V6DA 3P39A 2QWNA 2O8DB 5BN8A 5F0XA 4M3RA 2B4JA 1BISA 2RF2A 3ATVA 3U3GA 5M1PA 4BVOA 2PAVA 3L8BA 3VQ4A 1P8ZA 4CEEA 2IC3A 1E4GT 3R6MA 3NE6A 4B08A 4Z4EA 4DQ8A 3EYZA 3O9RA 4IJAA 4FXDA 4YOYA 1IBKK 1LW2A 4JRQA 5GADP 2QRDA 3WXKA 3T7ZA 1K6YA 3BF3A 3DLEA 2V51B 2IV8A 3B6OA 3O80A 5CE3A 4FWPA 3VPZA 3VN5A 2UUBK 3O4NA 2E1ZA 3RMCA 3KZBA 3T1HK 4AH9A 2ZGZA 3AO2A 1HX1A 1QN9A 5ADXH 4LF8K 3O8MA 4O5BA 1NK7A 4M3TA 3WNGA 5EPCA 3H46O 3FZMA 4OKEA 2VG6A 3P38A 4JI4K 4DV3K 4I9LA 3TTFA 2KHOA 3DXMA 5E41A 1WAJA 3PSIA 3M3ZA 3CYMA 3VOVA 4FJ7A 3DYAA 4IEIA 3PY8A 2FGTA 3TANA 3CXCM 1RDWX 4FLWA 1RDBA 1BO5O 3WQTA 3G4SN 4DSLA 3PX4A 2VQEK 4E89A 3K0SA 1S1VA 1SV5A 3AAQA 4JKGB 2HL9A 2FBTA 1VQLN 3MN6A 1T03A 4KH5A 1IKWA 2E8AA 3E01A 4H5TA 3P83D 3FZHA 2Z1JA 4KH4A 1HMVA 3RSEA 3AVLA 3CW7A 4KHQA 3THVA 5FLXO 4JI3K 4YHHK 3MXIA 3QEWA 3N4QA 2P9KA 3EL2A 2IGIA 3CFPA 4C7PA 5AQWA 3AVMA 1D9FA 1S3XA 4DFKA 4OPAA 1JXBA 1WQAA 3VTIA 4IDKA 1BI4A 1U47A 3WNEA 5JS1A 4NO7A 4DV2K 4ISGA 4CZGA 1CZBA 3HS9A 2Z8UA 4BACA 1D8YA 3VESA 1RDCA 4ILHA 1MPGA 4JS5A 1IKVA 1WLJA 5AZIA 3NVMA 2RKIA 5AN4A 3VQPA 3OS0A 1EQYA 4JKFA 1UL7A 4WXAA 5BMPA 3K59A 1KQSM 1PZDA 3OC3C 4DULA 1Q18A 2OZMA 5D3GA 3O08A 4FPAA 5JLHA 1U2VB 1UAXA 3VENA 3CWTA 4TPSA 2E88A 4A2BA 1OKJA 4FLVA 2XY7A 1M1KO 2I5WA 1KCFA 3F10A 3CJCA 1CLQA 3C6UA 3ZETB 1BIZA 4FWRA 1LW0A 3IUCA 2H3GX 3VQ7A 4KREA 3OBYA 1S1UA 1QN4A 3E9OA 2Q0UA 4LFBK 3ASMA 1QNCA 1SS6A 4BC5A 3G10A 4CGIA 4NYNA 2KQ2A 4GKJK 3DJCA 1XUPO 2VYPA 3NCIA 3OS2A 4FM2A 4FJLA 3BUZB 4ISEA 3HOSA 3LZIA 4JKAA 3I0WA 2HVHA 1TL3A 2OANA 4WQ5A 2I7NA 1Q86O 4Y1DA 4KHYA 1QZ6A 4IXCA 2QWQA 4JI1K 2ZWHA 3IS9A 5SWMA 1SAZA 1TKTA 2OYQA 5AQTA 1WNSA 5AFUH 4FYDA 3K2PA 1TK5A 4B9MA 2KW4A 1EX4A 4CFFA 3SNNA 5AQMA 1VSLA 4FSVA 3SZ2A 3ULDA 4CIFA 3OYGA 1MWMA 4JKCA 1N5YA 3IFRA 3KK7A 3VEXA 4HVJA 2CH6A 3WQUA 1M5Q1 3D4VA 3V9ZA 1KFIA 3CG7A 2A3ZA 5AQXA 2P9IB 1U04A 4FVUA 4WQ5C 4O8UA 4YORA 3D2EB 2HF4A 4C1NI 4IO9L 2NOBA 3SMSA 2O8CA 1Q9UA 1NWKA 3WNFA 1J5OA 3VA3A 1N36K 2HHXA 2F9TA 3DWLA 2W6KA 5FPNA 3G71N 2Q97A 4DR3K 3HVRA 4KRFA 4IOXA 2B5JA 3KVGA 5GIPA 3FZKA 3HM8A 3VQ6A 4FLZA 3HPGA 1QQCA 5AQZA 4JHDA 1A5VA 4IG0A 1ASUA 3LM2A 3PIOL 2FC0A 3CCRN 1E4FT 5HRRA 4E19A 1YQKA 2P9SB 4IDHA 4DU4A 4CEZA 4BR7A 1NJYA 2PY5A 1NLVA 2HB5A 1FW6A 5KI6A 4FJNA 5EVZA 5AQHA 4BR2A 3DOLA 3SUQA 3KD1E 1JLGA 5C0YA 4FJJA 4KH6A 3VERA 5AQVA 3MX5A 3OYKA 2OCEA 1WSHA 2BH1A 4C23A 1A5XA 4H5WA 4DFJA 3DMJA 2VCPA 3V1OA 4CGJA 4OLAA 4CEBA 5EX5A 3QB0A 3RTVA 3K5OA 1N39A 2P1JA 4O55A 1HKBA 1NGHA 5J2PA 4HUEA 5FPEA 1NK8A 1MU2A 3A5OC 3MCPA 1YVUA 1ZYQA 3WXMB 4IJNA 1HJRA 3VGLA 4PA1A 4PHTX 4DV7K 4PL8A 4CHZA 3M8SA 2EHGA 1ZBHA 3NF7A 3SQ1A 4CIGA 3CQ8A 4K8XA 1S1XA 3ZCMA 1P90A 2A42A 1VK0A
chains in the Genus database with same CATH topology
4G1QA 4C8NA 3U3YA 3OJSA 1KYDA 1LWYA 1JKHA 4HTUA 3V9SA 4BE1A 3TAGA 2YH5A 3N89A 2G8FA 4FM1A 4N41A 3VQ5A 4KI4A 4CHPA 1YQRA 2QKKA 4DSJA 2YKNA 3DRRA 3TAMA 2HHSA 5T7BA 1T8EA 2O4IA 4CHYA 4FM0A 3DRSA 3FFIA 2ATQA 4E3SA 1KFDA 5EU7A 2KFZA 1RNHA 1JLCA 4N56A 1KY6A 1Y97A 5J1EA 1DTTA 3I0XA 4FW1A 3LAKA 4IFVA 4CIEA 4KHUA 1VSFA 1HPZA 4B9LA 4LSNA 3OYNA 4CF0A 4LD0A 1KSPA 4FJ9A 4OLBA 1C6VA 3O3FA 2O3OA 4C8MA 4W5QA 3KK2A 2YHBA 3QEVA 3DPUA 1NJZA 3QIOA 3V1RA 4EJYA 3AVIA 1FKPA 2FBYA 1DTQA 3OY9A 1QSLA 3RMDA 2A1RA 4J2DA 1LWCA 1C0UA 3D45A 3T19A 3ZSZA 4E7KA 1QN5A 4NCGA 3QEXA 1QSYA 4E7IA 2Z1GA 2BGGA 4KV8A 4MQ3A 4FZXC 4PWDA 2ZQBA 1EXQA 2Y1JA 1U49A 1Q9YA 4K8ZA 2AJQA 3AO4A 3SPZA 4B8AB 1GOAA 3SV4A 3KD5E 3KLHA 4AILC 1LWEA 1RTHA 4J2BA 3NGIA 3RRGA 4CJVA 1KLMA 3AO1A 1U48A 2LSNA 2DFHA 4YNQA 4CEDA 5J2MA 2ZD1A 1HRHA 4RG8A 1EETA 1ITGA 4AHCA 3KTQA 4RW4A 4FJMA 3OYDA 3ULXA 1WN7A 4Q5VA 1R0AA 1KY7A 1I3AA 4L8RB 1BQMA 5CZ1A 3AVHA 3NH0A 3T3FA 1RTIA 1RDAA 3SUNA 1VSHA 1Q9XA 2P5GA 4EZ9A 2DFEA 4Z4FA 2WONA 3SQ2A 3NF6A 1S6PA 5KGWA 3ALYA 4CJ3A 3L2QA 3K5LA 3ZSVA 1WAFA 2D0AA 4Y1CA 1RCHA 3L2UA 3HYFA 1SKRA 5C24A 1S9GA 3I0SA 3V81A 4DS4A 1LWFA 3PX6A 4DTMA 4M42A 4CFBA 3OYLA 3LPUA 4CF2A 3LPTA 4CJKA 4BDPA 4PY5A 2X74A 1QHTA 4JLHA 5CZ2A 2HHVA 3RR8A 3VA0A 3K5MA 1N3AA 1QNAA 2ETJA 3MXMA 3BGRA 4F2SA 1BGXT 4KFBA 4FCYA 1TKDA 1RT6A 4IFYA 1EBMA 3ZSWA 4EP5A 3CFRA 2FBXA 1TK0A 4CHOA 3KLFA 4CF9A 1NK5A 1NKEA 1CXUA 3I0RA 3MEDA 1B92A 1SKWA 3RMBA 1YTAA 3PO5A 1HYSA 1BI4B 1NGMA 3DI6A 4FLXA 4CGHA 2E6MA 1QN3A 3OYFA 4DTNA 3V1QA 3MXJA 4CCHA 1EKEA 2Y1IA 4ROCB 1B9FA 3NGYA 4DU1A 3SQ4A 3QEPA 2NOEA 2HZSA 4W5NA 3QESA 3DRPA 4H8KA 4YFUA 5IYBP 2OZSA 5IYCP 2VWKA 3AA5X 1L3VA 3QERA 1TVRA 4I2QA 3NGZA 3HM9A 2D5RA 3S3MA 3LAMA 4Z4HA 2HHTA 1LAWA 4FK2A 2GBZA 1B9KA 3SQ0A 4ROEB 3MEEA 3HPOA 4AHTA 1L3UA 3OYMA 3OSMA 2YV0X 3AVCA 4HUFA 4GVMA 3EIKA 3OJUA 3TAFA 2MZ8A 3L3UA 3KLEA 2I5JA 4FJKA 1X9SA 1VTOA 1KO9A 1E42A 1YQLA 4RW9A 4BWMA 4BDZA 4DTJA 4CJ5A 4DQIA 1IG9A 4CGGA 4B9TA 4QCLA 3MEGA 4CK3A 1KYFA 4DMNA 5HRNA 1TV6A 1BL3A 2NUBA 3P5JA 1VRUA 1QS4A 4OGEA 5HRPA 2WOMA 1A5WA 4CJEA 4N5SA 4OPKA 4CHNA 4DU3A 1J54A 4CEAA 2PZSA 2G30A 3OCIA 4CFCA 2G8IA 4EP4A 4KI6A 5SZTA 3ZSXA 3VQEA 4J2AA 1TGOA 2E4LA 4C8OA 2OPQA 3LZJA 1JLBA 4HUGA 2VG5A 3LP3A 5HLFA 1NOYA 3AO3A 4C8KA 2KTQA 1NOZA 1S6QA 3M8QA 3OYIA 3P1GA 4DSIA 3SPYA 1IO2A 2NOZA 4R5PA 1EP4A 1XWLA 2RN2A 1C1BA 4PUOA 1G15A 3V6DA 1AISA 3QNOA 3RPJA 3ZT2A 5CY4A 2ITGA 4RW7A 2HNDA 1KLNA 1D3UA 4OGCA 4M3RA 1S9EA 1QNEA 1MP9A 2B4JA 1BISA 4AHRA 2RF2A 3BDPA 3U3GA 3WNHA 1WSIA 4O4GA 4OKJA 4DTXA 3TI0A 2OA8A 1S1WA 3KK1A 4KHSA 3L8BA 3AA2A 4QAGA 3AA4A 2VWJA 3VQ4A 4B9SA 1L5UA 3HO1A 4CEEA 3L2RA 3L2VA 2IC3A 3HP9A 2JLEA 2XO7A 3NE6A 3QEIA 4ELUA 1HNVA 4B08A 4LH5A 1VOLB 3EYZA 4Z4EA 4RODB 4CECA 3IRXA 5HP1A 4KTZA 4E0DA 4FXDA 3ZT0A 1LW2A 4M3WA 5HRSA 3EZ5A 3OYAA 1WSGA 4Q0BA 3JSMA 4JRQA 1NK4A 4B9VA 1YTBA 1YTFA 4FJIA 4JS4A 1K6YA 1W0HA 3HL8A 3DLEA 3VQBA 2IV8A 3DPTA 3B6OA 1UWBA 5I3UA 1RTDA 4DSKA 1HQUA 1UOCA 3LP0A 3HJFA 1RT1A 3AVBA 3VN5A 4ELTA 4FK4A 3O4NA 2P5OA 4FJGA 4I9QA 3RMCA 3NF8A 1HQEA 1KTQA 4AH9A 2XHIA 1FXXA 1VSEA 3NBPA 4M41A 3AO2A 3L3VA 1QN9A 5HBMA 4IKFA 4CESA 2OPPA 2EX3A 3VQ9A 3K58A 4O5BA 1NK9A 1RILA 3AO5A 3TAPA 1SUQA 1KVBA 1X9MA 1NK7A 3O3HA 3DLKA 1VSKA 3S3NA 1O1WA 3SUOA 2G8WA 4M3UA 4M3TA 3WNGA 4CFDA 4OPJA 1QTPA 4OKEA 1C0TA 2Z1HA 1ASWA 4M3XA 2VG6A 1XHXA 3AV9A 2NOHA 1J53A 4ID5A 4ID1A 3TR8A 4CJFA 4CJLA 4KB0A 3IAYA 1NK0A 1ZBFA 4I9LA 1ZBIA 4KTWA 3V9WA 2HHQA 1QE1A 2HNZA 5J2NA 5E41A 5HROA 1WAJA 2BDPA 2X78A 3CYMA 2QKBA 4FJ7A 3HSTB 3DYAA 3ISNC 3PY8A 5D3GA 2FGTA 3TANA 4FLWA 1RDBA 3SCXA 1S1TA 3QINA 1F21A 4H4OA 4KO0A 4LH4A 4WE1A 4DSLA 3PX4A 3U6FA 2HW3A 4E89A 1FN7A 1S1VA 3AVNA 4CJQA 1M3HA 1SV5A 1RM1A 3TWHA 5KRSA 2FBTA 1WSEA 1N3CA 2BANA 4CJUA 4E7JA 1T03A 1IKWA 4ZHRA 1U4BA 3E01A 3TARA 1REVA 4NYFA 4C8LA 3HS8A 2JOIA 3DOKA 2F8TA 1YT3A 4W5TA 3KLGA 3P83D 4B0AA 1RT5A 2Z1JA 3OYEA 4E1MA 3LDSA 5K14A 3ZSYA 1FK9A 4DTUA 4ZTFA 4KKOA 2D0BA 2O4GA 5FDLA 1HMVA 5KRTA 4PQUA 4DFPA 4HHTA 3AVLA 5CYQA 3RMAA 1NVPA 4E7HA 3ITHA 5IYDP 4KHQA 2BE2A 3SUPA 4Q11A 3THVA 4B8CA 3LWLA 3MXIA 4DF8A 3QEWA 4CF1A 2NOFA 2PYJA 2IGIA 2IS3A 3CFPA 4E1NA 1D9FA 3MECA 3AVMA 5I42A 1QTMA 2QK9A 4DFKA 1JXBA 1UT4A 3K57A 4F3TA 4IDKA 1BI4A 4CF8A 3KTUA 3WNEA 5JS2A 1U47A 4I2PA 4DWIA 4CGFA 5JS1A 3IH7A 3PV8A 2Z1IA 4O44A 1CZBA 3HS9A 2Z8UA 4BACA 1LV5A 3SYZA 2E6LA 1D8YA 1M3QA 3VQCA 4AHVA 1RDCA 3ZT4A 1JFIC 1QN7A 4N76A 4JS5A 1TBAB 1IKVA 1WLJA 2YNHA 3LALA 2XHBA 3HK2A 1BCOA 3KLIA 2RKIA 1RT7A 5AN4A 3MAQA 2IDOA 1RBTA 1C9BB 3VQPA 3OS0A 1UT7A 2X6NA 5KTQA 3K59A 3NAEA 3M8RA 1D9DA 1PZDA 2IV9A 3OC3C 4DULA 4W5RA 1X9WA 2G8UA 1T7PA 4DF4A 2OZMA 3DLHA 4KB1A 1NKCA 4DQRA 4UQGA 4BDYA 3H08A 4CK2A 3KIOA 1UAXA 2Q3SA 1NH2A 4TPSA 4DQPA 4FK0A 1BIUA 1TAQA 4FLVA 4OVLA 2XY7A 3TAQA 3F73A 4BE2A 4FZYA 2I5WA 2DFFA 1KCFA 2FBVA 2VG7A 3AVAA 2XY6A 3F10A 3UIQA 1CLQA 3C6UA 1IKXA 4LSLA 1B9DA 4DSEA 1NKBA 4CJRA 3QO9A 1BIZA 1UA0A 2HHUA 2LAEA 1D5AA 3IG1A 4DFMA 5FRMA 1LW0A 3AA3A 4CK1A 4DTOA 4J2EA 2KZMA 1RT4A 2HNYA 3VQ7A 3SNSA 4KREA 1J9AA 3NH2A 3PO4A 1S1UA 1QN4A 4GMJB 3OYBA 3K5NA 3NF9A 4O0JA 3ASMA 1QNCA 1TL1A 3M8PA 3I8DA 1TAUA 3O4QA 4Z4GA 3QIPA 1RBRA 1I39A 2HHWA 1RT2A 3G10A 4CGIA 1TK8A 4NYNA 5DMRA 2KQ2A 2XRIA 2XY8A 1IKYA 4F8RA 3ZSRA 3LP1A 1TKZA 5C25A 4GW6A 4CJSA 3OS2A 3NCIA 3ZT1A 3LWMA 4B3OA 2ZE2A 4AHSA 3B6PA 4FM2A 4FJLA 3OS1A 2YNGA 1DLOA 4MFBA 1LAVA 4DTPA 3LZIA 4NCAA 4OJRA 1C0MA 3A2FA 3I0WA 2YNFA 1TL3A 3AVJA 4O0IA 4DLGA 1KYUA 3KKRA 1TKXA 4DFJA 2HVHA 2DTUA 3OYHA 1Z25A 2NOIA 4QOZB 4Y1DA 2YKMA 4HCBA 1BQNA 1QTSA 1X1PA 1Z26A 5J2QA 4KHYA 1IH7A 4ICLA 4Z4CA 2QXFA 1RBSA 3SI6A 1GOBA 2RPIA 3VQAA 3IS9A 3KK3A 5SWMA 3TAEA 1TKTA 2OYQA 4HCCA 1ZBUA 4B9UA 4ELVA 1WNSA 4EJZA 4CGDA 3C95A 3K2PA 1TK5A 4FJ5A 4B9MA 4FYDA 4ZTJA 3NHGA 1NJXA 2KW4A 3DLRA 1SKSA 4Z0UA 3OVNA 2VJ0A 1CDWA 1EX4A 2G8KA 3DLBA 1JLQA 1C1CA 2GUIA 3SNNA 2P51A 5CYMA 3S9HA 4CERA 1L3TA 3F9KA 1VSLA 1SL2A 4W5OA 3SZ2A 3ULDA 4LY7A 3QNNA 1XI1A 1U45A 1HYZA 1KVCA 4CIFA 2IAJA 3OYGA 3ZSQA 1N5YA 4H4MA 4KPYA 3G0ZA 4HVJA 3KRMA 2HZMA 1HU0A 2R7YA 1JXEA 1SL1A 4CEOA 1QSSA 4N47A 3SJJA 1VSJA 4KHWA 2XY5A 3JYTA 4Z4IA 1LWWA 3V9ZA 4AHUA 1VSIA 4FVMA 4M45A 3CG7A 1C1AA 4CJ4A 3C6TA 3AVGA 1RDDA 5DK5A 2F8SA 4DQSA 3H1ZA 2KZZA 1RBUA 1XHZA 1U04A 2NOLA 2MJ7A 3F0ZA 1ZBLA 4FZZA 1TBPA 2NOBA 3T1AA 3V9UA 1VSMA 1VOKA 3WNFA 3D0PA 4DSFA 1J5OA 2HMIA 3VA3A 3O3GA 3V4IA 3PX0A 3S3OA 1UA1A 2YNIA 4KAZA 1RTJA 2HHXA 4DTRA 4KRFA 1FKOA 1GOCA 1SL0A 3HVRA 3QETA 4KTQA 2B5JA 3SV3A 3CM5A 1T05A 4BWJA 2PYLA 1BHLA 4FJ8A 4I7FA 3NDKA 4NCBA 2D0CA 1JL1A 1NK6A 3VQ6A 3OYCA 1TGHA 4CJTA 4FLZA 3HPGA 5FROA 1QQCA 4IG3A 1WSFA 2OPSA 2X6SA 3OYJA 4FLUA 4TSXA 3DM2A 4EZ6A 3HXMA 1RBVA 1A5VA 1QN6A 4IG0A 3KKSA 4FJHA 2KFNA 4FW2A 1ASUA 2W42A 2F96A 4DS5A 4F2RA 4KHNA 2FC0A 2G8HA 1WSJA 2B6AA 3LANA 5HRRA 4E19A 1YQKA 1VRTA 4CEQA 4DU4A 4WZSD 1KVAA 4M3ZA 1JL2A 2A1SA 4CEZA 1NJYA 1VSDA 4CJPA 2PY5A 3RRHA 2DY4A 3PUFA 3TABA 2HB5A 3KJVA 4FJXA 3AVFA 5KI6A 3VQDA 4CE9A 1HNIA 4DTSA 4FJNA 1L3SA 1KRPA 1JLFA 4DG1A 4F4KA 3HPHA 4RW8A 4DLEA 3HT3A 1CZ9A 3NH1A 3DOLA 2YHAA 1QN8A 1HYVA 1W9HA 4CFAA 1JLGA 3CM6A 4FLYA 3SUQA 3KD1E 4FJJA 1Q8IA 3HVTA 1JLAA 1PCZA 3OYKA 3CFOA 1CXQA 1QNBA 1WSHA 2IOCA 3HP6A 1XC9A 3VQ8A 1A5XA 2OPRA 4OKKA 3DMJA 1VTLE 2JGUA 3V1OA 4CGJA 3LP2A 3ZT3A 4CEBA 5KGXA 3RWUA 3RTVA 4OLAA 3K5OA 4CJWA 1N39A 2P1JA 4O55A 4I8OA 1YQMA 1S5JA 1BCMA 5J2PA 4HUEA 1YTUA 5FRNA 3DLGA 3OSTA 4IBNA 5C42A 1NK8A 4CEFA 1RT3A 1W80A 1MU2A 4JRPA 4B9NA 1YVUA 1ZYQA 3RR7A 4E7LA 4XIUA 1LWVA 1N6QA 4RW6A 1NJWA 1ASVA 3AVKA 3VQQA 1HJRA 2GV9A 4M3YA 2G8VA 3C94A 4CHQA 3EY1A 2HVIA 4PA1A 3L2WA 3V9XA 1R4XA 3QLHA 1KFSA 4CHZA 3M8SA 4FLTA 2EHGA 1JLEA 3NF7A 3ZSOA 4BE0A 3SQ1A 4CIGA 1ZBHA 4DQQA 3CQ8A 4K8XA 1S1XA 3ZCMA 3NFAA 4F3OA 1VK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G1Q A;  4C8N A;  3U3Y A;  3OJS A;  1KYD A;  1JKH A;  4HTU A;  3V9S A;  4BE1 A;  3TAG A;  2G8F A;  4N41 A;  4FM1 A;  3VQ5 A;  4KI4 A;  4CHP A;  2QKK A;  4DSJ A;  2YKN A;  3DRR A;  3TAM A;  2HHS A;  5T7B A;  1T8E A;  2O4I A;  4CHY A;  4FM0 A;  3DRS A;  3FFI A;  2ATQ A;  4E3S A;  1KFD A;  5EU7 A;  2KFZ A;  1RNH A;  1JLC A;  4N56 A;  1KY6 A;  1Y97 A;  5J1E A;  1DTT A;  4FW1 A;  4IFV A;  3LAK A;  4KHU A;  4CIE A;  1VSF A;  1HPZ A;  4B9L A;  4LSN A;  3OYN A;  4CF0 A;  4LD0 A;  1KSP A;  4FJ9 A;  4OLB A;  1C6V A;  3O3F A;  4C8M A;  4W5Q A;  3KK2 A;  2YHB A;  3QEV A;  1NJZ A;  3QIO A;  3V1R A;  3AVI A;  1FKP A;  2FBY A;  1DTQ A;  3OY9 A;  1QSL A;  3RMD A;  2A1R A;  4J2D A;  1LWC A;  1C0U A;  3D45 A;  3T19 A;  3ZSZ A;  4E7K A;  1QN5 A;  4NCG A;  3QEX A;  1QSY A;  4E7I A;  2Z1G A;  2BGG A;  4KV8 A;  4MQ3 A;  4FZX C;  4PWD A;  2ZQB A;  1EXQ A;  2Y1J A;  1U49 A;  1Q9Y A;  4K8Z A;  2AJQ A;  3AO4 A;  3SPZ A;  4B8A B;  1GOA A;  3SV4 A;  3KD5 E;  3KLH A;  4AIL C;  1LWE A;  1RTH A;  4J2B A;  3NGI A;  3RRG A;  4CJV A;  1KLM A;  3AO1 A;  1U48 A;  2LSN A;  2DFH A;  4YNQ A;  4CED A;  5J2M A;  2ZD1 A;  1HRH A;  4RG8 A;  1EET A;  1ITG A;  4AHC A;  3KTQ A;  4RW4 A;  4FJM A;  3OYD A;  1WN7 A;  4Q5V A;  1R0A A;  1KY7 A;  1I3A A;  4L8R B;  1BQM A;  5CZ1 A;  3AVH A;  3NH0 A;  3T3F A;  1RTI A;  1RDA A;  3SUN A;  1VSH A;  1Q9X A;  2P5G A;  4EZ9 A;  2DFE A;  4Z4F A;  2WON A;  3SQ2 A;  3NF6 A;  1S6P A;  5KGW A;  3ALY A;  4CJ3 A;  3L2Q A;  3K5L A;  3ZSV A;  1WAF A;  2D0A A;  4Y1C A;  1RCH A;  3L2U A;  3HYF A;  1SKR A;  5C24 A;  1S9G A;  3I0S A;  3V81 A;  4DS4 A;  1LWF A;  3PX6 A;  4DTM A;  4M42 A;  4CFB A;  3OYL A;  3LPU A;  4CF2 A;  3LPT A;  4CJK A;  4BDP A;  4PY5 A;  2X74 A;  1QHT A;  4JLH A;  5CZ2 A;  2HHV A;  3RR8 A;  3VA0 A;  3K5M A;  1QNA A;  2ETJ A;  3MXM A;  4F2S A;  3BGR A;  1BGX T;  4KFB A;  4FCY A;  1TKD A;  1RT6 A;  4IFY A;  3ZSW A;  4EP5 A;  3CFR A;  2FBX A;  1TK0 A;  4CHO A;  3KLF A;  4CF9 A;  1NK5 A;  1NKE A;  1CXU A;  3I0R A;  3MED A;  1B92 A;  1SKW A;  3RMB A;  1YTA A;  3PO5 A;  1HYS A;  1BI4 B;  1NGM A;  3DI6 A;  4FLX A;  4CGH A;  2E6M A;  1QN3 A;  3OYF A;  4DTN A;  3V1Q A;  3MXJ A;  4CCH A;  1EKE A;  2Y1I A;  4ROC B;  1B9F A;  3NGY A;  4DU1 A;  3SQ4 A;  3QEP A;  5I42 A;  4W5N A;  3QES A;  3DRP A;  4H8K A;  4YFU A;  5IYB P;  2OZS A;  5IYC P;  2VWK A;  3AA5 X;  1L3V A;  3QER A;  1TVR A;  4I2Q A;  3NGZ A;  3HM9 A;  2D5R A;  3S3M A;  3LAM A;  4Z4H A;  2HHT A;  1LAW A;  4FK2 A;  2GBZ A;  1B9K A;  3SQ0 A;  4ROE B;  3MEE A;  3HPO A;  4AHT A;  1L3U A;  3OYM A;  2YV0 X;  3AVC A;  4HUF A;  4GVM A;  3EIK A;  3OJU A;  3TAF A;  3L3U A;  3KLE A;  2I5J A;  4FJK A;  1X9S A;  1VTO A;  4BWM A;  1E42 A;  4BDZ A;  4RW9 A;  4DTJ A;  4DQI A;  4CJ5 A;  1IG9 A;  4CGG A;  4B9T A;  4QCL A;  3MEG A;  4CK3 A;  1KYF A;  4DMN A;  5HRN A;  1TV6 A;  1BL3 A;  2NUB A;  3P5J A;  1VRU A;  1QS4 A;  4OGE A;  5HRP A;  2WOM A;  1A5W A;  4CJE A;  4N5S A;  4OPK A;  4CHN A;  4DU3 A;  1J54 A;  4CEA A;  2PZS A;  2G30 A;  3OCI A;  4CFC A;  2G8I A;  4EP4 A;  4KI6 A;  5SZT A;  3ZSX A;  3VQE A;  4J2A A;  1TGO A;  2E4L A;  4C8O A;  2OPQ A;  3LZJ A;  1JLB A;  4HUG A;  2VG5 A;  3LP3 A;  5HLF A;  1NOY A;  3AO3 A;  4C8K A;  2KTQ A;  1NOZ A;  1S6Q A;  3M8Q A;  3OYI A;  3P1G A;  4DSI A;  3SPY A;  1IO2 A;  4R5P A;  1EP4 A;  1XWL A;  2RN2 A;  1C1B A;  4PUO A;  1G15 A;  3V6D A;  1AIS A;  3QNO A;  3ZT2 A;  5CY4 A;  2ITG A;  4RW7 A;  2HND A;  1KLN A;  1D3U A;  4OGC A;  4M3R A;  1S9E A;  1QNE A;  1MP9 A;  2B4J A;  1BIS A;  4AHR A;  2RF2 A;  3BDP A;  3U3G A;  3WNH A;  1WSI A;  4O4G A;  4OKJ A;  4DTX A;  3TI0 A;  2OA8 A;  1S1W A;  3KK1 A;  4KHS A;  3L8B A;  3AA2 A;  4QAG A;  3AA4 A;  2VWJ A;  3VQ4 A;  4B9S A;  1L5U A;  3HO1 A;  4CEE A;  3L2R A;  3L2V A;  2IC3 A;  3HP9 A;  2JLE A;  2XO7 A;  3NE6 A;  3QEI A;  4ELU A;  1HNV A;  4B08 A;  4LH5 A;  1VOL B;  3EYZ A;  4Z4E A;  4ROD B;  4CEC A;  3IRX A;  5HP1 A;  4KTZ A;  4E0D A;  4FXD A;  3ZT0 A;  1LW2 A;  4M3W A;  5HRS A;  3EZ5 A;  3OYA A;  1WSG A;  4Q0B A;  3JSM A;  4JRQ A;  1NK4 A;  4B9V A;  1YTB A;  1YTF A;  4FJI A;  4JS4 A;  1K6Y A;  1W0H A;  3HL8 A;  3DLE A;  3VQB A;  2IV8 A;  3B6O A;  5I3U A;  1UWB A;  1RTD A;  4DSK A;  1HQU A;  1UOC A;  3LP0 A;  3HJF A;  1RT1 A;  3AVB A;  3VN5 A;  4ELT A;  4FK4 A;  3O4N A;  2P5O A;  4FJG A;  4I9Q A;  3RMC A;  3NF8 A;  1HQE A;  1KTQ A;  4AH9 A;  1FXX A;  1VSE A;  3NBP A;  4M41 A;  3AO2 A;  3L3V A;  1QN9 A;  5HBM A;  4IKF A;  4CES A;  2OPP A;  2EX3 A;  3VQ9 A;  3K58 A;  4O5B A;  1NK9 A;  1RIL A;  3AO5 A;  3TAP A;  1SUQ A;  1KVB A;  1X9M A;  1NK7 A;  3O3H A;  3DLK A;  1VSK A;  3S3N A;  1O1W A;  3SUO A;  2G8W A;  4M3U A;  4M3T A;  3WNG A;  4CFD A;  4OPJ A;  1QTP A;  4OKE A;  1C0T A;  2Z1H A;  1ASW A;  4M3X A;  2VG6 A;  1XHX A;  3AV9 A;  1J53 A;  4ID5 A;  3TR8 A;  4ID1 A;  4CJF A;  4CJL A;  4KB0 A;  3IAY A;  1NK0 A;  1ZBF A;  4I9L A;  1ZBI A;  4KTW A;  3V9W A;  2HHQ A;  1QE1 A;  2HNZ A;  5J2N A;  5E41 A;  5HRO A;  1WAJ A;  2BDP A;  2X78 A;  3CYM A;  2QKB A;  4FJ7 A;  3HST B;  3DYA A;  3ISN C;  3PY8 A;  5D3G A;  3TAN A;  4FLW A;  1RDB A;  3SCX A;  1S1T A;  3QIN A;  1F21 A;  4H4O A;  4KO0 A;  4LH4 A;  4WE1 A;  4DSL A;  3PX4 A;  3U6F A;  2HW3 A;  4E89 A;  1S1V A;  3AVN A;  4CJQ A;  1SV5 A;  1RM1 A;  3TWH A;  5KRS A;  2FBT A;  2BAN A;  1WSE A;  4CJU A;  4E7J A;  1T03 A;  1IKW A;  4ZHR A;  1U4B A;  3E01 A;  3TAR A;  1REV A;  4NYF A;  4C8L A;  3HS8 A;  3DOK A;  2F8T A;  1YT3 A;  4W5T A;  3KLG A;  3P83 D;  4B0A A;  1RT5 A;  2Z1J A;  3OYE A;  4E1M A;  3LDS A;  5K14 A;  3ZSY A;  1FK9 A;  4DTU A;  4ZTF A;  4KKO A;  2D0B A;  2O4G A;  5FDL A;  1HMV A;  5KRT A;  4PQU A;  4DFP A;  4HHT A;  3AVL A;  5CYQ A;  3RMA A;  1NVP A;  4E7H A;  3ITH A;  5IYD P;  4KHQ A;  2BE2 A;  3SUP A;  3THV A;  4B8C A;  3LWL A;  3MXI A;  4DF8 A;  3QEW A;  4CF1 A;  2PYJ A;  2IGI A;  2IS3 A;  3CFP A;  4E1N A;  1D9F A;  3MEC A;  3AVM A;  1QTM A;  2QK9 A;  4DFK A;  1JXB A;  3K57 A;  4F3T A;  4IDK A;  1BI4 A;  4CF8 A;  1U47 A;  3WNE A;  5JS2 A;  4DWI A;  4I2P A;  5JS1 A;  4CGF A;  3PV8 A;  2Z1I A;  4O44 A;  1CZB A;  3HS9 A;  2Z8U A;  4BAC A;  1LV5 A;  3SYZ A;  2E6L A;  1D8Y A;  4N76 A;  3VQC A;  4AHV A;  1RDC A;  3ZT4 A;  1JFI C;  1QN7 A;  3HK2 A;  4JS5 A;  1TBA B;  1IKV A;  1WLJ A;  2YNH A;  3LAL A;  2XHB A;  1BCO A;  3KLI A;  2RKI A;  1RT7 A;  3MAQ A;  2IDO A;  1RBT A;  1C9B B;  3VQP A;  3OS0 A;  2X6N A;  5KTQ A;  3K59 A;  3NAE A;  3M8R A;  1D9D A;  1PZD A;  2IV9 A;  3OC3 C;  4W5R A;  1X9W A;  2G8U A;  1T7P A;  2OZM A;  4DF4 A;  3DLH A;  4KB1 A;  1NKC A;  4DQR A;  4UQG A;  4BDY A;  3H08 A;  4CK2 A;  3KIO A;  1UAX A;  2Q3S A;  1NH2 A;  4DQP A;  4FK0 A;  1BIU A;  1TAQ A;  4FLV A;  4OVL A;  2XY7 A;  3TAQ A;  3F73 A;  4BE2 A;  4FZY A;  2DFF A;  1KCF A;  2FBV A;  2VG7 A;  3AVA A;  2XY6 A;  3UIQ A;  1CLQ A;  3C6U A;  1IKX A;  4LSL A;  1B9D A;  4DSE A;  1NKB A;  4CJR A;  3QO9 A;  1BIZ A;  1UA0 A;  2HHU A;  1D5A A;  3IG1 A;  4DFM A;  5FRM A;  1LW0 A;  3AA3 A;  4CK1 A;  4DTO A;  4J2E A;  2KZM A;  1RT4 A;  2HNY A;  3VQ7 A;  4KRE A;  1J9A A;  3NH2 A;  3PO4 A;  1S1U A;  1QN4 A;  4GMJ B;  3OYB A;  3K5N A;  3NF9 A;  4O0J A;  3ASM A;  1QNC A;  1TL1 A;  3M8P A;  3I8D A;  1TAU A;  3O4Q A;  4Z4G A;  3QIP A;  1RBR A;  1I39 A;  2HHW A;  1RT2 A;  3G10 A;  4CGI A;  1TK8 A;  4NYN A;  5DMR A;  2KQ2 A;  2XRI A;  2XY8 A;  1IKY A;  4F8R A;  3ZSR A;  3LP1 A;  1TKZ A;  5C25 A;  4GW6 A;  4CJS A;  3OS2 A;  3NCI A;  3ZT1 A;  3LWM A;  4B3O A;  2ZE2 A;  4AHS A;  3B6P A;  4FM2 A;  4FJL A;  3OS1 A;  2YNG A;  1DLO A;  4MFB A;  1LAV A;  4DTP A;  3LZI A;  4NCA A;  4OJR A;  1C0M A;  3A2F A;  4O0I A;  2YNF A;  1TL3 A;  3AVJ A;  4DLG A;  4DFJ A;  1KYU A;  3KKR A;  1TKX A;  2HVH A;  2DTU A;  3OYH A;  1Z25 A;  4QOZ B;  4Y1D A;  2YKM A;  4HCB A;  1BQN A;  1QTS A;  1X1P A;  1Z26 A;  5J2Q A;  4KHY A;  1IH7 A;  4ICL A;  4Z4C A;  2QXF A;  1RBS A;  3SI6 A;  1GOB A;  2RPI A;  3VQA A;  3IS9 A;  3KK3 A;  5SWM A;  3TAE A;  1TKT A;  2OYQ A;  4HCC A;  1ZBU A;  4B9U A;  4ELV A;  1WNS A;  4CGD A;  3C95 A;  3K2P A;  1TK5 A;  4FJ5 A;  4B9M A;  4FYD A;  4ZTJ A;  3NHG A;  1NJX A;  2KW4 A;  3DLR A;  1SKS A;  4Z0U A;  3OVN A;  2VJ0 A;  1CDW A;  1EX4 A;  2G8K A;  3DLB A;  1JLQ A;  1C1C A;  2GUI A;  3SNN A;  2P51 A;  5CYM A;  3S9H A;  4CER A;  1L3T A;  3F9K A;  1VSL A;  1SL2 A;  4W5O A;  3SZ2 A;  3ULD A;  4LY7 A;  3QNN A;  1XI1 A;  1U45 A;  1HYZ A;  1KVC A;  4CIF A;  2IAJ A;  3OYG A;  3ZSQ A;  1N5Y A;  4H4M A;  4KPY A;  3G0Z A;  4HVJ A;  2R7Y A;  1JXE A;  1SL1 A;  4CEO A;  1QSS A;  4N47 A;  3SJJ A;  1VSJ A;  4KHW A;  2XY5 A;  3JYT A;  4Z4I A;  3V9Z A;  4AHU A;  1VSI A;  4FVM A;  4M45 A;  3CG7 A;  1C1A A;  4CJ4 A;  3C6T A;  3AVG A;  1RDD A;  5DK5 A;  2F8S A;  4DQS A;  3H1Z A;  2KZZ A;  1RBU A;  1XHZ A;  1U04 A;  2MJ7 A;  1ZBL A;  4FZZ A;  1TBP A;  3T1A A;  3V9U A;  1VSM A;  1VOK A;  3WNF A;  3D0P A;  4DSF A;  1J5O A;  2HMI A;  3VA3 A;  3O3G A;  3V4I A;  3PX0 A;  3S3O A;  1UA1 A;  2YNI A;  4KAZ A;  1RTJ A;  2HHX A;  4DTR A;  4KRF A;  1FKO A;  1GOC A;  1SL0 A;  3HVR A;  3QET A;  4KTQ A;  2B5J A;  3SV3 A;  3CM5 A;  1T05 A;  4BWJ A;  2PYL A;  1BHL A;  4FJ8 A;  4I7F A;  3NDK A;  4NCB A;  2D0C A;  1JL1 A;  1NK6 A;  3VQ6 A;  3OYC A;  1TGH A;  4CJT A;  4FLZ A;  3HPG A;  5FRO A;  1QQC A;  4IG3 A;  1WSF A;  2OPS A;  2X6S A;  3OYJ A;  4FLU A;  4TSX A;  3DM2 A;  4EZ6 A;  3HXM A;  1RBV A;  1A5V A;  1QN6 A;  4IG0 A;  3KKS A;  4FJH A;  2KFN A;  4FW2 A;  1ASU A;  2W42 A;  2F96 A;  4DS5 A;  4F2R A;  4KHN A;  2FC0 A;  2G8H A;  1WSJ A;  2B6A A;  3LAN A;  5HRR A;  4E19 A;  1VRT A;  4CEQ A;  4DU4 A;  4WZS D;  1KVA A;  4M3Z A;  1JL2 A;  2A1S A;  4CEZ A;  1NJY A;  1VSD A;  4CJP A;  2PY5 A;  3RRH A;  2DY4 A;  3PUF A;  3TAB A;  2HB5 A;  3KJV A;  4FJX A;  3AVF A;  5KI6 A;  3VQD A;  4CE9 A;  1HNI A;  4DTS A;  4FJN A;  1L3S A;  1KRP A;  1JLF A;  4DG1 A;  4F4K A;  3HPH A;  4RW8 A;  4DLE A;  3HT3 A;  1CZ9 A;  3NH1 A;  3DOL A;  2YHA A;  1QN8 A;  1HYV A;  1W9H A;  4CFA A;  1JLG A;  3CM6 A;  4FLY A;  3SUQ A;  3KD1 E;  4FJJ A;  1Q8I A;  3HVT A;  1JLA A;  1PCZ A;  3OYK A;  3CFO A;  1CXQ A;  1QNB A;  1WSH A;  2IOC A;  3HP6 A;  1XC9 A;  3VQ8 A;  1A5X A;  2OPR A;  4OKK A;  3DMJ A;  1VTL E;  2JGU A;  3V1O A;  4CGJ A;  3LP2 A;  3ZT3 A;  4CEB A;  5KGX A;  3RWU A;  3RTV A;  4OLA A;  3K5O A;  4CJW A;  2P1J A;  4O55 A;  1S5J A;  1BCM A;  5J2P A;  4HUE A;  1YTU A;  5FRN A;  3DLG A;  5C42 A;  4IBN A;  1NK8 A;  4CEF A;  1RT3 A;  1W80 A;  1MU2 A;  4JRP A;  4B9N A;  1YVU A;  1ZYQ A;  3RR7 A;  4E7L A;  4XIU A;  1N6Q A;  4RW6 A;  1NJW A;  1ASV A;  3AVK A;  3VQQ A;  1HJR A;  2GV9 A;  4M3Y A;  2G8V A;  3C94 A;  4CHQ A;  3EY1 A;  2HVI A;  4PA1 A;  3L2W A;  3V9X A;  1R4X A;  3QLH A;  1KFS A;  4CHZ A;  3M8S A;  4FLT A;  2EHG A;  1JLE A;  3NF7 A;  3ZSO A;  4BE0 A;  3SQ1 A;  4CIG A;  1ZBH A;  4DQQ A;  3CQ8 A;  4K8X A;  1S1X A;  3ZCM A;  3NFA A;  4F3O A;  1VK0 A; 
#chains in the Genus database with same CATH topology
 4G1Q A;  1TYQ B;  2D4W A;  3CQY A;  1QQM A;  5EOY A;  3TAG A;  2DKA A;  2O8D A;  4N41 A;  1XQS C;  1YF5 L;  2KKZ A;  2QKK A;  2HHS A;  3O9T A;  5T7B A;  4BRG A;  3FFI A;  2KFZ A;  1RNH A;  4N56 A;  1Y97 A;  2YI1 A;  4FW1 A;  3F9M A;  5EY4 A;  2AP1 A;  4B9L A;  1C6V A;  3KWG A;  2E2N A;  2P9U B;  3DPU A;  4I6M B;  2A1R A;  3ENH A;  3T19 A;  4E7K A;  4E7I A;  2Z1G A;  2Y1J A;  4K8Z A;  2AJQ A;  3KD5 E;  1GOA A;  4AIL C;  3C6H A;  3NGI A;  3O1B A;  1YXQ A;  1KLM A;  4AM6 A;  2DFH A;  2ZD1 A;  3WT0 A;  4AHC A;  1KC8 O;  4BRQ A;  1WN7 A;  2QI2 A;  3T3F A;  4Z4F A;  2JWL A;  3F2K A;  3NF6 A;  4JKH A;  4YOX A;  2D1K A;  4CJ3 A;  4CZE A;  3L2Q A;  1WAF A;  3I33 A;  3VTH A;  3L2U A;  3HYF A;  1SKR A;  5KL0 A;  3I0S A;  3AAP A;  4CZM A;  5BR8 K;  4M42 A;  3RSE B;  2X74 A;  1KXP A;  2YJF A;  3MXM A;  2ETJ A;  4BRL A;  3BGR A;  1BGX T;  1HNZ K;  5AQY A;  4KFB A;  4FCY A;  4IFY A;  1EBM A;  2GEL A;  4EP5 A;  1T6D A;  3KLF A;  1SKW A;  4JKG A;  2NRR A;  3MED A;  1HYS A;  4QS8 A;  1VQM N;  1BI4 B;  3UE5 A;  2E6M A;  3KWI A;  3HZ6 A;  4DR1 K;  3MXJ A;  3CC2 N;  3SQ4 A;  3NGY A;  4Z94 A;  4W5N A;  3QEP A;  2NOE A;  2HZS A;  3PMG A;  3DRP A;  3K9K A;  5IYC P;  2Y8Q A;  3VEW A;  3J8A A;  4RCH A;  3NGZ A;  3LAM A;  4XEI A;  4K43 A;  2OTL N;  2QWO A;  3OYM A;  1NBW A;  3OSM A;  3AVC A;  3FFK B;  1DGK N;  3OJU A;  2I5J A;  5B8H A;  3R1X A;  1OVQ A;  4BDZ A;  2WBN A;  1IG9 A;  4CK3 A;  4FWM A;  2NUB A;  4JK9 A;  1M90 O;  1SZ2 A;  4OGE A;  4N5S A;  2WOM A;  1VQN N;  3O9U A;  3VGK A;  2QRE A;  3OCI A;  2GTD A;  4M7Y A;  5SZT A;  4KI6 A;  3W0L A;  4J2A A;  3QIC A;  4HUG A;  4FOE A;  2GWJ A;  1U2V A;  2V52 B;  1NOY A;  3AO3 A;  4C8K A;  3M8Q A;  1S6Q A;  2GEM A;  4R5P A;  5CHI A;  5KPR A;  3A5L C;  1G15 A;  1OH6 A;  1MWK A;  1YIT N;  3QNO A;  3R9P A;  4JKB A;  5CY4 A;  2R5X A;  2NRH A;  4RW7 A;  2E1Y A;  3JXU A;  3G6E N;  3ZET A;  1D3U A;  4OGC A;  3UW2 A;  1QNE A;  1MP9 A;  3MDQ A;  4AHR A;  3BDP A;  2HST A;  1WSI A;  3TI0 A;  1WOQ A;  3AA2 A;  4QAG A;  4DV5 K;  1L5U A;  1EWQ A;  3HP9 A;  5BRE A;  4ELU A;  1ESV A;  1HNV A;  4LH5 A;  2RE2 A;  1QHA A;  1RDU A;  5HP1 A;  5BPL A;  4J8F A;  2FKF A;  3OYA A;  4ILJ A;  1YTB A;  4BRM A;  1YTF A;  4FPB A;  1C47 A;  5IT9 O;  1NGF A;  3VQB A;  3OTO K;  1HQU A;  1RT1 A;  4WYB A;  2BUP A;  4ELT A;  3ZYY X;  3SBG A;  4M63 C;  5HBM A;  4IKF A;  4GKK K;  2EX3 A;  3Q7B A;  1NK9 A;  1RIL A;  1NG9 A;  3AO5 A;  3TAP A;  1SUQ A;  3O3H A;  1VQ8 N;  3DLK A;  3S3N A;  4M3U A;  3QML A;  4JK8 A;  5GAG P;  1QTP A;  2Z1H A;  1ASW A;  2O8C B;  3EO3 A;  3C04 A;  1XMO K;  4CJF A;  2NOH A;  1J53 A;  4ID1 A;  3QBX A;  4KB0 A;  2NRW A;  3IAY A;  1Z6R A;  2EHB D;  2X78 A;  5AQK A;  4B3T K;  1HUX A;  3ISN C;  2UXB K;  1S1T A;  4H4O A;  1F21 A;  4LH4 A;  1VQ4 N;  1KD1 O;  4WE1 A;  4JHD B;  1FN7 A;  1S22 A;  2P9I A;  4CZL A;  4CJQ A;  3TWH A;  2WTU A;  4CJU A;  1WSE A;  1N3C A;  4O8K A;  4JD2 A;  3CCQ N;  3VMF B;  5GAH P;  5BMN A;  1REV A;  1W97 L;  2JOI A;  3HO1 A;  1GLJ O;  4E1M A;  4D7R A;  1FK9 A;  4ZTF A;  4KKO A;  2O4G A;  1OVY A;  3MWT A;  4E7H A;  2BE2 A;  3HSC A;  4B8C A;  3LWL A;  4JAX A;  4DF8 A;  4E1N A;  3MEC A;  3FZL A;  1QTM A;  2QK9 A;  1UT4 A;  4F3T A;  4CF8 A;  1K2Y X;  3GDQ A;  1BG3 A;  4R79 A;  3GE1 A;  3IH7 A;  3PV8 A;  2P9S A;  2E6L A;  3G25 A;  4AHV A;  3ZT4 A;  1QN7 A;  3HK2 A;  1BCO A;  4A5B A;  2VQF K;  2IDO A;  1RBT A;  1DKG D;  4JKE A;  2X6N A;  5AQS A;  3C7N B;  1X9W A;  4LF9 K;  4KB1 A;  1W2B M;  5A2Q O;  4CK2 A;  4GV6 A;  1NGC A;  1ILY A;  1TAQ A;  2NZT A;  4MO5 A;  4OVL A;  4MO4 A;  4U7B A;  3F73 A;  4BE2 A;  4B3M K;  2DKD A;  3ZX0 A;  3UIQ A;  5AQI A;  2QTD A;  3R3L A;  5JVH L;  2CGK A;  4CZI A;  3A5M C;  2LAE A;  4B1U B;  5FRM A;  4J2E A;  5BRF A;  1RT4 A;  5F2R A;  3SNS A;  3O1W A;  3PO4 A;  4GMJ B;  1TAU A;  3NF9 A;  1GLE G;  2NRV A;  3SJH A;  1GLF O;  4Z4G A;  3QIP A;  1I39 A;  2UUC K;  1IBL K;  4QG5 A;  3ZSR A;  5BRD A;  2Q36 A;  3TE5 A;  1GLL O;  1VAZ A;  3ZT1 A;  3WXI A;  1TYQ A;  4BGB A;  4AHS A;  1KFQ A;  4H5V A;  4MFB A;  3TSU A;  4DTP A;  4IWV A;  4DLG A;  2DTU A;  1YIJ N;  3OYH A;  1Z25 A;  2YKM A;  1BQN A;  1Z26 A;  5J2Q A;  2QXF A;  3SI6 A;  3VQA A;  3TAE A;  2P9U A;  4DV1 K;  4I6M A;  4B9U A;  4EJZ A;  3C95 A;  3TTC A;  3HBT A;  1NJX A;  1VQO N;  3DLR A;  2G8K A;  2VJ0 A;  2GUI A;  1VHX A;  1DEJ A;  3GG4 A;  4BRF A;  4CER A;  4DB3 A;  3CVT A;  3F9K A;  3L4Q A;  5HOO A;  4LY7 A;  1XI1 A;  3THY A;  5KPZ A;  2HZM A;  1JXE A;  3CPE A;  3ENO A;  4CEO A;  3SJJ A;  2O8B B;  2WFB A;  4CZJ A;  3JYT A;  4FOI A;  4GVE A;  3CPW M;  4FVM A;  3CER A;  4M45 A;  2GWK A;  2YA3 A;  3C6T A;  3AVG A;  1RDD A;  5DK5 A;  4DQS A;  2KZZ A;  1XHZ A;  5LJW A;  5IWA K;  2NOL A;  2MJ7 A;  1ZBL A;  1Q7Y O;  1EO1 A;  4CD1 A;  1Z05 A;  1TBP A;  2EWS A;  5LY3 A;  1VOK A;  3VF4 A;  2HMI A;  4KAZ A;  3TU5 A;  2QR1 A;  4DTR A;  4A59 A;  1GOC A;  1SL0 A;  3SV3 A;  4BWJ A;  1BHL A;  3CHW A;  1LOT B;  2D0C A;  1JL1 A;  4FWK A;  5MLC Q;  1TGH A;  4CJT A;  4G9Z A;  4TSX A;  3HRG A;  1NGE A;  3DLL L;  4FW2 A;  3AGK A;  4RWT A;  2G8H A;  5C10 A;  3LAN A;  3ENO C;  3Q7C A;  4NB4 A;  3QDK A;  3EAY A;  1SQK A;  3VEY A;  5M1K A;  3RRH A;  3VEO A;  4CE9 A;  1HNI A;  3AY9 A;  4EIA A;  4F4K A;  4LFA K;  3WUH A;  4H0P A;  4DLE A;  1Q81 O;  1CZ9 A;  1G99 A;  4BQL A;  3NH1 A;  1Q8I A;  4JI2 K;  1JLA A;  4OKK A;  3RWU A;  2JGU A;  3J7Z O;  3RSM A;  3FGU A;  2E20 A;  4A57 A;  1BCM A;  3CWS A;  5FRN A;  4BC4 A;  4IBN A;  5C42 A;  4CEF A;  4E7L A;  1LWV A;  3VQQ A;  3CF5 L;  1T3V A;  3TSQ A;  3JS6 A;  3ZSO A;  4BE0 A;  4QS9 A;  3L6Q A;  2P9L A;  3CI5 A;  5AJ3 K;  3NFA A;  4KPY A;  4C8N A;  3U3Y A;  1LWY A;  1JKH A;  4HTU A;  3V9S A;  2YH5 A;  3N89 A;  3MK6 A;  1HLU A;  4GNI A;  4CHP A;  3FE1 A;  5AZJ B;  3TAM A;  2Z0F A;  4RTF D;  4CHY A;  1IBM K;  4E3S A;  3H6E A;  2ZM6 K;  1DTT A;  3I0X A;  4IFV A;  2V7Y A;  1EUV A;  4OLB A;  2P9P B;  2O3O A;  3KK2 A;  1NJZ A;  4ISF A;  3OY9 A;  3RMD A;  1LWC A;  5C2D A;  3F5T A;  3QEX A;  2UU9 K;  1NGG A;  2BGG A;  4MQ3 A;  4PWD A;  2ZQB A;  1U49 A;  4HJH A;  5I9E B;  3NMU A;  3KLH A;  1LWE A;  4J2B A;  3RRG A;  4CJV A;  4GV9 A;  1N32 K;  4CED A;  5J2M A;  1HRH A;  4RG8 A;  5AQN A;  3CCL N;  3ENB A;  5TKW A;  3KTQ A;  1VQ6 N;  3FZF A;  4Q5V A;  1IG8 A;  1BQM A;  3NH0 A;  2P5G A;  1VSH A;  4H03 B;  2DFE A;  1XNQ K;  4BR5 A;  2A5X A;  3WEE A;  4JD2 B;  2D0A A;  3WXL A;  5C24 A;  1S9G A;  1LWF A;  5KPT A;  5AQU A;  4CF2 A;  3LPT A;  3VF2 A;  4B3S K;  4PY5 A;  1QHT A;  3VET A;  3RR8 A;  3K5M A;  1N3A A;  1QNA A;  2OOX A;  3TSP A;  2O8E B;  1TKD A;  3OGD A;  1RT6 A;  1P5G X;  3CFR A;  4X65 K;  3MX2 A;  4H5N A;  3U9D A;  3EEQ A;  4CHO A;  4M7X A;  3M5R A;  1NK5 A;  4A62 A;  3I0R A;  1B92 A;  1YTA A;  2QWL A;  3FR0 A;  1QVG M;  2FLO A;  4DTN A;  3AGR A;  1EKE A;  5I42 A;  1YJW N;  1P5D X;  4H8K A;  4YFU A;  1YVN A;  5FPM A;  3AA5 X;  1VQP N;  3QER A;  5JIC A;  2UYT A;  1K9M O;  3VGM A;  4Z4H A;  1LAW A;  2GBZ A;  4CJ7 A;  4ROE B;  4WFB L;  2YV0 X;  1NGD A;  2W41 A;  5AQQ A;  3H45 C;  2Q31 A;  3L3U A;  3TAF A;  3PLA A;  4FJK A;  2FF3 B;  1KO9 A;  4DTJ A;  1YQL A;  4JI5 K;  2BTF A;  4B9T A;  3MEG A;  4WX8 A;  1I94 K;  3I56 N;  4YOT A;  1OH8 A;  5JN5 A;  1VRU A;  1JCE A;  4FWO A;  4BR4 A;  5HRP A;  2ZJR L;  4DU3 A;  4FWN A;  4CHN A;  3J81 O;  5ELZ A;  4CFC A;  4BG8 A;  3ZSX A;  3A5N C;  4BRD A;  3C7N A;  1TGO A;  2E4L A;  3T1Y K;  3OH9 A;  4JI7 K;  2VG5 A;  2YJE A;  3LP3 A;  4B1X B;  2Q1N A;  5CR4 A;  3P1G A;  4HTL A;  3SPY A;  3ZLJ A;  2NOZ A;  4PUO A;  2ASP A;  1NJI O;  4CD3 A;  2HND A;  3U8X A;  5LJV A;  1KLN A;  2FSK A;  1S9E A;  4CCH A;  4BJU A;  3WNH A;  3CMA N;  4DTX A;  2OA8 A;  1S1W A;  3KK1 A;  2D0O A;  3CET A;  3VEZ A;  3L2V A;  1GLC G;  1HNW K;  2JLE A;  3P4I A;  2XO7 A;  2QRC A;  1VOL B;  4ROD B;  4KTZ A;  3ZT0 A;  1HKC A;  4Q0B A;  1WSG A;  3E9P A;  3SAF A;  1NK4 A;  4B9V A;  1BDG A;  3CCV N;  5GIO A;  4JS4 A;  4YOV A;  3HL8 A;  5I3U A;  1RGI A;  3QFU A;  2NRX A;  3LP0 A;  3HJF A;  1WUA A;  3BZK A;  3CC7 N;  1T44 A;  3AVB A;  3CJ7 A;  3NF8 A;  1HQE A;  1KTQ A;  2XHI A;  1PCM X;  2A40 A;  1VSE A;  3THY B;  2FSJ A;  3L3V A;  1X3M A;  3GL1 A;  4CES A;  2OPP A;  5AQF A;  3VQ9 A;  3K58 A;  3EN9 A;  3VF6 A;  1VSK A;  1O1W A;  3SUO A;  4OPJ A;  4DV4 K;  1C0T A;  2ZFD B;  3TR8 A;  4BRP A;  1NK0 A;  1ZBF A;  3V9W A;  4NLC A;  2HNZ A;  4GV3 A;  5HRO A;  2BDP A;  2QKB A;  2O8B A;  3I3W A;  3HST B;  3H3O B;  3L4I A;  5M1Q A;  3LL3 A;  1BA1 A;  1IJJ A;  2CGL A;  3SCX A;  3QIN A;  3ID6 A;  3U6F A;  2HW3 A;  4H0X B;  5M1O A;  5KRS A;  3OW2 M;  1N34 K;  4LF7 K;  5BR9 A;  4MDA A;  2F8T A;  1YT3 A;  2YHW A;  4W5T A;  3DLB A;  4DTU A;  5K14 A;  1UA0 A;  5E26 A;  1SL2 A;  4PQU A;  2D0B A;  5KRT A;  4HHT A;  5CYQ A;  4A5A A;  2V9J A;  5IYD P;  3SUP A;  3IDH A;  3TTD A;  4AF1 A;  1LXT A;  4CF1 A;  4PKG A;  2NWV A;  4AM7 A;  1BWF O;  4DHY A;  3EKU A;  3KTU A;  1YJ9 N;  3SBT A;  3SYZ A;  2OOY A;  2HHH K;  1M3Q A;  1TBA B;  2YNH A;  2XHB A;  1U6Z A;  3THW B;  1RT7 A;  1C9B B;  1UT7 A;  4NXN K;  4W5R A;  4DF4 A;  1V5S A;  1NKC A;  4JNE A;  4DQR A;  4UQG A;  3H08 A;  5JMV D;  3KIO A;  2Q3S A;  2I7P A;  2IVO A;  3CJA A;  3HOT A;  1NH2 A;  4DQP A;  2UXD K;  2P9L B;  4FZY A;  2QXL A;  2FBV A;  2E2P A;  2VG7 A;  1E3M A;  4BQZ A;  4LSL A;  1IKX A;  4BRH A;  4DSE A;  1KAZ A;  3OH6 A;  2HHU A;  3S41 A;  1D5A A;  3IG1 A;  3AA3 A;  5HL7 L;  2KZM A;  4IEE A;  3NH2 A;  3OYB A;  3K5N A;  4O0J A;  1TL1 A;  5BPM A;  4OX9 K;  2JWK A;  2WUS A;  1RBR A;  1OH5 A;  2HHW A;  5DMR A;  1T6A A;  1DIZ A;  3MN9 A;  4F8R A;  3LP1 A;  1TKZ A;  4GW6 A;  4CJS A;  3H1Q A;  1K8K B;  4B3O A;  3QBW A;  1N8R O;  1YUW A;  4BC2 A;  3E1Y A;  3OS1 A;  2YNG A;  5F1X A;  5AZJ A;  2JPI A;  1LAV A;  2H4L X;  5BPN A;  1NMN A;  4OJR A;  1C0M A;  3A2F A;  4O0I A;  2YNF A;  5TKY A;  3CJ1 A;  1TKX A;  3HTV A;  3KKR A;  2NOI A;  1QTS A;  4LC9 B;  1IH7 A;  2V7Z A;  5AQP A;  2P9P A;  1GOB A;  2RPI A;  2UXC K;  4B1Y B;  1ZBU A;  4ELV A;  2E2O A;  2F9W A;  4CGD A;  4FJ5 A;  4ZTJ A;  3NHG A;  1R59 O;  1SKS A;  5M1N A;  3WEE B;  1C1C A;  5CYM A;  5LMU K;  5E84 A;  2Q0R A;  4BR0 A;  4W5O A;  4BG9 A;  3DXK B;  1HYZ A;  1KVC A;  1NMD A;  2IAJ A;  4H5R A;  3G0Z A;  1SL1 A;  3CWA A;  4N47 A;  4H0T B;  2XY5 A;  1LWW A;  4AHU A;  4PKI A;  2A6A A;  3H1Z A;  3D7E O;  3V9U A;  1VSM A;  3D0P A;  4JI6 K;  2YNI A;  1RTJ A;  3ZX2 A;  1T05 A;  2PYL A;  3CM5 A;  3U4L A;  4I7F A;  2IIR A;  3NDK A;  4IG3 A;  3OYJ A;  4FLU A;  4EZ6 A;  2YCH A;  2O8E A;  3HXM A;  4BRI A;  1QN6 A;  3KKS A;  1Q82 O;  4FJH A;  2KFN A;  2W42 A;  4DS5 A;  2HBK A;  3O4W A;  2Y8L A;  4CEQ A;  1NNE A;  4WZS D;  2O8F B;  4EAJ A;  1JL2 A;  4B1W B;  3O5B A;  2A1S A;  3P31 A;  4BGA A;  1HPM A;  5C12 A;  1VSD A;  3DAW A;  2ZGY A;  4CJP A;  3OHR A;  4D7Q A;  5H1S Q;  4DV0 K;  4FJX A;  2V8Q A;  4H0Y B;  3SAG A;  1RFQ A;  1JLF A;  5KQ8 A;  2V92 A;  4YY3 K;  3HPH A;  4RW8 A;  2JHJ A;  3HT3 A;  2YHA A;  4FLY A;  4H0O A;  3CM6 A;  2ITM A;  4YDU C;  3CFO A;  1NU0 A;  2IOC A;  3HP6 A;  1VTL E;  3LP2 A;  3ZT3 A;  5BN9 A;  4I8O A;  1YQM A;  1YTU A;  4O5F A;  3M1F A;  2GX9 A;  1RT3 A;  1YHQ N;  2HMP A;  3RR7 A;  4NLB A;  4XIU A;  5GIN A;  3I8B A;  1NGA A;  2G8V A;  3EY1 A;  2HVI A;  3THX B;  1KFS A;  1R4X A;  3AAR A;  4U67 L;  4FLT A;  2F7T A;  2PFU A;  4DQQ A;  4DG1 A;  3T4N A;  1J5E K;  3OJS A;  1KYD A;  5AQG A;  4JK7 A;  1ZBS A;  3W3D A;  3VQ5 A;  1YQR A;  5JVG L;  2YKN A;  4JI8 K;  2O4I A;  3DRS A;  2ATQ A;  3CJ9 A;  1KY6 A;  4MRQ A;  5BRH A;  3EKS A;  3LAK A;  4KHU A;  4CIE A;  1VSF A;  1HPZ A;  3RVC A;  4LSN A;  3O3F A;  2YHB A;  3QEV A;  3V1R A;  3AVI A;  3M6G A;  1Y64 A;  2DKC A;  4NCG A;  1QSY A;  2F4V K;  4KV8 A;  1EXQ A;  3D2F B;  3SPZ A;  4B8A B;  5ADX A;  3MN5 A;  4X64 K;  4CBU A;  2LSN A;  2ZJQ L;  3LM9 A;  4IOC L;  4KHP K;  4PL7 A;  1C0G A;  3D6R A;  4BC3 A;  1ITG A;  3SK3 A;  3OYD A;  2HBJ A;  3CCJ N;  3ULX A;  1OH7 A;  1KY7 A;  1I3A A;  3MN7 A;  4L8R B;  5CZ1 A;  1ZXO A;  4HWI A;  2WON A;  4XH4 A;  3E9L A;  5KGW A;  4BRE A;  4JKD A;  3ZSV A;  2YX6 A;  3CJB A;  3V81 A;  3PX6 A;  4CZH A;  4CFB A;  1N33 K;  3IMX A;  3O9Q A;  2FKM X;  4CJK A;  3CCM N;  4DR5 K;  4BDP A;  5CZ2 A;  4JLH A;  2HHV A;  1HKG A;  1BU6 O;  4K42 A;  5GAE P;  2VGM A;  1PCJ X;  4AQY K;  4BY9 C;  3BZC A;  4CF9 A;  1CXU A;  2W6L A;  2D0P A;  3NA5 A;  2QWR A;  3H1V X;  4FL9 A;  3DI6 A;  4CGH A;  3V1Q A;  4BRO A;  2Y1I A;  3N4P A;  4DU1 A;  4JI0 K;  2ASO A;  4EAL A;  2E2Q A;  1NGJ A;  5IYB P;  2CGJ A;  1YI2 N;  2VWK A;  1L3V A;  1TVR A;  1TUU A;  3HM9 A;  1K8A O;  1K35 A;  4B3R K;  3J7Y P;  3MEE A;  3HPO A;  1ATS A;  4AHT A;  4X66 K;  1L3U A;  4PKH A;  4GVM A;  3EIK A;  3KLE A;  2FUV A;  3UB5 A;  4BWM A;  4DQI A;  4CJ5 A;  4B9Q A;  3QFP A;  4QCL A;  1V4S A;  4DMN A;  3THW A;  1QS4 A;  4CJE A;  4OPK A;  2G30 A;  4EP4 A;  4LF6 K;  5AR0 A;  1JLB A;  3ULE B;  2YHY A;  3MMV A;  3ATU A;  5HLF A;  3EZW A;  2KTQ A;  1J6Z A;  1EP4 A;  2RN2 A;  1AIS A;  3RPJ A;  3ZT2 A;  4CI6 A;  2ITG A;  1C4G A;  3JAM O;  4FK2 A;  2GUP A;  4O4G A;  4OKJ A;  3A0I X;  4KHS A;  1J3M A;  3AA4 A;  4CBW A;  2VWJ A;  4B9S A;  4A61 A;  3L2R A;  3U9Z A;  3QEI A;  5AQO A;  1DT9 A;  3ID8 A;  3TPQ A;  4CEC A;  3IRX A;  1QQN A;  4E0D A;  4M3W A;  3PSF A;  2HOE A;  5HRS A;  3EZ5 A;  3JSM A;  3I55 N;  1K8K A;  4FJI A;  1VQ9 N;  1W0H A;  4ILG B;  4DSK A;  3DPT A;  4FWQ A;  1RTD A;  1UWB A;  1UOC A;  4FK4 A;  1FJG K;  2P5O A;  4FJG A;  4I9Q A;  1QZ5 A;  5DM6 L;  2E5L K;  1FXX A;  3B8A X;  3NBP A;  2P9N B;  4M41 A;  2HF3 A;  3E66 A;  5AFU A;  1YAG A;  3LDP A;  5FPD A;  4OO1 J;  2QWM A;  1X9M A;  1KVB A;  1C0F A;  4GY2 B;  2G8W A;  3BY5 A;  4CFD A;  3ZEU B;  2QWP A;  2VGN A;  4BRC A;  4M3X A;  1XHX A;  3AV9 A;  4ID5 A;  4CJL A;  3FLC O;  1ZBI A;  5HSH A;  4K0K K;  4KTW A;  2HHQ A;  1QE1 A;  3CCS N;  2FXU A;  1WBB A;  3DXK A;  5J2N A;  4DR4 K;  1W7A A;  3CCE N;  3LDL A;  1O13 A;  4KO0 A;  3UKU A;  3AVN A;  2Q2R A;  1M3H A;  1RM1 A;  1HR0 K;  2BAN A;  4EAH D;  4E7J A;  1HJO A;  4ZHR A;  1U4B A;  3TAR A;  1K73 O;  4NYF A;  4C8L A;  3HS8 A;  3DOK A;  3J80 O;  1VQ7 N;  3KLG A;  3GBT A;  4B0A A;  1RT5 A;  3OYE A;  3LDS A;  3ZSY A;  3MWP A;  1TK8 A;  5FDL A;  4V19 S;  1V4T A;  4DFP A;  3RMA A;  1TUY A;  1NVP A;  3ITH A;  4Q11 A;  1T6C A;  5M1F A;  4F9O A;  2NOF A;  2PYJ A;  2IS3 A;  4IOA L;  4IZ9 A;  4DR6 K;  3LDQ A;  3K57 A;  4DWI A;  4YOW A;  5JS2 A;  4I2P A;  2ZJP L;  4CGF A;  2Z1I A;  4O44 A;  1LV5 A;  2O8F A;  4N76 A;  3BP8 A;  3VQC A;  1JFI C;  4B1Z A;  3LAL A;  3KLI A;  3MAQ A;  1BA0 A;  5KTQ A;  3NAE A;  2UUA K;  1D9D A;  3M8R A;  4DUY K;  2IV9 A;  2G8U A;  3UKR B;  1T7P A;  1JCG A;  2YHX A;  3DLH A;  3NVK A;  4BDY A;  1BUP A;  4FK0 A;  1BIU A;  3TAQ A;  2DFF A;  3AVA A;  2XY6 A;  3TDH A;  4H0V B;  1B9D A;  1NKB A;  4MLH A;  1NM1 A;  4CJR A;  3QO9 A;  2HBM A;  3CIP A;  4DFM A;  2QEX N;  4CK1 A;  4DTO A;  4BRK A;  2HNY A;  1GLA G;  4CVN E;  4NXM K;  1J9A A;  1BOT O;  4JN4 A;  3M8P A;  3I8D A;  4EHT A;  3O4Q A;  1RT2 A;  3THX A;  3CC4 N;  4BRA A;  2XRI A;  2XY8 A;  1IKY A;  4WQ4 A;  5C25 A;  3LWM A;  2ZE2 A;  2NNW A;  3BEX A;  3CME N;  3B6P A;  3CCU N;  3CD6 N;  3O6W A;  1DLO A;  4UY8 O;  3HI0 A;  4WFA L;  3L0Q A;  4NCA A;  3AVJ A;  1KYU A;  5AQJ A;  4QOZ B;  4HCB A;  1X1P A;  1JJ2 M;  4ICL A;  4Z4C A;  2OTJ N;  1RBS A;  4YOU A;  3J7A P;  3KK3 A;  5DM7 L;  1QVF M;  3SAH A;  4HCC A;  3ENC A;  2FF6 A;  4Z0U A;  3OVN A;  1CDW A;  5JLF A;  4DR2 K;  1JLQ A;  3D2F A;  2P51 A;  3S9H A;  2ASM A;  1L3T A;  3QNN A;  1MDU B;  4WQ4 C;  1U45 A;  4DUZ K;  3GOI A;  3WXJ A;  3DXM B;  1JCF A;  1CZA N;  3VEV A;  4H4M A;  3ZSQ A;  3KRM A;  1HU0 A;  2R7Y A;  1QSS A;  1VSJ A;  4KHW A;  4Z4I A;  1IV0 A;  1VSI A;  4CJ4 A;  1C1A A;  2QLV A;  2F8S A;  2ZF5 O;  3PIP L;  1RBU A;  3F0Z A;  4L3Q A;  5AQR A;  2PBD A;  4FZZ A;  2VWB A;  3A8Y A;  3T1A A;  2PWW A;  4DSF A;  3V4I A;  3O3G A;  3PX0 A;  3S3O A;  1UA1 A;  1FKO A;  3QET A;  1YJN N;  4KTQ A;  4FJ8 A;  4NCB A;  1XSZ A;  4XH1 A;  4BVP A;  1NK6 A;  3C65 A;  1KAX A;  3KHY A;  3OYC A;  1PVS A;  5FRO A;  1WSF A;  2OPS A;  2X6S A;  3BKQ X;  4JEP A;  2P9K B;  3DM2 A;  1RBV A;  3K9J A;  1EWR A;  4MDB A;  4F2R A;  2F96 A;  4KHN A;  1WSJ A;  1NGB A;  2B6A A;  3OA9 A;  2AA4 A;  4DV6 K;  1VRT A;  4FWS A;  4DCH A;  1KVA A;  4K25 A;  4M3Z A;  3IKM A;  5AZI B;  4B1V A;  4CBX A;  2W40 A;  2DY4 A;  3PUF A;  3CVS A;  4FWL A;  3KJV A;  3TAB A;  1X3N A;  3AVF A;  3VQD A;  1JDY A;  4EAG A;  3CQX A;  2NLX A;  4DTS A;  1L3S A;  2A41 A;  3EE9 A;  3LDO A;  1KRP A;  3SLC A;  4X62 K;  1ATR A;  4XH5 A;  4CFA A;  1QN8 A;  1HYV A;  1W9H A;  2NRZ A;  5C2F A;  3HVT A;  1PCZ A;  4EFH A;  1CXQ A;  1QNB A;  5LMN K;  2KLA A;  1XC9 A;  2IVN A;  4JYA K;  4DKW A;  4Y0W A;  2IVP A;  2OPR A;  3VQ8 A;  5KGX A;  3O9S A;  2CH5 A;  4CJW A;  1XC3 A;  1S5J A;  4MLE A;  1VQK N;  3DLG A;  3OST A;  4B9N A;  1W80 A;  4JRP A;  1N6Q A;  4RW6 A;  1NJW A;  1ASV A;  3AVK A;  2GV9 A;  2J4R A;  4M3Y A;  3ULE A;  3C94 A;  3SMP A;  4CHQ A;  5KQD A;  3ZX3 A;  4CZF A;  4K41 A;  3L2W A;  3QLH A;  3V9X A;  1JLE A;  1XNR K;  4F3O A;  4BE1 A;  2G8F A;  4FM1 A;  4KI4 A;  3OSE A;  4DSJ A;  3DRR A;  1X9J A;  1T8E A;  4WCE L;  2QA4 N;  4FM0 A;  1KFD A;  5EU7 A;  1JLC A;  5J1E A;  2FSN A;  2QW9 A;  1GLD G;  4IO8 A;  3OYN A;  4CF0 A;  4LD0 A;  4C1N K;  1KSP A;  4FJ9 A;  4C8M A;  4W5Q A;  3MCA B;  3QIO A;  4EJY A;  1FKP A;  2FBY A;  1DTQ A;  1QSL A;  2H5A X;  4J2D A;  1C0U A;  3D45 A;  3ZSZ A;  1QN5 A;  4FZX C;  1Q9Y A;  4LFC K;  4CZK A;  2NRT A;  3AO4 A;  3SV4 A;  4FO0 A;  1RTH A;  4JV5 K;  3AO1 A;  1U48 A;  4WF9 L;  2P9N A;  4YNQ A;  1D4X A;  1EET A;  3T69 A;  4RW4 A;  4FJM A;  5C15 A;  1R0A A;  3C6A A;  2HKP A;  4KBO A;  3AVH A;  1RTI A;  1RDA A;  3SUN A;  3UKU B;  1Q9X A;  4EZ9 A;  2HBL A;  2JHN A;  1GLB G;  3ZEU A;  1S6P A;  3BF1 A;  4BR9 A;  3SQ2 A;  3ALY A;  3K5L A;  4Y1C A;  1RCH A;  3C0B A;  5EXW A;  2QM1 A;  4E1J A;  1WB9 A;  4DS4 A;  4DTM A;  1VQ5 N;  5F9C A;  3OYL A;  3LPU A;  4YDU A;  4IFE A;  3VA0 A;  4F2S A;  1ATN A;  1HNX K;  3LDN A;  4WFN L;  3H3N O;  3ZSW A;  2FBX A;  2HL8 A;  1TK0 A;  1LCU A;  1NKE A;  3D2E A;  4QS7 A;  3RMB A;  3PO5 A;  1NGM A;  4CW7 B;  4FLX A;  1QN3 A;  4OPH A;  3OYF A;  4A2A A;  4ROC B;  1B9F A;  4EHU A;  3QES A;  2DPN A;  3OBW A;  1XMQ K;  1WJW A;  4LF5 K;  2OZS A;  4I2Q A;  2D5R A;  1NGI A;  3S3M A;  1QQO A;  2HHT A;  1B9K A;  3SQ0 A;  5AQL A;  4LF4 K;  3D7Q A;  4HUF A;  4DR7 K;  2MZ8 A;  4EAI A;  1MA9 B;  1X9S A;  1VTO A;  1S72 N;  1E42 A;  5LL6 Z;  4RW9 A;  2F7L A;  4BRN A;  4CGG A;  1H1V A;  3OLP A;  1KYF A;  2WC9 A;  3CWU A;  5HRN A;  1TV6 A;  1BL3 A;  3P5J A;  1TUO A;  1VKL A;  1A5W A;  1KAY A;  1WBD A;  1J54 A;  4CEA A;  2PZS A;  2G8I A;  2RHK A;  3VQE A;  3UKR A;  4C8O A;  2OPQ A;  3LZJ A;  1ZC6 A;  4IL8 A;  2NVM A;  5JMV A;  1NOZ A;  3OYI A;  3EE8 A;  3PDK A;  4DSI A;  3R8E A;  4EAK A;  1IO2 A;  2NLV A;  1XWL A;  1C1B A;  3V6D A;  3P39 A;  2QWN A;  2O8D B;  5BN8 A;  5F0X A;  4M3R A;  2B4J A;  1BIS A;  2RF2 A;  3ATV A;  3U3G A;  5M1P A;  4BVO A;  2PAV A;  3L8B A;  3VQ4 A;  1P8Z A;  4CEE A;  2IC3 A;  1E4G T;  3R6M A;  3NE6 A;  4B08 A;  4Z4E A;  4DQ8 A;  3EYZ A;  3O9R A;  4IJA A;  4FXD A;  4YOY A;  1IBK K;  1LW2 A;  4JRQ A;  5GAD P;  2QRD A;  3WXK A;  3T7Z A;  1K6Y A;  3BF3 A;  3DLE A;  2V51 B;  2IV8 A;  3B6O A;  3O80 A;  5CE3 A;  4FWP A;  3VPZ A;  3VN5 A;  2UUB K;  3O4N A;  2E1Z A;  3RMC A;  3KZB A;  3T1H K;  4AH9 A;  2ZGZ A;  3AO2 A;  1HX1 A;  1QN9 A;  5ADX H;  4LF8 K;  3O8M A;  4O5B A;  1NK7 A;  4M3T A;  3WNG A;  5EPC A;  3H46 O;  3FZM A;  4OKE A;  2VG6 A;  3P38 A;  4JI4 K;  4DV3 K;  4I9L A;  3TTF A;  2KHO A;  3DXM A;  5E41 A;  1WAJ A;  3PSI A;  3M3Z A;  3CYM A;  3VOV A;  4FJ7 A;  3DYA A;  4IEI A;  3PY8 A;  2FGT A;  3TAN A;  3CXC M;  1RDW X;  4FLW A;  1RDB A;  1BO5 O;  3WQT A;  3G4S N;  4DSL A;  3PX4 A;  2VQE K;  4E89 A;  3K0S A;  1S1V A;  1SV5 A;  3AAQ A;  4JKG B;  2HL9 A;  2FBT A;  1VQL N;  3MN6 A;  1T03 A;  4KH5 A;  1IKW A;  2E8A A;  3E01 A;  4H5T A;  3P83 D;  3FZH A;  2Z1J A;  4KH4 A;  1HMV A;  3RSE A;  3AVL A;  3CW7 A;  4KHQ A;  3THV A;  5FLX O;  4JI3 K;  4YHH K;  3MXI A;  3QEW A;  3N4Q A;  2P9K A;  3EL2 A;  2IGI A;  3CFP A;  4C7P A;  5AQW A;  3AVM A;  1D9F A;  1S3X A;  4DFK A;  4OPA A;  1JXB A;  1WQA A;  3VTI A;  4IDK A;  1BI4 A;  1U47 A;  3WNE A;  5JS1 A;  4NO7 A;  4DV2 K;  4ISG A;  4CZG A;  1CZB A;  3HS9 A;  2Z8U A;  4BAC A;  1D8Y A;  3VES A;  1RDC A;  4ILH A;  1MPG A;  4JS5 A;  1IKV A;  1WLJ A;  5AZI A;  3NVM A;  2RKI A;  5AN4 A;  3VQP A;  3OS0 A;  1EQY A;  4JKF A;  1UL7 A;  4WXA A;  5BMP A;  3K59 A;  1KQS M;  1PZD A;  3OC3 C;  4DUL A;  1Q18 A;  2OZM A;  5D3G A;  3O08 A;  4FPA A;  5JLH A;  1U2V B;  1UAX A;  3VEN A;  3CWT A;  4TPS A;  2E88 A;  4A2B A;  1OKJ A;  4FLV A;  2XY7 A;  1M1K O;  2I5W A;  1KCF A;  3F10 A;  3CJC A;  1CLQ A;  3C6U A;  3ZET B;  1BIZ A;  4FWR A;  1LW0 A;  3IUC A;  2H3G X;  3VQ7 A;  4KRE A;  3OBY A;  1S1U A;  1QN4 A;  3E9O A;  2Q0U A;  4LFB K;  3ASM A;  1QNC A;  1SS6 A;  4BC5 A;  3G10 A;  4CGI A;  4NYN A;  2KQ2 A;  4GKJ K;  3DJC A;  1XUP O;  2VYP A;  3NCI A;  3OS2 A;  4FM2 A;  4FJL A;  3BUZ B;  4ISE A;  3HOS A;  3LZI A;  4JKA A;  3I0W A;  2HVH A;  1TL3 A;  2OAN A;  4WQ5 A;  2I7N A;  1Q86 O;  4Y1D A;  4KHY A;  1QZ6 A;  4IXC A;  2QWQ A;  4JI1 K;  2ZWH A;  3IS9 A;  5SWM A;  1SAZ A;  1TKT A;  2OYQ A;  5AQT A;  1WNS A;  5AFU H;  4FYD A;  3K2P A;  1TK5 A;  4B9M A;  2KW4 A;  1EX4 A;  4CFF A;  3SNN A;  5AQM A;  1VSL A;  4FSV A;  3SZ2 A;  3ULD A;  4CIF A;  3OYG A;  1MWM A;  4JKC A;  1N5Y A;  3IFR A;  3KK7 A;  3VEX A;  4HVJ A;  2CH6 A;  3WQU A;  1M5Q 1;  3D4V A;  3V9Z A;  1KFI A;  3CG7 A;  2A3Z A;  5AQX A;  2P9I B;  1U04 A;  4FVU A;  4WQ5 C;  4O8U A;  4YOR A;  3D2E B;  2HF4 A;  4C1N I;  4IO9 L;  2NOB A;  3SMS A;  2O8C A;  1Q9U A;  1NWK A;  3WNF A;  1J5O A;  3VA3 A;  1N36 K;  2HHX A;  2F9T A;  3DWL A;  2W6K A;  5FPN A;  3G71 N;  2Q97 A;  4DR3 K;  3HVR A;  4KRF A;  4IOX A;  2B5J A;  3KVG A;  5GIP A;  3FZK A;  3HM8 A;  3VQ6 A;  4FLZ A;  3HPG A;  1QQC A;  5AQZ A;  4JHD A;  1A5V A;  4IG0 A;  1ASU A;  3LM2 A;  3PIO L;  2FC0 A;  3CCR N;  1E4F T;  5HRR A;  4E19 A;  1YQK A;  2P9S B;  4IDH A;  4DU4 A;  4CEZ A;  4BR7 A;  1NJY A;  2PY5 A;  1NLV A;  2HB5 A;  1FW6 A;  5KI6 A;  4FJN A;  5EVZ A;  5AQH A;  4BR2 A;  3DOL A;  3SUQ A;  3KD1 E;  1JLG A;  5C0Y A;  4FJJ A;  4KH6 A;  3VER A;  5AQV A;  3MX5 A;  3OYK A;  2OCE A;  1WSH A;  2BH1 A;  4C23 A;  1A5X A;  4H5W A;  4DFJ A;  3DMJ A;  2VCP A;  3V1O A;  4CGJ A;  4OLA A;  4CEB A;  5EX5 A;  3QB0 A;  3RTV A;  3K5O A;  1N39 A;  2P1J A;  4O55 A;  1HKB A;  1NGH A;  5J2P A;  4HUE A;  5FPE A;  1NK8 A;  1MU2 A;  3A5O C;  3MCP A;  1YVU A;  1ZYQ A;  3WXM B;  4IJN A;  1HJR A;  3VGL A;  4PA1 A;  4PHT X;  4DV7 K;  4PL8 A;  4CHZ A;  3M8S A;  2EHG A;  1ZBH A;  3NF7 A;  3SQ1 A;  4CIG A;  3CQ8 A;  4K8X A;  1S1X A;  3ZCM A;  1P90 A;  2A42 A;  1VK0 A; 
#chains in the Genus database with same CATH homology
 4G1Q A;  4C8N A;  3U3Y A;  3OJS A;  1KYD A;  1LWY A;  1JKH A;  4HTU A;  3V9S A;  4BE1 A;  3TAG A;  2YH5 A;  3N89 A;  2G8F A;  4FM1 A;  4N41 A;  3VQ5 A;  4KI4 A;  4CHP A;  1YQR A;  2QKK A;  4DSJ A;  2YKN A;  3DRR A;  3TAM A;  2HHS A;  5T7B A;  1T8E A;  2O4I A;  4CHY A;  4FM0 A;  3DRS A;  3FFI A;  2ATQ A;  4E3S A;  1KFD A;  5EU7 A;  2KFZ A;  1RNH A;  1JLC A;  4N56 A;  1KY6 A;  1Y97 A;  5J1E A;  1DTT A;  3I0X A;  4FW1 A;  3LAK A;  4IFV A;  4CIE A;  4KHU A;  1VSF A;  1HPZ A;  4B9L A;  4LSN A;  3OYN A;  4CF0 A;  4LD0 A;  1KSP A;  4FJ9 A;  4OLB A;  1C6V A;  3O3F A;  2O3O A;  4C8M A;  4W5Q A;  3KK2 A;  2YHB A;  3QEV A;  3DPU A;  1NJZ A;  3QIO A;  3V1R A;  4EJY A;  3AVI A;  1FKP A;  2FBY A;  1DTQ A;  3OY9 A;  1QSL A;  3RMD A;  2A1R A;  4J2D A;  1LWC A;  1C0U A;  3D45 A;  3T19 A;  3ZSZ A;  4E7K A;  1QN5 A;  4NCG A;  3QEX A;  1QSY A;  4E7I A;  2Z1G A;  2BGG A;  4KV8 A;  4MQ3 A;  4FZX C;  4PWD A;  2ZQB A;  1EXQ A;  2Y1J A;  1U49 A;  1Q9Y A;  4K8Z A;  2AJQ A;  3AO4 A;  3SPZ A;  4B8A B;  1GOA A;  3SV4 A;  3KD5 E;  3KLH A;  4AIL C;  1LWE A;  1RTH A;  4J2B A;  3NGI A;  3RRG A;  4CJV A;  1KLM A;  3AO1 A;  1U48 A;  2LSN A;  2DFH A;  4YNQ A;  4CED A;  5J2M A;  2ZD1 A;  1HRH A;  4RG8 A;  1EET A;  1ITG A;  4AHC A;  3KTQ A;  4RW4 A;  4FJM A;  3OYD A;  3ULX A;  1WN7 A;  4Q5V A;  1R0A A;  1KY7 A;  1I3A A;  4L8R B;  1BQM A;  5CZ1 A;  3AVH A;  3NH0 A;  3T3F A;  1RTI A;  1RDA A;  3SUN A;  1VSH A;  1Q9X A;  2P5G A;  4EZ9 A;  2DFE A;  4Z4F A;  2WON A;  3SQ2 A;  3NF6 A;  1S6P A;  5KGW A;  3ALY A;  4CJ3 A;  3L2Q A;  3K5L A;  3ZSV A;  1WAF A;  2D0A A;  4Y1C A;  1RCH A;  3L2U A;  3HYF A;  1SKR A;  5C24 A;  1S9G A;  3I0S A;  3V81 A;  4DS4 A;  1LWF A;  3PX6 A;  4DTM A;  4M42 A;  4CFB A;  3OYL A;  3LPU A;  4CF2 A;  3LPT A;  4CJK A;  4BDP A;  4PY5 A;  2X74 A;  1QHT A;  4JLH A;  5CZ2 A;  2HHV A;  3RR8 A;  3VA0 A;  3K5M A;  1N3A A;  1QNA A;  2ETJ A;  3MXM A;  3BGR A;  4F2S A;  1BGX T;  4KFB A;  4FCY A;  1TKD A;  1RT6 A;  4IFY A;  1EBM A;  3ZSW A;  4EP5 A;  3CFR A;  2FBX A;  1TK0 A;  4CHO A;  3KLF A;  4CF9 A;  1NK5 A;  1NKE A;  1CXU A;  3I0R A;  3MED A;  1B92 A;  1SKW A;  3RMB A;  1YTA A;  3PO5 A;  1HYS A;  1BI4 B;  1NGM A;  3DI6 A;  4FLX A;  4CGH A;  2E6M A;  1QN3 A;  3OYF A;  4DTN A;  3V1Q A;  3MXJ A;  4CCH A;  1EKE A;  2Y1I A;  4ROC B;  1B9F A;  3NGY A;  4DU1 A;  3SQ4 A;  3QEP A;  2NOE A;  2HZS A;  4W5N A;  3QES A;  3DRP A;  4H8K A;  4YFU A;  5IYB P;  2OZS A;  5IYC P;  2VWK A;  3AA5 X;  1L3V A;  3QER A;  1TVR A;  4I2Q A;  3NGZ A;  3HM9 A;  2D5R A;  3S3M A;  3LAM A;  4Z4H A;  2HHT A;  1LAW A;  4FK2 A;  2GBZ A;  1B9K A;  3SQ0 A;  4ROE B;  3MEE A;  3HPO A;  4AHT A;  1L3U A;  3OYM A;  3OSM A;  2YV0 X;  3AVC A;  4HUF A;  4GVM A;  3EIK A;  3OJU A;  3TAF A;  2MZ8 A;  3L3U A;  3KLE A;  2I5J A;  4FJK A;  1X9S A;  1VTO A;  1KO9 A;  1E42 A;  1YQL A;  4RW9 A;  4BWM A;  4BDZ A;  4DTJ A;  4CJ5 A;  4DQI A;  1IG9 A;  4CGG A;  4B9T A;  4QCL A;  3MEG A;  4CK3 A;  1KYF A;  4DMN A;  5HRN A;  1TV6 A;  1BL3 A;  2NUB A;  3P5J A;  1VRU A;  1QS4 A;  4OGE A;  5HRP A;  2WOM A;  1A5W A;  4CJE A;  4N5S A;  4OPK A;  4CHN A;  4DU3 A;  1J54 A;  4CEA A;  2PZS A;  2G30 A;  3OCI A;  4CFC A;  2G8I A;  4EP4 A;  4KI6 A;  5SZT A;  3ZSX A;  3VQE A;  4J2A A;  1TGO A;  2E4L A;  4C8O A;  2OPQ A;  3LZJ A;  1JLB A;  4HUG A;  2VG5 A;  3LP3 A;  5HLF A;  1NOY A;  3AO3 A;  4C8K A;  2KTQ A;  1NOZ A;  1S6Q A;  3M8Q A;  3OYI A;  3P1G A;  4DSI A;  3SPY A;  1IO2 A;  2NOZ A;  4R5P A;  1EP4 A;  1XWL A;  2RN2 A;  1C1B A;  4PUO A;  1G15 A;  3V6D A;  1AIS A;  3QNO A;  3RPJ A;  3ZT2 A;  5CY4 A;  2ITG A;  4RW7 A;  2HND A;  1KLN A;  1D3U A;  4OGC A;  4M3R A;  1S9E A;  1QNE A;  1MP9 A;  2B4J A;  1BIS A;  4AHR A;  2RF2 A;  3BDP A;  3U3G A;  3WNH A;  1WSI A;  4O4G A;  4OKJ A;  4DTX A;  3TI0 A;  2OA8 A;  1S1W A;  3KK1 A;  4KHS A;  3L8B A;  3AA2 A;  4QAG A;  3AA4 A;  2VWJ A;  3VQ4 A;  4B9S A;  1L5U A;  3HO1 A;  4CEE A;  3L2R A;  3L2V A;  2IC3 A;  3HP9 A;  2JLE A;  2XO7 A;  3NE6 A;  3QEI A;  4ELU A;  1HNV A;  4B08 A;  4LH5 A;  1VOL B;  3EYZ A;  4Z4E A;  4ROD B;  4CEC A;  3IRX A;  5HP1 A;  4KTZ A;  4E0D A;  4FXD A;  3ZT0 A;  1LW2 A;  4M3W A;  5HRS A;  3EZ5 A;  3OYA A;  1WSG A;  4Q0B A;  3JSM A;  4JRQ A;  1NK4 A;  4B9V A;  1YTB A;  1YTF A;  4FJI A;  4JS4 A;  1K6Y A;  1W0H A;  3HL8 A;  3DLE A;  3VQB A;  2IV8 A;  3DPT A;  3B6O A;  1UWB A;  5I3U A;  1RTD A;  4DSK A;  1HQU A;  1UOC A;  3LP0 A;  3HJF A;  1RT1 A;  3AVB A;  3VN5 A;  4ELT A;  4FK4 A;  3O4N A;  2P5O A;  4FJG A;  4I9Q A;  3RMC A;  3NF8 A;  1HQE A;  1KTQ A;  4AH9 A;  2XHI A;  1FXX A;  1VSE A;  3NBP A;  4M41 A;  3AO2 A;  3L3V A;  1QN9 A;  5HBM A;  4IKF A;  4CES A;  2OPP A;  2EX3 A;  3VQ9 A;  3K58 A;  4O5B A;  1NK9 A;  1RIL A;  3AO5 A;  3TAP A;  1SUQ A;  1KVB A;  1X9M A;  1NK7 A;  3O3H A;  3DLK A;  1VSK A;  3S3N A;  1O1W A;  3SUO A;  2G8W A;  4M3U A;  4M3T A;  3WNG A;  4CFD A;  4OPJ A;  1QTP A;  4OKE A;  1C0T A;  2Z1H A;  1ASW A;  4M3X A;  2VG6 A;  1XHX A;  3AV9 A;  2NOH A;  1J53 A;  4ID5 A;  4ID1 A;  3TR8 A;  4CJF A;  4CJL A;  4KB0 A;  3IAY A;  1NK0 A;  1ZBF A;  4I9L A;  1ZBI A;  4KTW A;  3V9W A;  2HHQ A;  1QE1 A;  2HNZ A;  5J2N A;  5E41 A;  5HRO A;  1WAJ A;  2BDP A;  2X78 A;  3CYM A;  2QKB A;  4FJ7 A;  3HST B;  3DYA A;  3ISN C;  3PY8 A;  5D3G A;  2FGT A;  3TAN A;  4FLW A;  1RDB A;  3SCX A;  1S1T A;  3QIN A;  1F21 A;  4H4O A;  4KO0 A;  4LH4 A;  4WE1 A;  4DSL A;  3PX4 A;  3U6F A;  2HW3 A;  4E89 A;  1FN7 A;  1S1V A;  3AVN A;  4CJQ A;  1M3H A;  1SV5 A;  1RM1 A;  3TWH A;  5KRS A;  2FBT A;  1WSE A;  1N3C A;  2BAN A;  4CJU A;  4E7J A;  1T03 A;  1IKW A;  4ZHR A;  1U4B A;  3E01 A;  3TAR A;  1REV A;  4NYF A;  4C8L A;  3HS8 A;  2JOI A;  3DOK A;  2F8T A;  1YT3 A;  4W5T A;  3KLG A;  3P83 D;  4B0A A;  1RT5 A;  2Z1J A;  3OYE A;  4E1M A;  3LDS A;  5K14 A;  3ZSY A;  1FK9 A;  4DTU A;  4ZTF A;  4KKO A;  2D0B A;  2O4G A;  5FDL A;  1HMV A;  5KRT A;  4PQU A;  4DFP A;  4HHT A;  3AVL A;  5CYQ A;  3RMA A;  1NVP A;  4E7H A;  3ITH A;  5IYD P;  4KHQ A;  2BE2 A;  3SUP A;  4Q11 A;  3THV A;  4B8C A;  3LWL A;  3MXI A;  4DF8 A;  3QEW A;  4CF1 A;  2NOF A;  2PYJ A;  2IGI A;  2IS3 A;  3CFP A;  4E1N A;  1D9F A;  3MEC A;  3AVM A;  5I42 A;  1QTM A;  2QK9 A;  4DFK A;  1JXB A;  1UT4 A;  3K57 A;  4F3T A;  4IDK A;  1BI4 A;  4CF8 A;  3KTU A;  3WNE A;  5JS2 A;  1U47 A;  4I2P A;  4DWI A;  4CGF A;  5JS1 A;  3IH7 A;  3PV8 A;  2Z1I A;  4O44 A;  1CZB A;  3HS9 A;  2Z8U A;  4BAC A;  1LV5 A;  3SYZ A;  2E6L A;  1D8Y A;  1M3Q A;  3VQC A;  4AHV A;  1RDC A;  3ZT4 A;  1JFI C;  1QN7 A;  4N76 A;  4JS5 A;  1TBA B;  1IKV A;  1WLJ A;  2YNH A;  3LAL A;  2XHB A;  3HK2 A;  1BCO A;  3KLI A;  2RKI A;  1RT7 A;  5AN4 A;  3MAQ A;  2IDO A;  1RBT A;  1C9B B;  3VQP A;  3OS0 A;  1UT7 A;  2X6N A;  5KTQ A;  3K59 A;  3NAE A;  3M8R A;  1D9D A;  1PZD A;  2IV9 A;  3OC3 C;  4DUL A;  4W5R A;  1X9W A;  2G8U A;  1T7P A;  4DF4 A;  2OZM A;  3DLH A;  4KB1 A;  1NKC A;  4DQR A;  4UQG A;  4BDY A;  3H08 A;  4CK2 A;  3KIO A;  1UAX A;  2Q3S A;  1NH2 A;  4TPS A;  4DQP A;  4FK0 A;  1BIU A;  1TAQ A;  4FLV A;  4OVL A;  2XY7 A;  3TAQ A;  3F73 A;  4BE2 A;  4FZY A;  2I5W A;  2DFF A;  1KCF A;  2FBV A;  2VG7 A;  3AVA A;  2XY6 A;  3F10 A;  3UIQ A;  1CLQ A;  3C6U A;  1IKX A;  4LSL A;  1B9D A;  4DSE A;  1NKB A;  4CJR A;  3QO9 A;  1BIZ A;  1UA0 A;  2HHU A;  2LAE A;  1D5A A;  3IG1 A;  4DFM A;  5FRM A;  1LW0 A;  3AA3 A;  4CK1 A;  4DTO A;  4J2E A;  2KZM A;  1RT4 A;  2HNY A;  3VQ7 A;  3SNS A;  4KRE A;  1J9A A;  3NH2 A;  3PO4 A;  1S1U A;  1QN4 A;  4GMJ B;  3OYB A;  3K5N A;  3NF9 A;  4O0J A;  3ASM A;  1QNC A;  1TL1 A;  3M8P A;  3I8D A;  1TAU A;  3O4Q A;  4Z4G A;  3QIP A;  1RBR A;  1I39 A;  2HHW A;  1RT2 A;  3G10 A;  4CGI A;  1TK8 A;  4NYN A;  5DMR A;  2KQ2 A;  2XRI A;  2XY8 A;  1IKY A;  4F8R A;  3ZSR A;  3LP1 A;  1TKZ A;  5C25 A;  4GW6 A;  4CJS A;  3OS2 A;  3NCI A;  3ZT1 A;  3LWM A;  4B3O A;  2ZE2 A;  4AHS A;  3B6P A;  4FM2 A;  4FJL A;  3OS1 A;  2YNG A;  1DLO A;  4MFB A;  1LAV A;  4DTP A;  3LZI A;  4NCA A;  4OJR A;  1C0M A;  3A2F A;  3I0W A;  2YNF A;  1TL3 A;  3AVJ A;  4O0I A;  4DLG A;  1KYU A;  3KKR A;  1TKX A;  4DFJ A;  2HVH A;  2DTU A;  3OYH A;  1Z25 A;  2NOI A;  4QOZ B;  4Y1D A;  2YKM A;  4HCB A;  1BQN A;  1QTS A;  1X1P A;  1Z26 A;  5J2Q A;  4KHY A;  1IH7 A;  4ICL A;  4Z4C A;  2QXF A;  1RBS A;  3SI6 A;  1GOB A;  2RPI A;  3VQA A;  3IS9 A;  3KK3 A;  5SWM A;  3TAE A;  1TKT A;  2OYQ A;  4HCC A;  1ZBU A;  4B9U A;  4ELV A;  1WNS A;  4EJZ A;  4CGD A;  3C95 A;  3K2P A;  1TK5 A;  4FJ5 A;  4B9M A;  4FYD A;  4ZTJ A;  3NHG A;  1NJX A;  2KW4 A;  3DLR A;  1SKS A;  4Z0U A;  3OVN A;  2VJ0 A;  1CDW A;  1EX4 A;  2G8K A;  3DLB A;  1JLQ A;  1C1C A;  2GUI A;  3SNN A;  2P51 A;  5CYM A;  3S9H A;  4CER A;  1L3T A;  3F9K A;  1VSL A;  1SL2 A;  4W5O A;  3SZ2 A;  3ULD A;  4LY7 A;  3QNN A;  1XI1 A;  1U45 A;  1HYZ A;  1KVC A;  4CIF A;  2IAJ A;  3OYG A;  3ZSQ A;  1N5Y A;  4H4M A;  4KPY A;  3G0Z A;  4HVJ A;  3KRM A;  2HZM A;  1HU0 A;  2R7Y A;  1JXE A;  1SL1 A;  4CEO A;  1QSS A;  4N47 A;  3SJJ A;  1VSJ A;  4KHW A;  2XY5 A;  3JYT A;  4Z4I A;  1LWW A;  3V9Z A;  4AHU A;  1VSI A;  4FVM A;  4M45 A;  3CG7 A;  1C1A A;  4CJ4 A;  3C6T A;  3AVG A;  1RDD A;  5DK5 A;  2F8S A;  4DQS A;  3H1Z A;  2KZZ A;  1RBU A;  1XHZ A;  1U04 A;  2NOL A;  2MJ7 A;  3F0Z A;  1ZBL A;  4FZZ A;  1TBP A;  2NOB A;  3T1A A;  3V9U A;  1VSM A;  1VOK A;  3WNF A;  3D0P A;  4DSF A;  1J5O A;  2HMI A;  3VA3 A;  3O3G A;  3V4I A;  3PX0 A;  3S3O A;  1UA1 A;  2YNI A;  4KAZ A;  1RTJ A;  2HHX A;  4DTR A;  4KRF A;  1FKO A;  1GOC A;  1SL0 A;  3HVR A;  3QET A;  4KTQ A;  2B5J A;  3SV3 A;  3CM5 A;  1T05 A;  4BWJ A;  2PYL A;  1BHL A;  4FJ8 A;  4I7F A;  3NDK A;  4NCB A;  2D0C A;  1JL1 A;  1NK6 A;  3VQ6 A;  3OYC A;  1TGH A;  4CJT A;  4FLZ A;  3HPG A;  5FRO A;  1QQC A;  4IG3 A;  1WSF A;  2OPS A;  2X6S A;  3OYJ A;  4FLU A;  4TSX A;  3DM2 A;  4EZ6 A;  3HXM A;  1RBV A;  1A5V A;  1QN6 A;  4IG0 A;  3KKS A;  4FJH A;  2KFN A;  4FW2 A;  1ASU A;  2W42 A;  2F96 A;  4DS5 A;  4F2R A;  4KHN A;  2FC0 A;  2G8H A;  1WSJ A;  2B6A A;  3LAN A;  5HRR A;  4E19 A;  1YQK A;  1VRT A;  4CEQ A;  4DU4 A;  4WZS D;  1KVA A;  4M3Z A;  1JL2 A;  2A1S A;  4CEZ A;  1NJY A;  1VSD A;  4CJP A;  2PY5 A;  3RRH A;  2DY4 A;  3PUF A;  3TAB A;  2HB5 A;  3KJV A;  4FJX A;  3AVF A;  5KI6 A;  3VQD A;  4CE9 A;  1HNI A;  4DTS A;  4FJN A;  1L3S A;  1KRP A;  1JLF A;  4DG1 A;  4F4K A;  3HPH A;  4RW8 A;  4DLE A;  3HT3 A;  1CZ9 A;  3NH1 A;  3DOL A;  2YHA A;  1QN8 A;  1HYV A;  1W9H A;  4CFA A;  1JLG A;  3CM6 A;  4FLY A;  3SUQ A;  3KD1 E;  4FJJ A;  1Q8I A;  3HVT A;  1JLA A;  1PCZ A;  3OYK A;  3CFO A;  1CXQ A;  1QNB A;  1WSH A;  2IOC A;  3HP6 A;  1XC9 A;  3VQ8 A;  1A5X A;  2OPR A;  4OKK A;  3DMJ A;  1VTL E;  2JGU A;  3V1O A;  4CGJ A;  3LP2 A;  3ZT3 A;  4CEB A;  5KGX A;  3RWU A;  3RTV A;  4OLA A;  3K5O A;  4CJW A;  1N39 A;  2P1J A;  4O55 A;  4I8O A;  1YQM A;  1S5J A;  1BCM A;  5J2P A;  4HUE A;  1YTU A;  5FRN A;  3DLG A;  3OST A;  4IBN A;  5C42 A;  1NK8 A;  4CEF A;  1RT3 A;  1W80 A;  1MU2 A;  4JRP A;  4B9N A;  1YVU A;  1ZYQ A;  3RR7 A;  4E7L A;  4XIU A;  1LWV A;  1N6Q A;  4RW6 A;  1NJW A;  1ASV A;  3AVK A;  3VQQ A;  1HJR A;  2GV9 A;  4M3Y A;  2G8V A;  3C94 A;  4CHQ A;  3EY1 A;  2HVI A;  4PA1 A;  3L2W A;  3V9X A;  1R4X A;  3QLH A;  1KFS A;  4CHZ A;  3M8S A;  4FLT A;  2EHG A;  1JLE A;  3NF7 A;  3ZSO A;  4BE0 A;  3SQ1 A;  4CIG A;  1ZBH A;  4DQQ A;  3CQ8 A;  4K8X A;  1S1X A;  3ZCM A;  3NFA A;  4F3O A;  1VK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...