2D0CA

Crystal structure of bst-rnase hiii in complex with mn2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0cA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0cA02
1A5VA 4RODB 5HBMA 4CIEA 3KK3A 1QNBA 4DTMA 1NK8A 1RDDA 1QSLA 1ZBLA 1TVRA 3AO1A 4IDKA 4CJQA 4CJSA 2BANA 5FROA 4DU1A 1LAWA 2B5JA 3SQ4A 1QN8A 3CFOA 1RILA 1RNHA 4O0IA 1JLBA 3M8QA 4DTJA 3QEIA 2XY7A 4IG0A 3B6PA 3EZ5A 4FLUA 3OYCA 4CJPA 2A1RA 2OPRA 2HHWA 1VTOA 1TL3A 4B9SA 4Z4GA 4KI6A 3OS2A 1NH2A 2DFEA 1I39A 4YFUA 4DQSA 1D5AA 4M3TA 4ELVA 1QE1A 4MFBA 5SZTA 1B9KA 3IRXA 3RTVA 1C9BB 1L5UA 4CJVA 3OC3C 4ID1A 2OPPA 3KD5E 3NF9A 2WOMA 1IKVA 1SKWA 4LY7A 3ZT0A 4CHZA 3B6OA 3RRGA 2YNHA 3VQ6A 1WSJA 3SV4A 3C94A 1QSYA 4KFBA 1TKZA 2B4JA 2F96A 2YKNA 3AV9A 3ZSOA 4FJLA 4M3YA 2HHVA 4G1QA 4CHOA 3MAQA 3LZJA 2AJQA 3H08A 5FDLA 1WN7A 3DLRA 4CGJA 4O4GA 4OGCA 2GUIA 5KGWA 3MEEA 4K8XA 3OYAA 4CHPA 4B9TA 3CFRA 4Y1CA 3UIQA 5CYQA 4CF0A 3NDKA 3NBPA 5J2PA 3V81A 1TGOA 1S6PA 4OKKA 1HYVA 4K8ZA 1C0TA 4KREA 1JXBA 3S3OA 5KGXA 5I3UA 3C6TA 4CJWA 4M3ZA 2KW4A 3TAPA 5J2NA 4FLXA 1UA0A 3QLHA 4EZ6A 4CFAA 4WZSD 1QSSA 4M3XA 1VOKA 4HHTA 3TABA 1S1TA 1ITGA 2JLEA 5KI6A 4DF8A 3SUPA 4J2BA 4F2SA 3DRPA 3HPGA 5DMRA 1QTMA 4ROEB 3V4IA 4C8LA 4FJ8A 1DTTA 3VQAA 4FW2A 3VQ8A 4Z4HA 4Q0BA 2Z1HA 1XC9A 2XY5A 3SUOA 1JLEA 4CIGA 3HL8A 1QN6A 1WNSA 1YTAA 1YVUA 1NOYA 4XIUA 3F9KA 4KI4A 2KZZA 1UOCA 4B9MA 4B9NA 3BDPA 4KAZA 4ZHRA 3AVLA 2Z1JA 3U6FA 1N6QA 3VQPA 4FJ9A 1WSIA 3V9XA 1KFDA 2OZSA 4E1NA 4J2EA 2NUBA 1L3VA 5HRNA 2YNFA 1QN3A 3DOKA 2D0AA 1VSIA 4IKFA 1BISA 3TAFA 4N41A 5D3GA 4CEFA 3OYNA 1S5JA 1W0HA 3HPOA 1T7PA 4ROCB 4W5OA 2X6SA 3VA3A 3OYHA 2D0BA 3LPTA 4DSEA 1LW2A 1CLQA 1QTPA 1JKHA 2RF2A 4HCCA 4DS4A 2A1SA 1XWLA 2FBYA 2PZSA 5KRSA 1G15A 4E1MA 3DLEA 1SL0A 2X78A 4CF1A 3ZSZA 2I5JA 3LAMA 5J2QA 1L3UA 3SNNA 2BDPA 3RR7A 1ZYQA 3T19A 3PX4A 3CG7A 3KD1E 3MXJA 4LD0A 3SQ1A 4FK2A 5IYCP 4CJUA 2FBVA 4H4OA 5CYMA 4OPJA 3SJJA 2QKBA 1VSLA 3OYIA 3L3VA 3NH0A 4PA1A 1UAXA 2HNYA 2P1JA 1JL2A 4CESA 1BI4A 3S9HA 4B0AA 1KVAA 4H8KA 4Z0UA 1BGXT 3ZSQA 3ZCMA 3QESA 1NK0A 5FRMA 1JFIC 1YTFA 4CJ5A 5HP1A 3OCIA 4BDZA 1SKRA 2MJ7A 4M3UA 2GV9A 1HJRA 3KIOA 4DTOA 3S3MA 4CEDA 2Y1JA 4HUEA 4N5SA 2VWJA 4DWIA 1S9GA 1WAJA 2ZE2A 3K59A 4E7LA 4FYDA 4NCAA 2VJ0A 2BGGA 3AVAA 1RT5A 4CJRA 1BQMA 1RDAA 1ASVA 1R0AA 4KHWA 2YKMA 3ZSWA 3QEWA 3SI6A 3EYZA 3TANA 4F2RA 2RPIA 1TKDA 4FJNA 4LH5A 4EZ9A 2YV0X 3O3HA 2W42A 4C8OA 2OZMA 1HQEA 4CGGA 1HMVA 1VSKA 1E42A 5HRPA 2XY8A 5DK5A 4MQ3A 3PX6A 1N5YA 1NK5A 3HSTB 4CEBA 1KLNA 4CJ3A 4CJEA 4BE1A 3AA5X 1BCOA 3VQQA 3OS0A 3U3YA 3THVA 5J2MA 2FBTA 4CHQA 1RTHA 4W5TA 4CGFA 1K6YA 2Z1IA 1U48A 3OYKA 4RW8A 3RMCA 1WAFA 2WONA 3AVCA 5KRTA 1FK9A 1EX4A 4FJ5A 2D5RA 3DLHA 2DFHA 3RWUA 3AA4A 1BIUA 4PY5A 1VK0A 1CXUA 3AVNA 2XHBA 4FJKA 4FCYA 3ZSXA 3OYBA 4KHNA 1HQUA 1NOZA 3BGRA 2P5OA 4F8RA 3HP9A 3TAMA 1C0UA 4M3WA 1LWEA 3K5OA 2O4IA 1QN4A 3VQ4A 4EP4A 3ZT2A 1A5XA 4IFVA 3D0PA 4B9VA 4FW1A 3KLHA 1T8EA 4B9UA 1KFSA 1WLJA 3NH1A 4KTZA 4JLHA 3HK2A 3AA3A 1NKBA 5JS1A 1GOBA 5HRSA 4I7FA 3ZSVA 4M45A 4CJ4A 1KVCA 1C0MA 3L2RA 1KY6A 1TKTA 2HNDA 3KLEA 3PX0A 2HB5A 3QIPA 1CZBA 4FJXA 4N76A 5C24A 4M42A 2G8KA 3MXMA 1A5WA 1F21A 1J53A 1TGHA 1Q8IA 3WNHA 3TWHA 2ETJA 4IG3A 1Q9XA 3KTQA 4E7JA 1U04A 4CF2A 4QOZB 4FJJA 1GOAA 3AVGA 1TBPA 3ULDA 3OYEA 4M41A 3CFPA 4BDPA 1FKOA 2XO7A 1CZ9A 2XRIA 1RT6A 1QQCA 4DLGA 1EP4A 3V1QA 3OJUA 4DQQA 3WNFA 3DLBA 1RTDA 4AILC 3AO5A 3IG1A 1NJXA 4CEEA 3VQ7A 3NE6A 3LALA 3HP6A 3LWLA 1S1UA 2IGIA 4KTWA 2DY4A 1BHLA 3AVHA 4CECA 1RDBA 2XY6A 1KSPA 1TK8A 1NJYA 2PYJA 3P5JA 4FM1A 2HHTA 3HS8A 3DOLA 3DM2A 3M8RA 4F3OA 4CEAA 1RBVA 2ITGA 3PV8A 4NYFA 4BACA 4C8KA 1WSHA 2IS3A 1LAVA 4KKOA 3DRSA 3V9UA 1BI4B 1FXXA 3I0RA 1X1PA 3KKRA 4QAGA 1NK9A 1RCHA 1LV5A 4BE2A 3QNNA 4R5PA 4W5NA 1RTIA 2YHBA 1B9FA 3LAKA 5C42A 4CEOA 4DQPA 2E6MA 4HUFA 4KHSA 3U3GA 4DQIA 4FZYA 3A2FA 3KLGA 1EXQA 3LWMA 1Y97A 3DMJA 4JRPA 1KY7A 1TAQA 1RT4A 4FVMA 2HNZA 2LSNA 4RW9A 1JLGA 1WSFA 5I42A 3L2VA 4FM2A 1D9DA 2G8WA 2HVHA 3ZSRA 2KTQA 4DU4A 1NKCA 4CJKA 4JS5A 2G30A 3PUFA 4CGIA 2G8HA 4JRQA 2G8UA 3HO1A 1TL1A 1SKSA 4FK0A 1BIZA 2O4GA 3NF8A 4KO0A 3AVMA 2G8FA 1RM1A 4B8AB 3V1OA 4CJTA 4KRFA 4E0DA 4CK2A 1BQNA 3CQ8A 1IKWA 3VQCA 3SQ2A 3SCXA 3QIOA 2G8VA 1JLAA 3OS1A 2ATQA 4QCLA 2X74A 1KYUA 1WSEA 3OVNA 4RW4A 3VQ9A 4CFDA 4N56A 2KQ2A 1QNCA 1IO2A 3TAEA 3L3UA 3QO9A 1B9DA 5HLFA 3WNGA 4FJGA 4DLEA 3NGIA 4B3OA 2R7YA 3WNEA 3HS9A 1QS4A 3RMAA 2HVIA 4LH4A 1I3AA 2IV9A 1L3SA 3O4NA 1T03A 4CJFA 4DFKA 1HNVA 1W9HA 4FJIA 4ELUA 1O1WA 3H1ZA 4LSNA 2PYLA 4I2PA 4OPKA 5JS2A 3V9ZA 4EP5A 3KLIA 5EU7A 1D9FA 1VSFA 3T3FA 1NJWA 3LP2A 3VQDA 3OYMA 4YNQA 4OLBA 4NCBA 4OVLA 1RBTA 5E41A 4W5QA 4FM0A 1NK4A 2OYQA 3AVFA 1YTUA 3KKSA 4CF8A 2KZMA 5KTQA 4GMJB 3V9SA 4AHRA 2E4LA 4B8CA 3CM6A 4CCHA 2HHXA 1VSEA 3LDSA 1B92A 4O44A 1KTQA 4CGDA 4N47A 1IKXA 3SQ0A 2QK9A 4J2AA 3CYMA 2OPQA 3EIKA 4CEZA 2FC0A 1ZBIA 3AO2A 2ZD1A 1W80A 1RDCA 1SV5A 1RT1A 2JGUA 3E01A 3NFAA 4KHQA 4PQUA 4ID5A 4B08A 4PWDA 1J9AA 4ICLA 5T7BA 4E3SA 2IOCA 4TSXA 3VQEA 1RT3A 3ZSYA 4UQGA 3L2UA 4Z4EA 2HHSA 1S1XA 1VSMA 4CHYA 3CM5A 4CK3A 1J54A 3MXIA 2QKKA 2HW3A 2EX3A 3G0ZA 4CHNA 1C1BA 4W5RA 4DTUA 2ZQBA 4KHYA 3LP1A 4AH9A 1TBAB 1REVA 3OY9A 1UA1A 5FRNA 1KLMA 2IDOA 1JXEA 4C8MA 4DFMA 1VRTA 3SUNA 3LP0A 3OJSA 4B9LA 2HHUA 1QNEA 1C1CA 3DYAA 4DU3A 2QXFA 3ITHA 4DSKA 4O55A 1RT7A 1C6VA 1VSDA 4CJLA 1Z25A 4LSLA 4FZZA 1MU2A 5C25A 3K5NA 3SYZA 2Z1GA 3QNOA 2B6AA 2P51A 3MECA 3OYGA 3I8DA 1NK7A 4OGEA 2BE2A 3HJFA 4CEQA 4FJHA 3VN5A 2VG6A 4FJ7A 5K14A 2VG5A 1VOLB 4CK1A 1QN7A 4BWJA 1QNAA 3OYFA 4Z4CA 2VG7A 3QEPA 4DS5A 3SPYA 4FZXC 2F8TA 4CE9A 4IFYA 4DMNA 3KLFA 1KVBA 1EKEA 1RT2A 3K5MA 3TAGA 4OKEA 4BWMA 1KYFA 3O3FA 4KHUA 3C95A 3MEDA 3PO5A 4CERA 1DTQA 3TI0A 2YHAA 1AISA 4AHVA 3NF6A 3ZT4A 4CIFA 4E89A 4CFCA 3L2WA 1SL2A 4DSJA 4FLTA 1R4XA 1HNIA 3DLGA 4AHCA 4CFBA 1FKPA 4OKJA 3EY1A 4GW6A 3HYFA 3V6DA 1NJZA 3PO4A 3DLKA 2G8IA 4E7IA 3QETA 4M3RA 3HVRA 1ASWA 2Y1IA 1JLFA 3IS9A 4FLZA 2KFNA 1PZDA 2OPSA 3ISNC 1UWBA 3RRHA 3O4QA 3AO4A 4Y1DA 1WSGA 1IH7A 4RW6A 3KK2A 4I2QA 3K5LA 3K57A 3VQ5A 1X9MA 1HYSA 1NGMA 3L2QA 1U49A 3I0SA 1EETA 5HROA 3NCIA 4C8NA 1IG9A 4HTUA 5CZ2A 1QTSA 4DG1A 1QHTA 4FXDA 3C6UA 1KRPA 2P5GA 1TK5A 1NKEA 4F4KA 1ZBFA 4Q5VA 4FJMA 4HVJA 1ZBUA 3G10A 1TAUA 1RBUA 2RN2A 4BE0A 1QN9A 2HMIA 4DSIA 1Z26A 3D45A 4DTPA 4GVMA 5IYDP 4CF9A 1NK6A 3QEXA 1X9WA 4KB0A 4CGHA 3V1RA 4DTSA 2FBXA 3KK1A 3HXMA 3RR8A 3OYLA 4KPYA 2HHQA 4J2DA 3TARA 4H4MA 4DF4A 4JS4A 5CY4A 3LANA 4FK4A 1ASUA 4OJRA 3AVIA 2RKIA 1CDWA 3P83D 3M8PA 3NF7A 1VRUA 3DRRA 3L8BA 4O0JA 4E7HA 3NHGA 1KCFA 5SWMA 3SPZA 3HVTA 2E6LA 4DQRA 4Z4FA 1JLQA 1RBSA 3JYTA 5CZ1A 3SV3A 2YNGA 3LZIA 4AHSA 5J1EA 1S1WA 1VSJA 3NH2A 3OYJA 3T1AA 4HCBA 2X6NA 3ASMA 3PY8A 1S6QA 2KFZA 4KV8A 3NGYA 1BCMA 3MEGA 1GOCA 1JL1A 1LW0A 1VTLE 4DSLA 4RW7A 4KB1A 3RMBA 1BL3A 1S9EA 4ZTFA 1QN5A 1X9SA 4FLWA 1U47A 1XHZA 1YTBA 3HM9A 4KTQA 3VA0A 3HPHA 3ZT3A 3DI6A 4DTNA 4ZTJA 3ALYA 4Z4IA 2DTUA 1PCZA 1SL1A 2YNIA 4IBNA 2Q3SA 3SZ2A 3NGZA 4WE1A 1Q9YA 4DFJA 4OLAA 1L3TA 1TK0A 1C1AA 3AO3A 3QERA 5IYBP 1HPZA 1HRHA 3TAQA 4PUOA 4DSFA 3NAEA 3KJVA 3LPUA 4DTXA 4RG8A 1S1VA 1CXQA 1JLCA 2PY5A 5HRRA 2Z8UA 4I9LA 4O5BA 1U45A 1RTJA 2EHGA 1D3UA 3AVBA 2IC3A 1HYZA 4FLYA 3M8SA 3QEVA 1U4BA 4I9QA 4L8RB 3SUQA 1TKXA 3V9WA 3VQBA 1IKYA 2GBZA 1ZBHA 4FLVA 1LWCA 1KYDA 3HT3A 4BDYA 3AA2A 2VWKA 4AHTA 3P1GA 3O3GA 3AVJA 3K58A 1SUQA 1LWFA 3ZT1A 1YT3A 4DTRA 2IAJA 2D0CA 4DFPA 2DFFA 2F8SA 4E7KA 1XHXA 1MP9A 3LP3A 3QINA 4E19A 3S3NA 1XI1A 2OA8A 1VSHA 3AVKA 1TV6A 4HUGA 3IAYA 1NVPA 2IV8A 3TR8A 4F3TA 1J5OA 1RBRA 3RMDA 1D8YA 3JSMA 4NYNA 3OYDA 1T05A 4NCGA 4ELTA 3FFIA 1DLOA 3K2PA 4AHUA 3F73A
chains in the Genus database with same CATH superfamily
4RODB 4DTMA 3HO1A 3KK3A 1NK8A 4IDKA 4CJSA 1CZAN 3FR0A 4DU1A 1LAWA 2B5JA 3SQ4A 2WTUA 4CW7B 3JXUA 1U2VA 4HTLA 3OH6A 3M8QA 1ATNA 3CJ9A 3MWPA 3BP8A 2HHWA 2P9IB 4JI7K 3OS2A 1NH2A 4JI5K 1QE1A 4JHDB 3IRXA 3VESA 4CJVA 4B1WB 1EWQA 3HTVA 1SKWA 3B6OA 1QVFM 4IEIA 4GV6A 2FF3B 4M3YA 3ZSOA 3AV9A 1Q7YO 4DV6K 3THXA 4GV3A 1M3HA 2NOLA 3CWTA 4LF5K 4GVEA 4Y1CA 3V81A 1S6PA 4K8ZA 3S3OA 3CHWA 3TAPA 4FLXA 3QLHA 2FKFA 4C23A 4CFAA 1QSSA 3TABA 3OGDA 2F9WA 1ITGA 2JLEA 4KH5A 5KI6A 4DF8A 4F2SA 3DRPA 1E4FT 4TPSA 4Z94A 4DKWA 4C8LA 3VQAA 4FW2A 2NRVA 5ADXA 3BF3A 5AQPA 4CIGA 4B3SK 1WNSA 1NOYA 3QMLA 4MDBA 3F9KA 4KI4A 3TTCA 3VGLA 1N6QA 2ZGYA 3VQPA 3ULEA 1WSIA 4YOXA 2UU9K 2NUBA 2YNFA 5AFUH 4M7YA 5D3GA 2QM1A 2ITMA 2O8DA 4DSEA 4W5OA 2X6SA 4O5FA 2NZTA 1CLQA 1JKHA 2P9UB 3BUZB 2A1SA 2Q0RA 3CF5L 2PZSA 3SK3A 3CWSA 3THWB 1SL0A 4CBXA 4BRLA 3IFRA 3ZSZA 5J2QA 3LAMA 2RHKA 1KAXA 3VTIA 5CYMA 3WUHA 1IBKK 3OYIA 3M1FA 3RSEA 5H1SQ 2HNYA 4CESA 3S9HA 2NRTA 1KVAA 4H8KA 1NK0A 4WQ5C 3ZCMA 4BR7A 3FZMA 4IO9L 1U2VB 4LF6K 4M3UA 4B1XB 2NOFA 2VWBA 2V7YA 4HUEA 3THYB 3GDQA 4BRKA 2IVOA 2ZE2A 4E7LA 4GY2B 2BGGA 4CJRA 1RT5A 1N8RO 1BWFO 3EYZA 3EO3A 4FJNA 4IWVA 4PHTX 3H1VX 2YV0X 2OZMA 1DKGD 1HQEA 5GADP 1SQKA 4HWIA 5HRPA 5DK5A 3VTHA 4MQ3A 1KO9A 2GX9A 3IUCA 4CEBA 4CJ3A 1HUXA 3ENHA 4BE1A 1BCOA 3OS0A 3U3YA 3THVA 4CBUA 1U48A 3RMCA 3D4VA 2WONA 2NWVA 1WJWA 3PIOL 2D5RA 2DFHA 2HSTA 4EAKA 1BIUA 1VK0A 3AVNA 4FJKA 2IVNA 4EJZA 4OPAA 4J8FA 3BGRA 4K42A 4H0XB 4AQYK 1LWEA 4V19S 4B1UB 2O4IA 3ZT2A 4IFVA 3ZX0A 4DULA 4JAXA 5M1KA 1T8EA 3K0SA 1WLJA 3AA3A 5HRSA 4CVNE 4H0TB 3SBGA 3PX0A 1YAGA 1KY6A 1TKTA 4WQ5A 2O8EA 4M42A 2G8KA 3ULEB 1Q9XA 1TGHA 3WNHA 4QOZB 2VCPA 1TBPA 2IIRA 5JICA 1RGIA 3OYEA 4M41A 3WQUA 1GLBG 1TYQA 1RT6A 2O8DB 1NMNA 2LAEA 3AO5A 4DV5K 3NE6A 3LALA 3PIPL 1S1UA 3VOVA 3C65A 1BHLA 1TUYA 3LDPA 3DOLA 3M8RA 3WXLA 1W2BM 4BACA 3DRSA 4OX9K 3OSTA 1T44A 4CZHA 1NK9A 4R5PA 3CWUA 2WBNA 2E6MA 3A5OC 4DQIA 3KLGA 3UKRA 4JRPA 1TAQA 2W41A 1RT4A 4K0KK 4CBWA 3FZKA 3L2VA 5AQLA 4FWMA 5AJ3K 4JKGA 2G30A 4CGIA 2G8HA 4JRQA 1SKSA 4H5TA 3KZBA 3AVMA 3EL2A 4CJTA 2V52B 3W0LA 4KRFA 4AM6A 1BQNA 3SCXA 4WF9L 1JLAA 5AQZA 2X74A 3LL3A 4N56A 1HNZK 4LFAK 2KQ2A 1QNCA 2VGMA 4B3OA 3CCUN 4ILHA 1NNEA 4LH4A 4YY3K 4DFKA 4FJIA 1O1WA 2Q0UA 2YHYA 5CE3A 4EP5A 1HJOA 5EU7A 4JI8K 1T6AA 1NJWA 5AN4A 2HF3A 2ZWHA 4OLBA 4AM7A 4F9OA 4FPBA 5MLCQ 3CMAN 3MDQA 3KKSA 3CXCM 2KZMA 5M1FA 4AHRA 4B1ZA 3CM6A 1VSEA 2O8EB 2HL8A 2ZJRL 4O44A 3MMVA 1MA9B 3SQ0A 4CEZA 2FC0A 4C1NK 2JPIA 4CZMA 4B08A 4FWKA 5LMNK 4ICLA 5T7BA 4UQGA 1RT3A 4YOUA 1QZ6A 5C2DA 2HHSA 3MK6A 2EX3A 2YA3A 1N36K 1REVA 3OY9A 2DKCA 1KLMA 2IDOA 4WQ4C 1VRTA 3RSMA 2P9LA 3RPJA 4KH6A 3DWLA 2HBJA 2HL9A 3DYAA 3ITHA 4BQZA 4BRHA 4DU3A 4DSKA 3D2FB 4LSLA 1MU2A 5CR4A 3SBTA 3QNOA 5TKYA 4EALA 3HJFA 5DM6L 3Q7CA 5K14A 2VG5A 3ZX2A 3UKRB 5C15A 2F4VK 1NGDA 1JCEA 3QEPA 2E1YA 3SPYA 3MN7A 3R3LA 3M5RA 4IFYA 1SZ2A 3TAGA 4OKEA 4A59A 4KHUA 3ZETA 2Q97A 3TI0A 2W40A 1AISA 4JKFA 3L2WA 3KTUA 3G25A 4FLTA 1VQMN 5ADXH 2UUBK 1NJZA 4OKJA 3DPTA 4BREA 4GW6A 2G8IA 3O80A 3QETA 2WUSA 1JLFA 3IS9A 2NOHA 3ISNC 1UWBA 3QFUA 4N76A 3VQ5A 3MCAB 1VQNN 5AQMA 1C47A 1NGMA 3Q7BA 1I94K 4HTUA 2ZGZA 4FXDA 3TTFA 1NKEA 1VQ5N 4JK7A 1ZBUA 3PMGA 1P5DX 4WQ4A 1Z26A 2A42A 4DTPA 1W7AA 1NK6A 3QEXA 4CGHA 1BA1A 4DTSA 3DJCA 4H4MA 1EQYA 4PL8A 4OJRA 1MPGA 1VRUA 2R5XA 1KCFA 4PKIA 3HVTA 4DQRA 1JLQA 3JYTA 5CZ1A 3SV3A 3CC2N 2YNGA 3LZIA 5J1EA 3EKUA 1VSJA 3OYJA 4HCBA 1ESVA 3A5MC 1YIJN 1M3QA 4A2BA 1BCMA 4GNIA 1GOCA 1JL1A 1LW0A 1OH5A 4KB1A 1X3MA 1QN5A 3KK7A 4DV2K 1YTBA 3HPHA 4DTNA 3O9UA 3HOTA 4WE1A 4CI6A 1N39A 3PLAA 4DSFA 3NAEA 1CXQA 1VQPN 2Z8UA 4DR5K 1U45A 4M63C 3DXMB 3V9WA 3VQBA 5LJVA 1KFQA 1GLLO 3G71N 4AHTA 4FWNA 3ZT1A 3ZETB 2D0CA 4DFPA 3U8XA 1XHXA 3QINA 4BG8A 3VEVA 1TV6A 4D7QA 2NRHA 2O8FA 2GELA 1RBRA 3JSMA 2VGNA 1IBMK 3FLCO 4ELTA 3EE9A 4FWOA 3HZ6A 4CIEA 4A5AA 1QSLA 1UL7A 3VERA 3AO1A 2KKZA 4X65K 2BANA 5FROA 1KFIA 3HOSA 5M1NA 3CFOA 1YITN 2H4LX 1RILA 4JKAA 1JLBA 2HHHK 4X62K 3B6PA 3EZ5A 4FLUA 3KVGA 4KI6A 3VEOA 2NOIA 1X3NA 1D5AA 3VEYA 4MFBA 3NMUA 5SZTA 2Q2RA 4IXCA 1C9BB 3IDHA 3RTVA 3OC3C 2OPPA 3KD5E 4H0VB 5A2QO 2WOMA 3MN6A 2GWJA 3ID8A 4JKHA 4FPAA 4LY7A 4CHZA 5JLFA 1WSJA 1TKZA 2B4JA 1XQSC 4G1QA 4YDUC 3ENBA 3LZJA 2JOIA 3WXMB 1QQNA 4FWPA 2HZSA 4I6MB 4OGCA 4K8XA 2P9PA 2BH1A 5E26A 3CFRA 3UIQA 5CYQA 1TGOA 1XNRK 4AF1A 3ZEUA 2OOXA 4CJWA 2KW4A 3L0QA 1BG3A 4WZSD 1NMDA 2QLVA 4EIAA 4HHTA 3N89A 1IJJA 1QTMA 4ROEB 4U7BA 1YJWN 2OTJN 2ZJPL 3ATUA 2Z1HA 2V9JA 1XUPO 2VQFK 4WCEL 1YVUA 1NGBA 4BC2A 5LJWA 4XIUA 3UKUA 4KAZA 4ZHRA 1K8KA 3U6FA 2WFBA 3V9XA 3TTDA 4J2EA 1QN3A 3CCMN 1VSIA 2FGTA 4CEFA 4DR4K 1W0HA 1T7PA 1GLCG 2YHWA 2YI1A 4JEPA 1LW2A 3KWIA 4B1VA 1XWLA 1G15A 5AQHA 5F2RA 2O8FB 3DLEA 2P9NA 2I5JA 3SNNA 1GLDG 2Y8QA 3T19A 4H03B 2Q31A 3C04A 2WC9A 4YDUA 4FK2A 4CJUA 5M1QA 1HKBA 1RFQA 5LY3A 1N3CA 1UAXA 2FSKA 4PA1A 2F8SA 1JL2A 4GKKK 5FRMA 5DM7L 1BGXT 3ZSQA 2CH6A 3U9ZA 1HJRA 3KIOA 1E4GT 2Q36A 1LWYA 1QZ5A 2Y1JA 1JCFA 2VWJA 4DWIA 2BTFA 4FOEA 1O13A 4IEEA 3T1YK 4NCAA 2VJ0A 3L4IA 3EEQA 4PKHA 3FGUA 2YKMA 3SI6A 1EWRA 1TKDA 1YQRA 1NU0A 4LH5A 4CFFA 3PX6A 1NK5A 3JS6A 3JAMO 3SAFA 3TU5A 1DIZA 1NGIA 1RTHA 4CZGA 4FWQA 2P9PB 3OYKA 1FK9A 1RDUA 2P9SA 3DLHA 2E20A 2NRXA 3ZEUB 4BRCA 1CXUA 3J7AP 3O1BA 3HBTA 1M90O 3TAMA 1JCGA 3K5OA 1MWKA 2AP1A 1K73O 4B9UA 3DPUA 3A5NC 1KFSA 1NKBA 1GOBA 4I7FA 3ZSVA 1KVCA 5I9EB 2HNDA 4MRQA 1CZBA 3UKUB 4FJXA 1QVGM 1F21A 1Q8IA 3I56N 3TWHA 3OH9A 4IG3A 1BOTO 4CF2A 3ULDA 1OH6A 3AARA 3ZX3A 2OOYA 4NXMK 2XRIA 1XC3A 1QQCA 1EP4A 4XH5A 5F9CA 1RTDA 1NGFA 3VQ7A 2P9NB 2IVPA 3F10A 4KTWA 1LWWA 2O3OA 4NB4A 1NJYA 3CPEA 3P5JA 4IZ9A 4FM1A 4F3OA 4EHUA 3TE5A 4NYFA 1WSHA 1LAVA 4KKOA 1PCMX 3V9UA 1FXXA 3I0RA 1LV5A 3QNNA 3D6RA 3LAKA 5C42A 5BR9A 4BRAA 5FPEA 4HUFA 4NXNK 5M1OA 3TSPA 4CZIA 2HNZA 4DR6K 2ASMA 5I42A 2KTQA 4DU4A 4R79A 1TL1A 1LXTA 2G8FA 3ENOA 3V1OA 4B3RK 2G8VA 1XNQK 3OS1A 2ATQA 4FSVA 5LMUK 5KPZA 4CFDA 3TAEA 1NGGA 5HLFA 3QO9A 1B9DA 5EOYA 2A6AA 2R7YA 4BC4A 3HS9A 3B8AX 3RMAA 2IV9A 1L3SA 3O4NA 1J5EK 1W9HA 3I55N 2PYLA 4OPKA 5JS2A 1T6DA 3V9ZA 3R8EA 1K35A 3T3FA 4CZJA 3LP2A 3VQDA 4OVLA 1BUPA 1RBTA 3MX5A 5E41A 4X66K 4W5QA 4QS7A 4CF8A 5KTQA 2NRRA 1XSZA 3J8AA 2E4LA 1WBDA 2HHXA 1B92A 1KTQA 4CGDA 4N47A 3THXB 2QTDA 3EIKA 1QQMA 3AO2A 2ZD1A 4YOWA 1SV5A 1R59O 1J9AA 3U4LA 2IOCA 1S1XA 1PCJX 1VSMA 2QKKA 1J54A 3MXIA 3G0ZA 4AH9A 1TBAB 1UA1A 3OLPA 4DUYK 4DFMA 4B9LA 4CD1A 5KPRA 4H0OA 3QFPA 1J6ZA 1RT7A 4JI3K 1HKGA 3M6GA 3ULXA 2QXLA 1EO1A 1QHAA 3I8DA 4OGEA 4CEQA 3OBWA 1K2YX 2VG6A 3AY9A 1VOLB 4BWJA 1QNAA 4ISGA 2DKAA 5M1PA 4CE9A 4DMNA 4NLCA 3RVCA 4CZFA 3K5MA 5FPNA 4BWMA 1KYFA 3O3FA 4RCHA 4CERA 1DTQA 4AHVA 3ZT4A 4CIFA 3UE5A 1UT4A 1SL2A 4IOCL 1HNIA 4AHCA 3CJ1A 4CFBA 1DT9A 3PO4A 3DLKA 4E7IA 2KFNA 3ZYYX 4WXAA 2OPSA 3RSEB 3O4QA 4DQSA 3KK2A 1IH7A 3K57A 2PWWA 4I2QA 3UW2A 2AA4A 5HROA 4C8NA 3OTOK 1IG9A 2QEXN 4NO7A 4DG1A 1QHTA 3VF6A 4F4KA 4M7XA 3G10A 4KHPK 1QN9A 2Q1NA 4JN4A 2QWRA 2QREA 5AQQA 5ELZA 5AQUA 5EY4A 1X9WA 2GUPA 4BR0A 1ZXOA 3RR8A 4KPYA 2HHQA 3IH7A 4OO1J 3HRGA 3NF7A 4BRMA 3DRRA 4O0JA 4E7HA 2D4WA 5SWMA 3SPZA 2E6LA 4DV4K 3PSIA 2V51B 4B3TK 3T1AA 4MDAA 3ASMA 4KV8A 3NGYA 3F0ZA 1YJ9N 3VETA 4ZTFA 1S72N 3HM9A 2DPNA 1G99A 2ZFDB 4H0PA 4ZTJA 2DTUA 4BVPA 4BQLA 3H46O 3SZ2A 1SL1A 2FF6A 1L3TA 1C1AA 1HPZA 3KJVA 3LPUA 4O5BA 4FLYA 2QR1A 3AVBA 2IC3A 3NA5A 2QRCA 5FPMA 4A5BA 3SUQA 1TKXA 2NRZA 4JKBA 4A2AA 2QA4N 1TYQB 4IJNA 1LWCA 4ISFA 3CERA 4QS9A 4G9ZA 3HT3A 3AA2A 2VWKA 3P1GA 3O3GA 3AVJA 5GAGP 1YT3A 2IAJA 4IO8A 2E2NA 4BJUA 3LP3A 4E19A 3T69A 1V5SA 3AVKA 4HUGA 3IAYA 1NVPA 1KAYA 3TR8A 4BC5A 4F3TA 3H1QA 1P90A 1N34K 3FZFA 1T05A 3SNSA 3ZLJA 1NJIO 1A5VA 5HBMA 4FL9A 1RDDA 3E66A 2E2PA 1TVRA 4CJQA 4H0YB 3QEIA 4JI4K 4IG0A 4QS8A 2A1RA 3H45C 2PFUA 1TL3A 4Z4GA 5AQVA 1JDYA 4YFUA 3IMXA 4ELVA 3VPZA 3K9JA 4JKGB 1B9KA 2J4RA 4BY9C 5KQDA 3OHRA 2NRWA 1T6CA 3ZT0A 3VGKA 4K41A 1VQ7N 3A8YA 3EAYA 3RRGA 3H3NO 3VQ6A 3SV4A 1QSYA 4KFBA 5C0YA 3EKSA 5EX5A 2YKNA 1FN7A 4CHOA 3MAQA 4GV9A 2AJQA 3H08A 5FDLA 3DLRA 3W3DA 4CGJA 3LM2A 4O4GA 2EHBD 2GUIA 1N3AA 1YJNN 4B9TA 1GLFO 3ATVA 3NBPA 5J2PA 4OKKA 4DV1K 1JXBA 5I3UA 3C6TA 3E1YA 5J2NA 4EZ6A 4JI6K 1HU0A 2FUVA 1S1TA 2A5XA 3O9TA 4O8KA 3SAGA 5AQXA 2QWOA 2FXUA 3HPGA 5DMRA 3V4IA 4FJ8A 1DTTA 2FLOA 1XC9A 4BR9A 1JLEA 3HL8A 1YTAA 2GEMA 2KZZA 1UOCA 4B9MA 4B9NA 4A61A 3AVLA 3F2KA 1KFDA 5KL0A 4BROA 4DR2K 3HSCA 1OH8A 5HRNA 4NLBA 1MDUB 3DOKA 3J81O 2D0AA 4IKFA 4N41A 3FE1A 3OYNA 1VQ8N 1S5JA 1SS6A 3DAWA 3HPOA 4EAGA 4IL8A 3OYHA 2D0BA 1QTPA 3O9RA 4HCCA 5BN8A 5GAHP 5KRSA 4E1MA 3O8MA 4CF1A 1L3UA 3RR7A 1PVSA 2P9LB 3MXJA 4LD0A 3SQ1A 5IYCP 2FBVA 4H4OA 5FPDA 1VSLA 3L3VA 5AQSA 1BA0A 4H5NA 2QWPA 1BI4A 3KRMA 4Z0UA 4CJ5A 3OCIA 4BDZA 2MJ7A 3J7YP 2GV9A 4N5SA 1WAJA 4FYDA 4EJYA 3AVAA 1KQSM 1C0FA 4YORA 1RDAA 4LFBK 1R0AA 4KHWA 3QEWA 3FFKB 2RPIA 4LF8K 2W42A 4CGGA 1HMVA 1VSKA 2ZJQL 3I8BA 1Q86O 1N5YA 3D2EA 1KLNA 4CJEA 3VQQA 2O8CA 5J2MA 2FBTA 4W5TA 5JMVD 4CGFA 5BRDA 5KPTA 1TUOA 2E8AA 1WAFA 4WFAL 3AVCA 4CZKA 4FJ5A 2QI2A 3NVKA 3OA9A 3GOIA 2YCHA 4DUZK 1IG8A 4H5VA 4PY5A 1S22A 3P39A 2XHBA 4FCYA 1VQ6N 3ZSXA 3OYBA 2MZ8A 2UYTA 4KHNA 2P5OA 5AZIA 1C0UA 3VQ4A 4EP4A 3D0PA 1A5XA 4H5WA 4BRFA 4FW1A 3KLHA 3NH1A 4JLHA 3HK2A 4CJ4A 4XH4A 5JMVA 2QWLA 1C0MA 3KLEA 2HB5A 1V4TA 3QIPA 5C24A 1NWKA 3MXMA 1A5WA 1J53A 1V4SA 3KTQA 3QBWA 4E7JA 4FJJA 3AVGA 5BRHA 3WXKA 3GG4A 2XO7A 4DLGA 3DLBA 5AZJA 1W97L 4YOVA 3WT0A 1BDGA 4CEEA 3BF1A 1VQ9N 2E5LK 3CCEN 3HP6A 1OH7A 3C0BA 3LWLA 2IGIA 4Q11A 2HKPA 4JKCA 2DY4A 4OPHA 3SMPA 4CECA 1RDBA 2XY6A 1KSPA 2HMPA 5JVHL 4BGBA 3DM2A 4CEAA 1RBVA 3PV8A 3E9LA 2IS3A 4MLHA 1BI4B 3N4QA 1TUUA 3KKRA 4W5NA 2YHBA 1B9FA 3SMSA 2FKMX 4CEOA 4DQPA 4BG9A 3WXIA 3DMJA 1KY7A 2P9IA 5JVGL 1DEJA 3CCSN 4FVMA 3O1WA 4KH4A 2LSNA 5AR0A 1JLGA 1WSFA 2A3ZA 2HVHA 1NKCA 5FLXO 4JS5A 3PUFA 3C6HA 5HL7L 1BIZA 3NF8A 4KO0A 3E9OA 3QB0A 4B8AB 4DCHA 3D2EB 3SQ2A 3CQ8A 2V92A 3QIOA 3IKMA 2O8CB 3CC4N 1HX1A 1BU6O 4QCLA 3CCJN 3VQ9A 5BPLA 4JI2K 3L3UA 3WNGA 4DLEA 3NGIA 2ZF5O 4DR7K 4JYAK 5GIOA 2HVIA 1I3AA 1ZC6A 5C2FA 3AAQA 1T03A 2QW9A 3H1ZA 1OVYA 3DLLL 3KLIA 1DGKN 1WBBA 3S41A 3OYMA 1UT7A 4YNQA 1MWMA 4FM0A 3CCRN 1FJGK 3LDLA 5AQOA 2OYQA 3AVFA 3BKQX 4BRNA 4GMJB 1IV0A 4K25A 3CCQN 3VEXA 5AQIA 2QK9A 3CYMA 3U9DA 4CZLA 4YHHK 2H3GX 1W80A 3E01A 2YX6A 3G4SN 4CZEA 4KHQA 4PWDA 3DXKA 5AZJB 4C8OA 4E3SA 4TSXA 3ZSYA 3L2UA 3P38A 1H1VA 2HW3A 3MX2A 4DTUA 4W5RA 2P9UA 3LP1A 4EAIA 5FRNA 1JXEA 4IJAA 4C8MA 2QRDA 1C0GA 3LP0A 5IT9O 4XEIA 1LWVA 1QNEA 1C1CA 2CGLA 2QXFA 5E84A 4O55A 1VSDA 4CJLA 4FZZA 5C25A 5AQTA 3D7EO 3SYZA 2Z1GA 3ENOC 2P51A 3MECA 4B9QA 3OYGA 2NNWA 1NK7A 3T7ZA 1K8KB 3VF2A 1JJ2M 4BR2A 1NLVA 3THYA 4Z4CA 4DR1K 2F8TA 1EKEA 1RT2A 4IOAL 1OKJA 3PO5A 4C1NI 3NF6A 4E89A 1HNXK 3CC7N 4DSJA 2HZMA 1YI2N 3H6EA 5AQYA 3DLGA 4FWLA 1FKPA 3EY1A 3V6DA 1E3MA 4M3RA 3HVRA 1ASWA 4FLZA 3I0WA 3K5LA 3AO4A 3R9PA 1WSGA 2KHOA 2HOEA 1X9MA 1HYSA 3HI0A 3WXJA 4B1YB 2GTDA 3O4WA 3NCIA 1QTSA 3C6UA 3EN9A 4MLEA 2P5GA 1TK5A 3VF4A 3BY5A 3MN9A 4Q5VA 1TAUA 4HVJA 1YXQA 1RBUA 2P9KA 4BE0A 2HMIA 5IYDP 2I7PA 4YOYA 4CF9A 3CMEN 3BZCA 4KB0A 2FBXA 3C6AA 3HXMA 4LF4K 3OYLA 4J2DA 3TARA 4JS4A 5CY4A 2I7NA 3LANA 4FK4A 1ASUA 4ILGB 3A0IX 3AVIA 2RKIA 1CDWA 3P83D 2F7TA 3L8BA 4O8UA 1NGJA 3CJAA 1RBSA 2OCEA 1YHQN 3DXKB 4AHSA 1VQKN 1S1WA 3P31A 2CH5A 2P9SB 3PY8A 2ASOA 3MEGA 1SAZA 1VTLE 4RW7A 3RMBA 1BL3A 1S9EA 1X9SA 4FLWA 2V8QA 3AGKA 1U47A 3ZT3A 3AGRA 3DI6A 3F5TA 3ALYA 4IBNA 3GL1A 3NGZA 3CQXA 1Q9YA 2HBMA 5F1XA 1TK0A 3QERA 1HRHA 3TAQA 3D7QA 3O08A 4DTXA 4BRGA 1S1VA 1JLCA 2QWNA 1P5GX 3T1HK 4I9LA 1K9MO 1RTJA 2EHGA 1D3UA 2V7ZA 3GE1A 1HYZA 4YOTA 3M8SA 4L8RB 1HR0K 5AQNA 4BVOA 1QQOA 4PKGA 3L4QA 3OW2M 4UY8O 1C4GA 3CETA 4BDYA 2NLVA 1SUQA 4JKEA 3T4NA 5B8HA 4DTRA 2DFFA 3S3NA 1GLAG 1D8YA 3KWGA 4NYNA 3OYDA 3K9KA 5BN9A 3K2PA 4AHUA 3WQTA 4FJHA 3F73A 1QNBA 1ZBLA 1YF5L 4A57A 4LF7K 2NOZA 2OANA 4L3QA 1QN8A 4U67L 1RNHA 4O0IA 2XY7A 4DTJA 2P9KB 4CJPA 4BR5A 2OPRA 4ISEA 3OYCA 1VTOA 4B9SA 1HPMA 2DFEA 1I39A 4EAHD 4M3TA 3TPQA 1L5UA 4ID1A 2XHIA 3NF9A 3O6WA 1K8AO 2Z0FA 4LF9K 1IKVA 4I8OA 3SLCA 2YNHA 3TDHA 1J3MA 1EUVA 3C94A 4FJLA 2F96A 2H5AX 2HHVA 1VAZA 1M1KO 1WN7A 4K43A 5KGWA 3MEEA 3OYAA 4CHPA 4CF0A 3NDKA 3I3WA 4A62A 4DV0K 1HYVA 4KREA 1C0TA 2NLXA 1NG9A 4H5RA 5KGXA 4M3ZA 3LM9A 1UA0A 4BRDA 4M3XA 1VOKA 2OTLN 3SUPA 4J2BA 2DKDA 4FO0A 4BRIA 2Y8LA 3I33A 3VQ8A 3D2FA 4Z4HA 4Q0BA 2XY5A 3SUOA 1NBWA 3J80O 2JWKA 1QN6A 2NOBA 3CVTA 3BDPA 4FJ9A 2Z1JA 2VYPA 1NGCA 2OZSA 2YH5A 4EAJA 4E1NA 1L3VA 4QG5A 2JHNA 1BISA 1ATSA 3TAFA 3BZKA 3GBTA 5HOOA 4ROCB 4XH1A 3VA3A 1BO5O 3LPTA 4KBOA 2PAVA 5AQGA 2RF2A 3CPWM 5BR8K 4DS4A 4B3MK 1EBMA 2FBYA 1NGAA 3CCVN 4DV3K 2X78A 2BDPA 2YJFA 1ZYQA 3PX4A 3CG7A 3KD1E 4OPJA 3SJJA 2QKBA 3NH0A 2P1JA 4EZ9A 2W6KA 4B0AA 4D7RA 3QESA 1JFIC 1YTFA 5HP1A 1SKRA 3S3MA 3MCPA 4DTOA 4IDHA 4CEDA 3L6QA 5HSHA 1FW6A 1S9GA 3K59A 5JLHA 2I5WA 3P4IA 1BQMA 1YUWA 1ASVA 3ZSWA 3TANA 4F2RA 3CCLN 4JNEA 3O3HA 5GIPA 1E42A 2XY8A 4JI1K 5GINA 3CWAA 1ATRA 1WOQA 3HSTB 3HM8A 3AA5X 2D0OA 3G6EN 4CJ7A 4CHQA 5EPCA 1K6YA 2HBKA 2Z1IA 4RW8A 5CHIA 5KRTA 4CD3A 1M5Q1 1EX4A 3LDOA 3R1XA 3RWUA 3AA4A 4ILJA 1HQUA 1NOZA 4F8RA 3HP9A 4M3WA 1QN4A 4E1JA 5LL6Z 4B9VA 3M3ZA 4JD2A 5BMNA 2CGJA 2VQEK 4KTZA 2HBLA 5JS1A 4M45A 3L2RA 2ZM6K 1HLUA 3VEWA 2ETJA 1U04A 1GOAA 1HNWK 3NVMA 3DXMA 4MO4A 3CFPA 4BDPA 1FKOA 1CZ9A 1ZBSA 3V1QA 3OJUA 2KLAA 4DQQA 3WNFA 3SAHA 4AILC 3H3OB 2EWSA 3IG1A 1NJXA 4DB3A 3CJ7A 5EVZA 1T3VA 2F7LA 3AVHA 1TK8A 2PYJA 2HHTA 3O9QA 5TKWA 5BPMA 3HS8A 3TSUA 2ITGA 4C8KA 1OVQA 5JN5A 1X1PA 4QAGA 1RCHA 2UXBK 4BE2A 5C10A 1RTIA 1Q18A 3CVSA 3QBXA 4KHSA 3U3GA 4FZYA 3CJCA 3A2FA 3QDKA 1EXQA 3LWMA 1Y97A 4RW9A 4FM2A 1D9DA 2G8WA 1NGEA 3ZSRA 2FSNA 4CJKA 2G8UA 4FK0A 4BRPA 1IBLK 2O4GA 1RM1A 5AQRA 4E0DA 1VQ4N 3E9PA 4CK2A 4HJHA 1IKWA 3VQCA 2NOEA 1WUAA 4JKDA 4LFCK 3PSFA 1KYUA 1WSEA 3OVNA 4RW4A 1VKLA 1IO2A 4FJGA 3CIPA 3BEXA 4I6MA 3WNEA 1QS4A 4DR3K 5F0XA 3O5BA 4JK9A 1NM1A 4CJFA 1HNVA 4ELUA 4LSNA 5AFUA 4I2PA 5AQKA 2BUPA 4FOIA 1D9FA 5BREA 1VSFA 5IWAK 4JD2B 4NCBA 4WX8A 3VENA 2O8BA 1NK4A 1YTUA 2F9TA 4RTFD 2CGKA 3V9SA 4B8CA 4CCHA 4WFNL 3LDSA 3AAPA 1IKXA 4J2AA 2OPQA 3WEEA 1ZBIA 5AQWA 1RDCA 3NFAA 1RT1A 2JGUA 4PQUA 4ID5A 2UXDK 4Z4EA 4IFEA 3VQEA 4CK3A 4CHYA 3CM5A 1LOTB 4CHNA 1C1BA 2E2QA 4KHYA 2ZQBA 4IOXA 2A41A 3LDQA 5C12A 2JWLA 3SUNA 3OJSA 4GKJK 2HHUA 3CW7A 2E2OA 4BR4A 1KD1O 1N33K 1Q81O 1YQKA 4MO5A 3CQYA 3OSMA 2D1KA 1WB9A 3EZWA 1C6VA 1GLJO 3OBYA 1Z25A 5AQJA 1P8ZA 3MN5A 3K5NA 3PDKA 4LC9B 2NVMA 2B6AA 4JK8A 2GWKA 5GAEP 2BE2A 2YHXA 3C7NA 3VN5A 4FJ7A 4CK1A 1QN7A 3OYFA 2VG7A 4DS5A 4FZXC 3KLFA 1KVBA 1YVNA 3CD6N 4DHYA 2UXCK 1VQLN 3C95A 3MEDA 2JHJA 3OSEA 1U6ZA 2YHAA 3KHYA 4CFCA 2RE2A 4DV7K 5AQFA 5BRFA 1LCUA 3CJBA 1R4XA 3SJHA 3HYFA 4BC3A 1X9JA 3R6MA 4PL7A 2Y1IA 1PZDA 4WYBA 3RRHA 1Y64A 4RW6A 4Y1DA 3UB5A 3LDNA 1YQLA 3L2QA 1U49A 3I0SA 1EETA 4Y0WA 3ID6A 5CZ2A 1Q9UA 1KXPA 2PBDA 1D4XA 3EE8A 3A5LC 1KRPA 1ZBFA 4FJMA 2E88A 3N4PA 2RN2A 5BPNA 1YQMA 2A40A 4FVUA 1Q82O 4DSIA 3D45A 4JV5K 4GVMA 5EXWA 2O8BB 2E1ZA 3VGMA 3V1RA 4JHDA 1Z6RA 3KK1A 1KC8O 3O9SA 1NGHA 4DF4A 2HF4A 3FZLA 4EHTA 4FWSA 4FWRA 3M8PA 1HKCA 3WEEB 1WQAA 1VHXA 4EFHA 3CI5A 3NHGA 2QWMA 2YJEA 4Z4FA 2W6LA 3NH2A 2UUAK 2X6NA 1S6QA 2KFZA 4DSLA 1Z05A 4BGAA 5AZIB 2D0PA 1XHZA 3J7ZO 4KTQA 3VA0A 4Z4IA 1RDWX 1PCZA 2YNIA 2Q3SA 3I0XA 1N32K 3MWTA 4DFJA 4OLAA 4X64K 3AO3A 5IYBP 4PUOA 2ASPA 3F9MA 5KQ8A 4RG8A 3ENCA 2PY5A 1ILYA 5HRRA 3C7NB 1KAZA 3QEVA 4C7PA 3QICA 1U4BA 4I9QA 2FSJA 1S3XA 4DQ8A 3TSQA 1IKYA 2GBZA 1ZBHA 4WFBL 4FLVA 4BRQA 3VEZA 1KYDA 3K58A 1LWFA 1GLEG 4E7KA 2QWQA 1MP9A 1XI1A 2OA8A 1VSHA 2UUCK 2IV8A 3FZHA 3THWA 4RWTA 1XMOK 5BMPA 3RMDA 1J5OA 1VQON 1XMQK 4JI0K 4NCGA 3VMFB 3FFIA 1DLOA
chains in the Genus database with same CATH topology
1A5VA 4RODB 5HBMA 4CIEA 3KK3A 1QNBA 4DTMA 1NK8A 1RDDA 1QSLA 1ZBLA 1TVRA 3AO1A 4IDKA 4CJQA 4CJSA 2BANA 5FROA 4DU1A 1LAWA 2B5JA 3SQ4A 2NOZA 1QN8A 3CFOA 1RILA 1RNHA 4O0IA 1JLBA 3M8QA 4DTJA 3QEIA 2XY7A 4IG0A 3B6PA 3EZ5A 4FLUA 3OYCA 4CJPA 2A1RA 2OPRA 2HHWA 1VTOA 1TL3A 4B9SA 4Z4GA 4KI6A 3OS2A 1NH2A 2NOIA 2DFEA 1I39A 4YFUA 4DQSA 1D5AA 4M3TA 4ELVA 1QE1A 4MFBA 5SZTA 1B9KA 3IRXA 3RTVA 1C9BB 1L5UA 4CJVA 3OC3C 4ID1A 2OPPA 3KD5E 2XHIA 3NF9A 2WOMA 1IKVA 1SKWA 4LY7A 3ZT0A 4I8OA 4CHZA 3B6OA 3RRGA 2YNHA 3VQ6A 1WSJA 3SV4A 3C94A 1QSYA 4KFBA 1TKZA 2B4JA 2F96A 2YKNA 1FN7A 3AV9A 3ZSOA 4FJLA 4M3YA 4G1QA 2HHVA 4CHOA 1M3HA 2NOLA 3MAQA 3LZJA 2AJQA 2JOIA 3H08A 1WN7A 3DLRA 5FDLA 4CGJA 4O4GA 2HZSA 4OGCA 2GUIA 1N3AA 3MEEA 5KGWA 3OYAA 4CHPA 4B9TA 4K8XA 3CFRA 4Y1CA 3UIQA 5CYQA 4CF0A 3NDKA 3NBPA 5J2PA 3V81A 1TGOA 1S6PA 4OKKA 5FRMA 1HYVA 4K8ZA 1C0TA 4KREA 1JXBA 3S3OA 5KGXA 5I3UA 3C6TA 4CJWA 4M3ZA 2KW4A 3TAPA 5J2NA 4FLXA 1UA0A 3QLHA 4EZ6A 4CFAA 4WZSD 1QSSA 4M3XA 1VOKA 1HU0A 4HHTA 3TABA 1S1TA 1ITGA 2JLEA 5KI6A 4DF8A 3SUPA 4J2BA 4F2SA 3DRPA 3HPGA 3N89A 4TPSA 5DMRA 4ROEB 1QTMA 3V4IA 4C8LA 4FJ8A 1DTTA 3VQAA 4FW2A 3VQ8A 4Z4HA 4Q0BA 2Z1HA 1XC9A 2XY5A 3SUOA 1JLEA 4CIGA 3HL8A 1QN6A 1WNSA 1YTAA 1YVUA 1NOYA 4XIUA 3F9KA 4KI4A 2KZZA 1UOCA 2NOBA 4B9MA 4B9NA 3BDPA 4KAZA 4ZHRA 3AVLA 2Z1JA 3U6FA 1N6QA 3VQPA 4FJ9A 1WSIA 3V9XA 1KFDA 2OZSA 2YH5A 4E1NA 4J2EA 2NUBA 1L3VA 5HRNA 2YNFA 1QN3A 3DOKA 2D0AA 1VSIA 4IKFA 2FGTA 1BISA 3TAFA 4N41A 4CEFA 3OYNA 5D3GA 1S5JA 1W0HA 3HPOA 1T7PA 4ROCB 4W5OA 2X6SA 3VA3A 3OYHA 2D0BA 3LPTA 4DSEA 1LW2A 1CLQA 1QTPA 1JKHA 2RF2A 4HCCA 4DS4A 2A1SA 1EBMA 1XWLA 2FBYA 2PZSA 5KRSA 1G15A 4E1MA 3DLEA 1SL0A 2X78A 4CF1A 3ZSZA 2I5JA 3LAMA 5J2QA 1L3UA 3SNNA 2BDPA 3RR7A 1ZYQA 3T19A 3PX4A 3CG7A 3KD1E 3MXJA 4LD0A 3SQ1A 4FK2A 5IYCP 4CJUA 2FBVA 4H4OA 5CYMA 4OPJA 3SJJA 2QKBA 1VSLA 3OYIA 3L3VA 3NH0A 1N3CA 1UAXA 4PA1A 2HNYA 2P1JA 1JL2A 4CESA 1BI4A 3S9HA 3KRMA 4B0AA 1KVAA 4Z0UA 1BGXT 4H8KA 3ZCMA 3ZSQA 3QESA 1NK0A 1JFIC 1YTFA 4CJ5A 5HP1A 3OCIA 4BDZA 1SKRA 2MJ7A 2NOFA 2GV9A 4M3UA 1HJRA 3KIOA 4DTOA 3S3MA 4CEDA 1LWYA 2Y1JA 4HUEA 4N5SA 2VWJA 4DWIA 1S9GA 1WAJA 2ZE2A 3K59A 4E7LA 4FYDA 2I5WA 2VJ0A 4NCAA 2BGGA 4EJYA 3AVAA 1RT5A 4CJRA 1BQMA 1RDAA 1ASVA 1R0AA 4KHWA 2YKMA 3ZSWA 3QEWA 3SI6A 3EYZA 3TANA 4F2RA 2RPIA 1TKDA 1YQRA 4FJNA 4LH5A 4EZ9A 2YV0X 3O3HA 2W42A 4C8OA 2OZMA 1HQEA 4CGGA 1HMVA 1VSKA 1E42A 5HRPA 2XY8A 5DK5A 4MQ3A 3PX6A 1N5YA 1NK5A 1KO9A 3HSTB 4CEBA 1KLNA 4CJ3A 4CJEA 4BE1A 3AA5X 1BCOA 3VQQA 3OS0A 3U3YA 3THVA 5J2MA 2FBTA 4CHQA 1RTHA 4W5TA 4CGFA 1K6YA 2Z1IA 1U48A 3OYKA 4RW8A 3RMCA 1WAFA 2WONA 3AVCA 5KRTA 1FK9A 1EX4A 4FJ5A 2D5RA 3DLHA 2DFHA 3RWUA 3AA4A 1BIUA 4PY5A 1VK0A 1CXUA 3AVNA 2XHBA 4FJKA 4FCYA 4EJZA 3ZSXA 3OYBA 2MZ8A 4KHNA 1HQUA 1NOZA 3BGRA 2P5OA 4F8RA 3HP9A 3TAMA 1C0UA 4M3WA 1LWEA 3K5OA 2O4IA 1QN4A 3VQ4A 4EP4A 3ZT2A 1A5XA 4IFVA 3D0PA 4B9VA 4DULA 4FW1A 3KLHA 1T8EA 4B9UA 3DPUA 1KFSA 1WLJA 3NH1A 4KTZA 4JLHA 3HK2A 3AA3A 1NKBA 5JS1A 1GOBA 5HRSA 4I7FA 3ZSVA 4M45A 4CJ4A 1KVCA 1C0MA 3L2RA 1KY6A 1TKTA 2HNDA 3KLEA 3PX0A 2HB5A 3QIPA 1CZBA 4FJXA 4N76A 5C24A 4M42A 2G8KA 3MXMA 1A5WA 1F21A 1J53A 1TGHA 1Q8IA 3WNHA 3TWHA 2ETJA 4IG3A 1Q9XA 3KTQA 4E7JA 1U04A 4CF2A 4QOZB 4FJJA 1GOAA 3AVGA 1TBPA 3ULDA 3OYEA 4M41A 3CFPA 4BDPA 1FKOA 2XO7A 1CZ9A 4DSKA 2XRIA 1RT6A 1QQCA 4DLGA 1EP4A 3V1QA 3OJUA 4DQQA 3WNFA 3DLBA 1RTDA 4AILC 2LAEA 3AO5A 3IG1A 1NJXA 4CEEA 3VQ7A 3NE6A 3LALA 3HP6A 3LWLA 1S1UA 3F10A 4Q11A 2IGIA 4KTWA 2DY4A 1LWWA 2O3OA 1BHLA 3AVHA 4CECA 1RDBA 2XY6A 1KSPA 1TK8A 1NJYA 2PYJA 3P5JA 4FM1A 2HHTA 3HS8A 3DOLA 3DM2A 3M8RA 4F3OA 4CEAA 1RBVA 2ITGA 3PV8A 4NYFA 4BACA 4C8KA 1WSHA 2IS3A 1LAVA 4KKOA 3DRSA 3V9UA 1BI4B 1FXXA 3I0RA 1X1PA 3OSTA 3KKRA 4QAGA 1NK9A 1RCHA 1LV5A 4BE2A 3QNNA 4R5PA 4W5NA 1RTIA 2YHBA 1B9FA 3LAKA 5C42A 4CEOA 4DQPA 2E6MA 4HUFA 4KHSA 3U3GA 4DQIA 4FZYA 3A2FA 3KLGA 1EXQA 3LWMA 1Y97A 3DMJA 4JRPA 1KY7A 1TAQA 1RT4A 4FVMA 2HNZA 2LSNA 4RW9A 1JLGA 1WSFA 5I42A 3L2VA 4FM2A 1D9DA 2G8WA 2HVHA 3ZSRA 2KTQA 4DU4A 1NKCA 4CJKA 4JS5A 2G30A 3PUFA 4CGIA 2G8HA 4JRQA 2G8UA 3HO1A 1TL1A 1SKSA 4FK0A 1BIZA 2O4GA 3NF8A 4KO0A 3AVMA 2G8FA 1RM1A 4B8AB 3V1OA 4CJTA 4DU3A 4KRFA 4E0DA 4CK2A 1BQNA 3CQ8A 1IKWA 3VQCA 2NOEA 3SQ2A 3QIOA 3SCXA 2G8VA 1JLAA 3OS1A 2ATQA 4QCLA 2X74A 1KYUA 1WSEA 3OVNA 4RW4A 3VQ9A 4CFDA 4N56A 2KQ2A 1QNCA 1IO2A 3TAEA 3L3UA 3QO9A 1B9DA 5HLFA 3WNGA 4FJGA 4DLEA 3NGIA 4B3OA 2R7YA 3WNEA 3HS9A 1QS4A 3RMAA 2HVIA 4LH4A 1I3AA 2IV9A 1L3SA 3O4NA 1T03A 4CJFA 4DFKA 1HNVA 1W9HA 4FJIA 4ELUA 1O1WA 3H1ZA 4LSNA 2PYLA 4I2PA 4OPKA 5JS2A 3V9ZA 4EP5A 3KLIA 5EU7A 1D9FA 1VSFA 3T3FA 1NJWA 3LP2A 3VQDA 5AN4A 3OYMA 1UT7A 4YNQA 4OLBA 4NCBA 4OVLA 1RBTA 5E41A 4W5QA 4FM0A 1NK4A 2OYQA 3AVFA 1YTUA 3KKSA 4CF8A 2KZMA 5KTQA 4GMJB 3V9SA 4AHRA 2E4LA 4B8CA 3CM6A 4CCHA 2HHXA 1VSEA 3LDSA 1B92A 4O44A 1KTQA 4CGDA 4N47A 1IKXA 3SQ0A 2QK9A 4J2AA 3CYMA 2OPQA 3EIKA 4CEZA 2FC0A 1ZBIA 3AO2A 2ZD1A 1W80A 1RDCA 1SV5A 1RT1A 2JGUA 3E01A 3NFAA 4KHQA 4PQUA 4ID5A 4B08A 4PWDA 1J9AA 4ICLA 5T7BA 4E3SA 2IOCA 4TSXA 3VQEA 1RT3A 3ZSYA 4UQGA 3L2UA 4Z4EA 2HHSA 1S1XA 1VSMA 4CHYA 3CM5A 4CK3A 1J54A 3MXIA 2QKKA 2HW3A 2EX3A 3G0ZA 4CHNA 1C1BA 4W5RA 4DTUA 2ZQBA 4KHYA 3LP1A 4AH9A 1TBAB 1REVA 3OY9A 1UA1A 5FRNA 1KLMA 2IDOA 1JXEA 4C8MA 4DFMA 1VRTA 3SUNA 3LP0A 3OJSA 4B9LA 2HHUA 3RPJA 1YQKA 1LWVA 1QNEA 1C1CA 3DYAA 3OSMA 2QXFA 3ITHA 4O55A 1RT7A 1C6VA 1VSDA 4CJLA 1Z25A 4LSLA 4FZZA 1MU2A 5C25A 3ULXA 3K5NA 3SYZA 2Z1GA 3QNOA 2B6AA 2P51A 3MECA 3OYGA 3I8DA 1NK7A 4OGEA 2BE2A 3HJFA 4CEQA 4FJHA 3VN5A 2VG6A 4FJ7A 5K14A 2VG5A 1VOLB 4CK1A 1QN7A 4BWJA 1QNAA 3OYFA 4Z4CA 2VG7A 3QEPA 4DS5A 3SPYA 4FZXC 3RRHA 2F8TA 4CE9A 4IFYA 4DMNA 3KLFA 1KVBA 1EKEA 1RT2A 3K5MA 3TAGA 4OKEA 4BWMA 1KYFA 3O3FA 4KHUA 3C95A 3MEDA 3PO5A 4CERA 1DTQA 3TI0A 2YHAA 1AISA 4AHVA 3NF6A 3ZT4A 4CIFA 4E89A 4CFCA 1UT4A 3KTUA 3L2WA 2HZMA 1SL2A 4FLTA 4DSJA 1R4XA 1HNIA 3DLGA 4AHCA 4CFBA 1FKPA 3DPTA 4OKJA 4GW6A 3HYFA 3EY1A 3V6DA 1NJZA 3DLKA 3PO4A 4E7IA 3QETA 4M3RA 2G8IA 3HVRA 1ASWA 2Y1IA 1JLFA 3IS9A 2NOHA 4FLZA 2KFNA 1PZDA 2OPSA 3I0WA 1UWBA 3ISNC 3O4QA 3AO4A 4Y1DA 1WSGA 1IH7A 4RW6A 3KK2A 4I2QA 3K5LA 3K57A 3VQ5A 1X9MA 1HYSA 1YQLA 1NGMA 3L2QA 1U49A 3I0SA 1EETA 5HROA 3NCIA 4C8NA 1IG9A 4HTUA 5CZ2A 1QTSA 4DG1A 1QHTA 4FXDA 3C6UA 1KRPA 2P5GA 1TK5A 1NKEA 4F4KA 1ZBFA 4Q5VA 4FJMA 4HVJA 1ZBUA 3G10A 1TAUA 1RBUA 2RN2A 4BE0A 1YQMA 1QN9A 2HMIA 4DSIA 1Z26A 3D45A 4DTPA 4GVMA 5IYDP 4CF9A 1NK6A 3QEXA 1X9WA 4KB0A 4CGHA 3V1RA 4DTSA 2FBXA 3KK1A 3HXMA 3RR8A 3OYLA 4KPYA 2HHQA 4J2DA 3TARA 4H4MA 4DF4A 3IH7A 4JS4A 5CY4A 3LANA 4FK4A 1ASUA 4OJRA 3AVIA 2RKIA 1CDWA 3P83D 3M8PA 3NF7A 1VRUA 3DRRA 3L8BA 4O0JA 4E7HA 3NHGA 1KCFA 5SWMA 3SPZA 3HVTA 2E6LA 4DQRA 4Z4FA 1JLQA 1RBSA 3JYTA 5CZ1A 3SV3A 2YNGA 3LZIA 4AHSA 5J1EA 1S1WA 1VSJA 3NH2A 3OYJA 3T1AA 4HCBA 2X6NA 3ASMA 3PY8A 1S6QA 2KFZA 1M3QA 4KV8A 3NGYA 1BCMA 3MEGA 3F0ZA 1JL1A 1GOCA 1VTLE 1LW0A 4RW7A 4DSLA 4KB1A 3RMBA 1BL3A 1S9EA 4ZTFA 1QN5A 1X9SA 4FLWA 1U47A 1XHZA 1YTBA 3HM9A 4KTQA 3VA0A 3HPHA 3ZT3A 3DI6A 4DTNA 4ZTJA 3ALYA 4Z4IA 2DTUA 1PCZA 1SL1A 2YNIA 4IBNA 2Q3SA 3SZ2A 3NGZA 3I0XA 4WE1A 1Q9YA 4DFJA 4OLAA 1L3TA 1TK0A 1N39A 1C1AA 3AO3A 5IYBP 1HPZA 1HRHA 3QERA 3TAQA 4PUOA 4DSFA 3NAEA 3KJVA 3LPUA 4DTXA 4RG8A 1S1VA 1CXQA 1JLCA 2PY5A 5HRRA 2Z8UA 4I9LA 4O5BA 1U45A 1RTJA 2EHGA 1D3UA 3AVBA 2IC3A 1HYZA 4FLYA 3M8SA 3QEVA 1U4BA 4I9QA 4L8RB 3SUQA 1TKXA 3V9WA 3VQBA 1IKYA 2GBZA 1ZBHA 4FLVA 1LWCA 1KYDA 3HT3A 4BDYA 3AA2A 2VWKA 4AHTA 3P1GA 3O3GA 3AVJA 3K58A 1SUQA 1LWFA 3ZT1A 1YT3A 4DTRA 2IAJA 2D0CA 4DFPA 2DFFA 2F8SA 4E7KA 1XHXA 1MP9A 3LP3A 3QINA 4E19A 3S3NA 1XI1A 2OA8A 1VSHA 3AVKA 1TV6A 4HUGA 3IAYA 1NVPA 2IV8A 3TR8A 4F3TA 1J5OA 1RBRA 3RMDA 1D8YA 3JSMA 4NYNA 3OYDA 1T05A 4NCGA 3SNSA 3FFIA 1DLOA 3K2PA 4ELTA 4AHUA 3F73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5V A;  4ROD B;  5HBM A;  4CIE A;  3KK3 A;  1QNB A;  4DTM A;  1NK8 A;  1RDD A;  1QSL A;  1ZBL A;  1TVR A;  3AO1 A;  4IDK A;  4CJQ A;  4CJS A;  2BAN A;  5FRO A;  4DU1 A;  1LAW A;  2B5J A;  3SQ4 A;  1QN8 A;  3CFO A;  1RIL A;  1RNH A;  4O0I A;  1JLB A;  3M8Q A;  4DTJ A;  3QEI A;  2XY7 A;  4IG0 A;  3B6P A;  3EZ5 A;  4FLU A;  3OYC A;  4CJP A;  2A1R A;  2OPR A;  2HHW A;  1VTO A;  1TL3 A;  4B9S A;  4Z4G A;  4KI6 A;  3OS2 A;  1NH2 A;  2DFE A;  1I39 A;  4YFU A;  4DQS A;  1D5A A;  4M3T A;  4ELV A;  1QE1 A;  4MFB A;  5SZT A;  1B9K A;  3IRX A;  3RTV A;  1C9B B;  1L5U A;  4CJV A;  3OC3 C;  4ID1 A;  2OPP A;  3KD5 E;  3NF9 A;  2WOM A;  1IKV A;  1SKW A;  4LY7 A;  3ZT0 A;  4CHZ A;  3B6O A;  3RRG A;  2YNH A;  3VQ6 A;  1WSJ A;  3SV4 A;  3C94 A;  1QSY A;  4KFB A;  1TKZ A;  2B4J A;  2F96 A;  2YKN A;  3AV9 A;  3ZSO A;  4FJL A;  4M3Y A;  2HHV A;  4G1Q A;  4CHO A;  3MAQ A;  3LZJ A;  2AJQ A;  3H08 A;  5FDL A;  1WN7 A;  3DLR A;  4CGJ A;  4O4G A;  4OGC A;  2GUI A;  5KGW A;  3MEE A;  4K8X A;  3OYA A;  4CHP A;  4B9T A;  3CFR A;  4Y1C A;  3UIQ A;  5CYQ A;  4CF0 A;  3NDK A;  3NBP A;  5J2P A;  3V81 A;  1TGO A;  1S6P A;  4OKK A;  1HYV A;  4K8Z A;  1C0T A;  4KRE A;  1JXB A;  3S3O A;  5KGX A;  5I3U A;  3C6T A;  4CJW A;  4M3Z A;  2KW4 A;  3TAP A;  5J2N A;  4FLX A;  1UA0 A;  3QLH A;  4EZ6 A;  4CFA A;  4WZS D;  1QSS A;  4M3X A;  1VOK A;  4HHT A;  3TAB A;  1S1T A;  1ITG A;  2JLE A;  5KI6 A;  4DF8 A;  3SUP A;  4J2B A;  4F2S A;  3DRP A;  3HPG A;  5DMR A;  1QTM A;  4ROE B;  3V4I A;  4C8L A;  4FJ8 A;  1DTT A;  3VQA A;  4FW2 A;  3VQ8 A;  4Z4H A;  4Q0B A;  2Z1H A;  1XC9 A;  2XY5 A;  3SUO A;  1JLE A;  4CIG A;  3HL8 A;  1QN6 A;  1WNS A;  1YTA A;  1YVU A;  1NOY A;  4XIU A;  3F9K A;  4KI4 A;  2KZZ A;  1UOC A;  4B9M A;  4B9N A;  3BDP A;  4KAZ A;  4ZHR A;  3AVL A;  2Z1J A;  3U6F A;  1N6Q A;  3VQP A;  4FJ9 A;  1WSI A;  3V9X A;  1KFD A;  2OZS A;  4E1N A;  4J2E A;  2NUB A;  1L3V A;  5HRN A;  2YNF A;  1QN3 A;  3DOK A;  2D0A A;  1VSI A;  4IKF A;  1BIS A;  3TAF A;  4N41 A;  5D3G A;  4CEF A;  3OYN A;  1S5J A;  1W0H A;  3HPO A;  1T7P A;  4ROC B;  4W5O A;  2X6S A;  3VA3 A;  3OYH A;  2D0B A;  3LPT A;  4DSE A;  1LW2 A;  1CLQ A;  1QTP A;  1JKH A;  2RF2 A;  4HCC A;  4DS4 A;  2A1S A;  1XWL A;  2FBY A;  2PZS A;  5KRS A;  1G15 A;  4E1M A;  3DLE A;  1SL0 A;  2X78 A;  4CF1 A;  3ZSZ A;  2I5J A;  3LAM A;  5J2Q A;  1L3U A;  3SNN A;  2BDP A;  3RR7 A;  1ZYQ A;  3T19 A;  3PX4 A;  3CG7 A;  3KD1 E;  3MXJ A;  4LD0 A;  3SQ1 A;  4FK2 A;  5IYC P;  4CJU A;  2FBV A;  4H4O A;  5CYM A;  4OPJ A;  3SJJ A;  2QKB A;  1VSL A;  3OYI A;  3L3V A;  3NH0 A;  4PA1 A;  1UAX A;  2HNY A;  2P1J A;  1JL2 A;  4CES A;  1BI4 A;  3S9H A;  4B0A A;  1KVA A;  4H8K A;  4Z0U A;  1BGX T;  3ZSQ A;  3ZCM A;  3QES A;  1NK0 A;  5FRM A;  1JFI C;  1YTF A;  4CJ5 A;  5HP1 A;  3OCI A;  4BDZ A;  1SKR A;  2MJ7 A;  4M3U A;  2GV9 A;  1HJR A;  3KIO A;  4DTO A;  3S3M A;  4CED A;  2Y1J A;  4HUE A;  4N5S A;  2VWJ A;  4DWI A;  1S9G A;  1WAJ A;  2ZE2 A;  3K59 A;  4E7L A;  4FYD A;  4NCA A;  2VJ0 A;  2BGG A;  3AVA A;  1RT5 A;  4CJR A;  1BQM A;  1RDA A;  1ASV A;  1R0A A;  4KHW A;  2YKM A;  3ZSW A;  3QEW A;  3SI6 A;  3EYZ A;  3TAN A;  4F2R A;  2RPI A;  1TKD A;  4FJN A;  4LH5 A;  4EZ9 A;  2YV0 X;  3O3H A;  2W42 A;  4C8O A;  2OZM A;  1HQE A;  4CGG A;  1HMV A;  1VSK A;  1E42 A;  5HRP A;  2XY8 A;  5DK5 A;  4MQ3 A;  3PX6 A;  1N5Y A;  1NK5 A;  3HST B;  4CEB A;  1KLN A;  4CJ3 A;  4CJE A;  4BE1 A;  3AA5 X;  1BCO A;  3VQQ A;  3OS0 A;  3U3Y A;  3THV A;  5J2M A;  2FBT A;  4CHQ A;  1RTH A;  4W5T A;  4CGF A;  1K6Y A;  2Z1I A;  1U48 A;  3OYK A;  4RW8 A;  3RMC A;  1WAF A;  2WON A;  3AVC A;  5KRT A;  1FK9 A;  1EX4 A;  4FJ5 A;  2D5R A;  3DLH A;  2DFH A;  3RWU A;  3AA4 A;  1BIU A;  4PY5 A;  1VK0 A;  1CXU A;  3AVN A;  2XHB A;  4FJK A;  4FCY A;  3ZSX A;  3OYB A;  4KHN A;  1HQU A;  1NOZ A;  3BGR A;  2P5O A;  4F8R A;  3HP9 A;  3TAM A;  1C0U A;  4M3W A;  1LWE A;  3K5O A;  2O4I A;  1QN4 A;  3VQ4 A;  4EP4 A;  3ZT2 A;  1A5X A;  4IFV A;  3D0P A;  4B9V A;  4FW1 A;  3KLH A;  1T8E A;  4B9U A;  1KFS A;  1WLJ A;  3NH1 A;  4KTZ A;  4JLH A;  3HK2 A;  3AA3 A;  1NKB A;  5JS1 A;  1GOB A;  5HRS A;  4I7F A;  3ZSV A;  4M45 A;  4CJ4 A;  1KVC A;  1C0M A;  3L2R A;  1KY6 A;  1TKT A;  2HND A;  3KLE A;  3PX0 A;  2HB5 A;  3QIP A;  1CZB A;  4FJX A;  4N76 A;  5C24 A;  4M42 A;  2G8K A;  3MXM A;  1A5W A;  1F21 A;  1J53 A;  1TGH A;  1Q8I A;  3WNH A;  3TWH A;  2ETJ A;  4IG3 A;  1Q9X A;  3KTQ A;  4E7J A;  1U04 A;  4CF2 A;  4QOZ B;  4FJJ A;  1GOA A;  3AVG A;  1TBP A;  3ULD A;  3OYE A;  4M41 A;  3CFP A;  4BDP A;  1FKO A;  2XO7 A;  1CZ9 A;  2XRI A;  1RT6 A;  1QQC A;  4DLG A;  1EP4 A;  3V1Q A;  3OJU A;  4DQQ A;  3WNF A;  3DLB A;  1RTD A;  4AIL C;  3AO5 A;  3IG1 A;  1NJX A;  4CEE A;  3VQ7 A;  3NE6 A;  3LAL A;  3HP6 A;  3LWL A;  1S1U A;  2IGI A;  4KTW A;  2DY4 A;  1BHL A;  3AVH A;  4CEC A;  1RDB A;  2XY6 A;  1KSP A;  1TK8 A;  1NJY A;  2PYJ A;  3P5J A;  4FM1 A;  2HHT A;  3HS8 A;  3DOL A;  3DM2 A;  3M8R A;  4F3O A;  4CEA A;  1RBV A;  2ITG A;  3PV8 A;  4NYF A;  4BAC A;  4C8K A;  1WSH A;  2IS3 A;  1LAV A;  4KKO A;  3DRS A;  3V9U A;  1BI4 B;  1FXX A;  3I0R A;  1X1P A;  3KKR A;  4QAG A;  1NK9 A;  1RCH A;  1LV5 A;  4BE2 A;  3QNN A;  4R5P A;  4W5N A;  1RTI A;  2YHB A;  1B9F A;  3LAK A;  5C42 A;  4CEO A;  4DQP A;  2E6M A;  4HUF A;  4KHS A;  3U3G A;  4DQI A;  4FZY A;  3A2F A;  3KLG A;  1EXQ A;  3LWM A;  1Y97 A;  3DMJ A;  4JRP A;  1KY7 A;  1TAQ A;  1RT4 A;  4FVM A;  2HNZ A;  2LSN A;  4RW9 A;  1JLG A;  1WSF A;  5I42 A;  3L2V A;  4FM2 A;  1D9D A;  2G8W A;  2HVH A;  3ZSR A;  2KTQ A;  4DU4 A;  1NKC A;  4CJK A;  4JS5 A;  2G30 A;  3PUF A;  4CGI A;  2G8H A;  4JRQ A;  2G8U A;  3HO1 A;  1TL1 A;  1SKS A;  4FK0 A;  1BIZ A;  2O4G A;  3NF8 A;  4KO0 A;  3AVM A;  2G8F A;  1RM1 A;  4B8A B;  3V1O A;  4CJT A;  4KRF A;  4E0D A;  4CK2 A;  1BQN A;  3CQ8 A;  1IKW A;  3VQC A;  3SQ2 A;  3SCX A;  3QIO A;  2G8V A;  1JLA A;  3OS1 A;  2ATQ A;  4QCL A;  2X74 A;  1KYU A;  1WSE A;  3OVN A;  4RW4 A;  3VQ9 A;  4CFD A;  4N56 A;  2KQ2 A;  1QNC A;  1IO2 A;  3TAE A;  3L3U A;  3QO9 A;  1B9D A;  5HLF A;  3WNG A;  4FJG A;  4DLE A;  3NGI A;  4B3O A;  2R7Y A;  3WNE A;  3HS9 A;  1QS4 A;  3RMA A;  2HVI A;  4LH4 A;  1I3A A;  2IV9 A;  1L3S A;  3O4N A;  1T03 A;  4CJF A;  4DFK A;  1HNV A;  1W9H A;  4FJI A;  4ELU A;  1O1W A;  3H1Z A;  4LSN A;  2PYL A;  4I2P A;  4OPK A;  5JS2 A;  3V9Z A;  4EP5 A;  3KLI A;  5EU7 A;  1D9F A;  1VSF A;  3T3F A;  1NJW A;  3LP2 A;  3VQD A;  3OYM A;  4YNQ A;  4OLB A;  4NCB A;  4OVL A;  1RBT A;  5E41 A;  4W5Q A;  4FM0 A;  1NK4 A;  2OYQ A;  3AVF A;  1YTU A;  3KKS A;  4CF8 A;  2KZM A;  5KTQ A;  4GMJ B;  3V9S A;  4AHR A;  2E4L A;  4B8C A;  3CM6 A;  4CCH A;  2HHX A;  1VSE A;  3LDS A;  1B92 A;  4O44 A;  1KTQ A;  4CGD A;  4N47 A;  1IKX A;  3SQ0 A;  2QK9 A;  4J2A A;  3CYM A;  2OPQ A;  3EIK A;  4CEZ A;  2FC0 A;  1ZBI A;  3AO2 A;  2ZD1 A;  1W80 A;  1RDC A;  1SV5 A;  1RT1 A;  2JGU A;  3E01 A;  3NFA A;  4KHQ A;  4PQU A;  4ID5 A;  4B08 A;  4PWD A;  1J9A A;  4ICL A;  5T7B A;  4E3S A;  2IOC A;  4TSX A;  3VQE A;  1RT3 A;  3ZSY A;  4UQG A;  3L2U A;  4Z4E A;  2HHS A;  1S1X A;  1VSM A;  4CHY A;  3CM5 A;  4CK3 A;  1J54 A;  3MXI A;  2QKK A;  2HW3 A;  2EX3 A;  3G0Z A;  4CHN A;  1C1B A;  4W5R A;  4DTU A;  2ZQB A;  4KHY A;  3LP1 A;  4AH9 A;  1TBA B;  1REV A;  3OY9 A;  1UA1 A;  5FRN A;  1KLM A;  2IDO A;  1JXE A;  4C8M A;  4DFM A;  1VRT A;  3SUN A;  3LP0 A;  3OJS A;  4B9L A;  2HHU A;  1QNE A;  1C1C A;  3DYA A;  4DU3 A;  2QXF A;  3ITH A;  4DSK A;  4O55 A;  1RT7 A;  1C6V A;  1VSD A;  4CJL A;  1Z25 A;  4LSL A;  4FZZ A;  1MU2 A;  5C25 A;  3K5N A;  3SYZ A;  2Z1G A;  3QNO A;  2B6A A;  2P51 A;  3MEC A;  3OYG A;  3I8D A;  1NK7 A;  4OGE A;  2BE2 A;  3HJF A;  4CEQ A;  4FJH A;  3VN5 A;  2VG6 A;  4FJ7 A;  5K14 A;  2VG5 A;  1VOL B;  4CK1 A;  1QN7 A;  4BWJ A;  1QNA A;  3OYF A;  4Z4C A;  2VG7 A;  3QEP A;  4DS5 A;  3SPY A;  4FZX C;  2F8T A;  4CE9 A;  4IFY A;  4DMN A;  3KLF A;  1KVB A;  1EKE A;  1RT2 A;  3K5M A;  3TAG A;  4OKE A;  4BWM A;  1KYF A;  3O3F A;  4KHU A;  3C95 A;  3MED A;  3PO5 A;  4CER A;  1DTQ A;  3TI0 A;  2YHA A;  1AIS A;  4AHV A;  3NF6 A;  3ZT4 A;  4CIF A;  4E89 A;  4CFC A;  3L2W A;  1SL2 A;  4DSJ A;  4FLT A;  1R4X A;  1HNI A;  3DLG A;  4AHC A;  4CFB A;  1FKP A;  4OKJ A;  3EY1 A;  4GW6 A;  3HYF A;  3V6D A;  1NJZ A;  3PO4 A;  3DLK A;  2G8I A;  4E7I A;  3QET A;  4M3R A;  3HVR A;  1ASW A;  2Y1I A;  1JLF A;  3IS9 A;  4FLZ A;  2KFN A;  1PZD A;  2OPS A;  3ISN C;  1UWB A;  3RRH A;  3O4Q A;  3AO4 A;  4Y1D A;  1WSG A;  1IH7 A;  4RW6 A;  3KK2 A;  4I2Q A;  3K5L A;  3K57 A;  3VQ5 A;  1X9M A;  1HYS A;  1NGM A;  3L2Q A;  1U49 A;  3I0S A;  1EET A;  5HRO A;  3NCI A;  4C8N A;  1IG9 A;  4HTU A;  5CZ2 A;  1QTS A;  4DG1 A;  1QHT A;  4FXD A;  3C6U A;  1KRP A;  2P5G A;  1TK5 A;  1NKE A;  4F4K A;  1ZBF A;  4Q5V A;  4FJM A;  4HVJ A;  1ZBU A;  3G10 A;  1TAU A;  1RBU A;  2RN2 A;  4BE0 A;  1QN9 A;  2HMI A;  4DSI A;  1Z26 A;  3D45 A;  4DTP A;  4GVM A;  5IYD P;  4CF9 A;  1NK6 A;  3QEX A;  1X9W A;  4KB0 A;  4CGH A;  3V1R A;  4DTS A;  2FBX A;  3KK1 A;  3HXM A;  3RR8 A;  3OYL A;  4KPY A;  2HHQ A;  4J2D A;  3TAR A;  4H4M A;  4DF4 A;  4JS4 A;  5CY4 A;  3LAN A;  4FK4 A;  1ASU A;  4OJR A;  3AVI A;  2RKI A;  1CDW A;  3P83 D;  3M8P A;  3NF7 A;  1VRU A;  3DRR A;  3L8B A;  4O0J A;  4E7H A;  3NHG A;  1KCF A;  5SWM A;  3SPZ A;  3HVT A;  2E6L A;  4DQR A;  4Z4F A;  1JLQ A;  1RBS A;  3JYT A;  5CZ1 A;  3SV3 A;  2YNG A;  3LZI A;  4AHS A;  5J1E A;  1S1W A;  1VSJ A;  3NH2 A;  3OYJ A;  3T1A A;  4HCB A;  2X6N A;  3ASM A;  3PY8 A;  1S6Q A;  2KFZ A;  4KV8 A;  3NGY A;  1BCM A;  3MEG A;  1GOC A;  1JL1 A;  1LW0 A;  1VTL E;  4DSL A;  4RW7 A;  4KB1 A;  3RMB A;  1BL3 A;  1S9E A;  4ZTF A;  1QN5 A;  1X9S A;  4FLW A;  1U47 A;  1XHZ A;  1YTB A;  3HM9 A;  4KTQ A;  3VA0 A;  3HPH A;  3ZT3 A;  3DI6 A;  4DTN A;  4ZTJ A;  3ALY A;  4Z4I A;  2DTU A;  1PCZ A;  1SL1 A;  2YNI A;  4IBN A;  2Q3S A;  3SZ2 A;  3NGZ A;  4WE1 A;  1Q9Y A;  4DFJ A;  4OLA A;  1L3T A;  1TK0 A;  1C1A A;  3AO3 A;  3QER A;  5IYB P;  1HPZ A;  1HRH A;  3TAQ A;  4PUO A;  4DSF A;  3NAE A;  3KJV A;  3LPU A;  4DTX A;  4RG8 A;  1S1V A;  1CXQ A;  1JLC A;  2PY5 A;  5HRR A;  2Z8U A;  4I9L A;  4O5B A;  1U45 A;  1RTJ A;  2EHG A;  1D3U A;  3AVB A;  2IC3 A;  1HYZ A;  4FLY A;  3M8S A;  3QEV A;  1U4B A;  4I9Q A;  4L8R B;  3SUQ A;  1TKX A;  3V9W A;  3VQB A;  1IKY A;  2GBZ A;  1ZBH A;  4FLV A;  1LWC A;  1KYD A;  3HT3 A;  4BDY A;  3AA2 A;  2VWK A;  4AHT A;  3P1G A;  3O3G A;  3AVJ A;  3K58 A;  1SUQ A;  1LWF A;  3ZT1 A;  1YT3 A;  4DTR A;  2IAJ A;  2D0C A;  4DFP A;  2DFF A;  2F8S A;  4E7K A;  1XHX A;  1MP9 A;  3LP3 A;  3QIN A;  4E19 A;  3S3N A;  1XI1 A;  2OA8 A;  1VSH A;  3AVK A;  1TV6 A;  4HUG A;  3IAY A;  1NVP A;  2IV8 A;  3TR8 A;  4F3T A;  1J5O A;  1RBR A;  3RMD A;  1D8Y A;  3JSM A;  4NYN A;  3OYD A;  1T05 A;  4NCG A;  4ELT A;  3FFI A;  1DLO A;  3K2P A;  4AHU A;  3F73 A; 
#chains in the Genus database with same CATH topology
 4ROD B;  4DTM A;  3HO1 A;  3KK3 A;  1NK8 A;  4IDK A;  4CJS A;  1CZA N;  3FR0 A;  4DU1 A;  1LAW A;  2B5J A;  3SQ4 A;  2WTU A;  4CW7 B;  3JXU A;  1U2V A;  4HTL A;  3OH6 A;  3M8Q A;  1ATN A;  3CJ9 A;  3MWP A;  3BP8 A;  2HHW A;  2P9I B;  4JI7 K;  3OS2 A;  1NH2 A;  4JI5 K;  1QE1 A;  4JHD B;  3IRX A;  3VES A;  4CJV A;  4B1W B;  1EWQ A;  3HTV A;  1SKW A;  3B6O A;  1QVF M;  4IEI A;  4GV6 A;  2FF3 B;  4M3Y A;  3ZSO A;  3AV9 A;  1Q7Y O;  4DV6 K;  3THX A;  4GV3 A;  1M3H A;  2NOL A;  3CWT A;  4LF5 K;  4GVE A;  4Y1C A;  3V81 A;  1S6P A;  4K8Z A;  3S3O A;  3CHW A;  3TAP A;  4FLX A;  3QLH A;  2FKF A;  4C23 A;  4CFA A;  1QSS A;  3TAB A;  3OGD A;  2F9W A;  1ITG A;  2JLE A;  4KH5 A;  5KI6 A;  4DF8 A;  4F2S A;  3DRP A;  1E4F T;  4TPS A;  4Z94 A;  4DKW A;  4C8L A;  3VQA A;  4FW2 A;  2NRV A;  5ADX A;  3BF3 A;  5AQP A;  4CIG A;  4B3S K;  1WNS A;  1NOY A;  3QML A;  4MDB A;  3F9K A;  4KI4 A;  3TTC A;  3VGL A;  1N6Q A;  2ZGY A;  3VQP A;  3ULE A;  1WSI A;  4YOX A;  2UU9 K;  2NUB A;  2YNF A;  5AFU H;  4M7Y A;  5D3G A;  2QM1 A;  2ITM A;  2O8D A;  4DSE A;  4W5O A;  2X6S A;  4O5F A;  2NZT A;  1CLQ A;  1JKH A;  2P9U B;  3BUZ B;  2A1S A;  2Q0R A;  3CF5 L;  2PZS A;  3SK3 A;  3CWS A;  3THW B;  1SL0 A;  4CBX A;  4BRL A;  3IFR A;  3ZSZ A;  5J2Q A;  3LAM A;  2RHK A;  1KAX A;  3VTI A;  5CYM A;  3WUH A;  1IBK K;  3OYI A;  3M1F A;  3RSE A;  5H1S Q;  2HNY A;  4CES A;  3S9H A;  2NRT A;  1KVA A;  4H8K A;  1NK0 A;  4WQ5 C;  3ZCM A;  4BR7 A;  3FZM A;  4IO9 L;  1U2V B;  4LF6 K;  4M3U A;  4B1X B;  2NOF A;  2VWB A;  2V7Y A;  4HUE A;  3THY B;  3GDQ A;  4BRK A;  2IVO A;  2ZE2 A;  4E7L A;  4GY2 B;  2BGG A;  4CJR A;  1RT5 A;  1N8R O;  1BWF O;  3EYZ A;  3EO3 A;  4FJN A;  4IWV A;  4PHT X;  3H1V X;  2YV0 X;  2OZM A;  1DKG D;  1HQE A;  5GAD P;  1SQK A;  4HWI A;  5HRP A;  5DK5 A;  3VTH A;  4MQ3 A;  1KO9 A;  2GX9 A;  3IUC A;  4CEB A;  4CJ3 A;  1HUX A;  3ENH A;  4BE1 A;  1BCO A;  3OS0 A;  3U3Y A;  3THV A;  4CBU A;  1U48 A;  3RMC A;  3D4V A;  2WON A;  2NWV A;  1WJW A;  3PIO L;  2D5R A;  2DFH A;  2HST A;  4EAK A;  1BIU A;  1VK0 A;  3AVN A;  4FJK A;  2IVN A;  4EJZ A;  4OPA A;  4J8F A;  3BGR A;  4K42 A;  4H0X B;  4AQY K;  1LWE A;  4V19 S;  4B1U B;  2O4I A;  3ZT2 A;  4IFV A;  3ZX0 A;  4DUL A;  4JAX A;  5M1K A;  1T8E A;  3K0S A;  1WLJ A;  3AA3 A;  5HRS A;  4CVN E;  4H0T B;  3SBG A;  3PX0 A;  1YAG A;  1KY6 A;  1TKT A;  4WQ5 A;  2O8E A;  4M42 A;  2G8K A;  3ULE B;  1Q9X A;  1TGH A;  3WNH A;  4QOZ B;  2VCP A;  1TBP A;  2IIR A;  5JIC A;  1RGI A;  3OYE A;  4M41 A;  3WQU A;  1GLB G;  1TYQ A;  1RT6 A;  2O8D B;  1NMN A;  2LAE A;  3AO5 A;  4DV5 K;  3NE6 A;  3LAL A;  3PIP L;  1S1U A;  3VOV A;  3C65 A;  1BHL A;  1TUY A;  3LDP A;  3DOL A;  3M8R A;  3WXL A;  1W2B M;  4BAC A;  3DRS A;  4OX9 K;  3OST A;  1T44 A;  4CZH A;  1NK9 A;  4R5P A;  3CWU A;  2WBN A;  2E6M A;  3A5O C;  4DQI A;  3KLG A;  3UKR A;  4JRP A;  1TAQ A;  2W41 A;  1RT4 A;  4K0K K;  4CBW A;  3FZK A;  3L2V A;  5AQL A;  4FWM A;  5AJ3 K;  4JKG A;  2G30 A;  4CGI A;  2G8H A;  4JRQ A;  1SKS A;  4H5T A;  3KZB A;  3AVM A;  3EL2 A;  4CJT A;  2V52 B;  3W0L A;  4KRF A;  4AM6 A;  1BQN A;  3SCX A;  4WF9 L;  1JLA A;  5AQZ A;  2X74 A;  3LL3 A;  4N56 A;  1HNZ K;  4LFA K;  2KQ2 A;  1QNC A;  2VGM A;  4B3O A;  3CCU N;  4ILH A;  1NNE A;  4LH4 A;  4YY3 K;  4DFK A;  4FJI A;  1O1W A;  2Q0U A;  2YHY A;  5CE3 A;  4EP5 A;  1HJO A;  5EU7 A;  4JI8 K;  1T6A A;  1NJW A;  5AN4 A;  2HF3 A;  2ZWH A;  4OLB A;  4AM7 A;  4F9O A;  4FPB A;  5MLC Q;  3CMA N;  3MDQ A;  3KKS A;  3CXC M;  2KZM A;  5M1F A;  4AHR A;  4B1Z A;  3CM6 A;  1VSE A;  2O8E B;  2HL8 A;  2ZJR L;  4O44 A;  3MMV A;  1MA9 B;  3SQ0 A;  4CEZ A;  2FC0 A;  4C1N K;  2JPI A;  4CZM A;  4B08 A;  4FWK A;  5LMN K;  4ICL A;  5T7B A;  4UQG A;  1RT3 A;  4YOU A;  1QZ6 A;  5C2D A;  2HHS A;  3MK6 A;  2EX3 A;  2YA3 A;  1N36 K;  1REV A;  3OY9 A;  2DKC A;  1KLM A;  2IDO A;  4WQ4 C;  1VRT A;  3RSM A;  2P9L A;  3RPJ A;  4KH6 A;  3DWL A;  2HBJ A;  2HL9 A;  3DYA A;  3ITH A;  4BQZ A;  4BRH A;  4DU3 A;  4DSK A;  3D2F B;  4LSL A;  1MU2 A;  5CR4 A;  3SBT A;  3QNO A;  5TKY A;  4EAL A;  3HJF A;  5DM6 L;  3Q7C A;  5K14 A;  2VG5 A;  3ZX2 A;  3UKR B;  5C15 A;  2F4V K;  1NGD A;  1JCE A;  3QEP A;  2E1Y A;  3SPY A;  3MN7 A;  3R3L A;  3M5R A;  4IFY A;  1SZ2 A;  3TAG A;  4OKE A;  4A59 A;  4KHU A;  3ZET A;  2Q97 A;  3TI0 A;  2W40 A;  1AIS A;  4JKF A;  3L2W A;  3KTU A;  3G25 A;  4FLT A;  1VQM N;  5ADX H;  2UUB K;  1NJZ A;  4OKJ A;  3DPT A;  4BRE A;  4GW6 A;  2G8I A;  3O80 A;  3QET A;  2WUS A;  1JLF A;  3IS9 A;  2NOH A;  3ISN C;  1UWB A;  3QFU A;  4N76 A;  3VQ5 A;  3MCA B;  1VQN N;  5AQM A;  1C47 A;  1NGM A;  3Q7B A;  1I94 K;  4HTU A;  2ZGZ A;  4FXD A;  3TTF A;  1NKE A;  1VQ5 N;  4JK7 A;  1ZBU A;  3PMG A;  1P5D X;  4WQ4 A;  1Z26 A;  2A42 A;  4DTP A;  1W7A A;  1NK6 A;  3QEX A;  4CGH A;  1BA1 A;  4DTS A;  3DJC A;  4H4M A;  1EQY A;  4PL8 A;  4OJR A;  1MPG A;  1VRU A;  2R5X A;  1KCF A;  4PKI A;  3HVT A;  4DQR A;  1JLQ A;  3JYT A;  5CZ1 A;  3SV3 A;  3CC2 N;  2YNG A;  3LZI A;  5J1E A;  3EKU A;  1VSJ A;  3OYJ A;  4HCB A;  1ESV A;  3A5M C;  1YIJ N;  1M3Q A;  4A2B A;  1BCM A;  4GNI A;  1GOC A;  1JL1 A;  1LW0 A;  1OH5 A;  4KB1 A;  1X3M A;  1QN5 A;  3KK7 A;  4DV2 K;  1YTB A;  3HPH A;  4DTN A;  3O9U A;  3HOT A;  4WE1 A;  4CI6 A;  1N39 A;  3PLA A;  4DSF A;  3NAE A;  1CXQ A;  1VQP N;  2Z8U A;  4DR5 K;  1U45 A;  4M63 C;  3DXM B;  3V9W A;  3VQB A;  5LJV A;  1KFQ A;  1GLL O;  3G71 N;  4AHT A;  4FWN A;  3ZT1 A;  3ZET B;  2D0C A;  4DFP A;  3U8X A;  1XHX A;  3QIN A;  4BG8 A;  3VEV A;  1TV6 A;  4D7Q A;  2NRH A;  2O8F A;  2GEL A;  1RBR A;  3JSM A;  2VGN A;  1IBM K;  3FLC O;  4ELT A;  3EE9 A;  4FWO A;  3HZ6 A;  4CIE A;  4A5A A;  1QSL A;  1UL7 A;  3VER A;  3AO1 A;  2KKZ A;  4X65 K;  2BAN A;  5FRO A;  1KFI A;  3HOS A;  5M1N A;  3CFO A;  1YIT N;  2H4L X;  1RIL A;  4JKA A;  1JLB A;  2HHH K;  4X62 K;  3B6P A;  3EZ5 A;  4FLU A;  3KVG A;  4KI6 A;  3VEO A;  2NOI A;  1X3N A;  1D5A A;  3VEY A;  4MFB A;  3NMU A;  5SZT A;  2Q2R A;  4IXC A;  1C9B B;  3IDH A;  3RTV A;  3OC3 C;  2OPP A;  3KD5 E;  4H0V B;  5A2Q O;  2WOM A;  3MN6 A;  2GWJ A;  3ID8 A;  4JKH A;  4FPA A;  4LY7 A;  4CHZ A;  5JLF A;  1WSJ A;  1TKZ A;  2B4J A;  1XQS C;  4G1Q A;  4YDU C;  3ENB A;  3LZJ A;  2JOI A;  3WXM B;  1QQN A;  4FWP A;  2HZS A;  4I6M B;  4OGC A;  4K8X A;  2P9P A;  2BH1 A;  5E26 A;  3CFR A;  3UIQ A;  5CYQ A;  1TGO A;  1XNR K;  4AF1 A;  3ZEU A;  2OOX A;  4CJW A;  2KW4 A;  3L0Q A;  1BG3 A;  4WZS D;  1NMD A;  2QLV A;  4EIA A;  4HHT A;  3N89 A;  1IJJ A;  1QTM A;  4ROE B;  4U7B A;  1YJW N;  2OTJ N;  2ZJP L;  3ATU A;  2Z1H A;  2V9J A;  1XUP O;  2VQF K;  4WCE L;  1YVU A;  1NGB A;  4BC2 A;  5LJW A;  4XIU A;  3UKU A;  4KAZ A;  4ZHR A;  1K8K A;  3U6F A;  2WFB A;  3V9X A;  3TTD A;  4J2E A;  1QN3 A;  3CCM N;  1VSI A;  2FGT A;  4CEF A;  4DR4 K;  1W0H A;  1T7P A;  1GLC G;  2YHW A;  2YI1 A;  4JEP A;  1LW2 A;  3KWI A;  4B1V A;  1XWL A;  1G15 A;  5AQH A;  5F2R A;  2O8F B;  3DLE A;  2P9N A;  2I5J A;  3SNN A;  1GLD G;  2Y8Q A;  3T19 A;  4H03 B;  2Q31 A;  3C04 A;  2WC9 A;  4YDU A;  4FK2 A;  4CJU A;  5M1Q A;  1HKB A;  1RFQ A;  5LY3 A;  1N3C A;  1UAX A;  2FSK A;  4PA1 A;  2F8S A;  1JL2 A;  4GKK K;  5FRM A;  5DM7 L;  1BGX T;  3ZSQ A;  2CH6 A;  3U9Z A;  1HJR A;  3KIO A;  1E4G T;  2Q36 A;  1LWY A;  1QZ5 A;  2Y1J A;  1JCF A;  2VWJ A;  4DWI A;  2BTF A;  4FOE A;  1O13 A;  4IEE A;  3T1Y K;  4NCA A;  2VJ0 A;  3L4I A;  3EEQ A;  4PKH A;  3FGU A;  2YKM A;  3SI6 A;  1EWR A;  1TKD A;  1YQR A;  1NU0 A;  4LH5 A;  4CFF A;  3PX6 A;  1NK5 A;  3JS6 A;  3JAM O;  3SAF A;  3TU5 A;  1DIZ A;  1NGI A;  1RTH A;  4CZG A;  4FWQ A;  2P9P B;  3OYK A;  1FK9 A;  1RDU A;  2P9S A;  3DLH A;  2E20 A;  2NRX A;  3ZEU B;  4BRC A;  1CXU A;  3J7A P;  3O1B A;  3HBT A;  1M90 O;  3TAM A;  1JCG A;  3K5O A;  1MWK A;  2AP1 A;  1K73 O;  4B9U A;  3DPU A;  3A5N C;  1KFS A;  1NKB A;  1GOB A;  4I7F A;  3ZSV A;  1KVC A;  5I9E B;  2HND A;  4MRQ A;  1CZB A;  3UKU B;  4FJX A;  1QVG M;  1F21 A;  1Q8I A;  3I56 N;  3TWH A;  3OH9 A;  4IG3 A;  1BOT O;  4CF2 A;  3ULD A;  1OH6 A;  3AAR A;  3ZX3 A;  2OOY A;  4NXM K;  2XRI A;  1XC3 A;  1QQC A;  1EP4 A;  4XH5 A;  5F9C A;  1RTD A;  1NGF A;  3VQ7 A;  2P9N B;  2IVP A;  3F10 A;  4KTW A;  1LWW A;  2O3O A;  4NB4 A;  1NJY A;  3CPE A;  3P5J A;  4IZ9 A;  4FM1 A;  4F3O A;  4EHU A;  3TE5 A;  4NYF A;  1WSH A;  1LAV A;  4KKO A;  1PCM X;  3V9U A;  1FXX A;  3I0R A;  1LV5 A;  3QNN A;  3D6R A;  3LAK A;  5C42 A;  5BR9 A;  4BRA A;  5FPE A;  4HUF A;  4NXN K;  5M1O A;  3TSP A;  4CZI A;  2HNZ A;  4DR6 K;  2ASM A;  5I42 A;  2KTQ A;  4DU4 A;  4R79 A;  1TL1 A;  1LXT A;  2G8F A;  3ENO A;  3V1O A;  4B3R K;  2G8V A;  1XNQ K;  3OS1 A;  2ATQ A;  4FSV A;  5LMU K;  5KPZ A;  4CFD A;  3TAE A;  1NGG A;  5HLF A;  3QO9 A;  1B9D A;  5EOY A;  2A6A A;  2R7Y A;  4BC4 A;  3HS9 A;  3B8A X;  3RMA A;  2IV9 A;  1L3S A;  3O4N A;  1J5E K;  1W9H A;  3I55 N;  2PYL A;  4OPK A;  5JS2 A;  1T6D A;  3V9Z A;  3R8E A;  1K35 A;  3T3F A;  4CZJ A;  3LP2 A;  3VQD A;  4OVL A;  1BUP A;  1RBT A;  3MX5 A;  5E41 A;  4X66 K;  4W5Q A;  4QS7 A;  4CF8 A;  5KTQ A;  2NRR A;  1XSZ A;  3J8A A;  2E4L A;  1WBD A;  2HHX A;  1B92 A;  1KTQ A;  4CGD A;  4N47 A;  3THX B;  2QTD A;  3EIK A;  1QQM A;  3AO2 A;  2ZD1 A;  4YOW A;  1SV5 A;  1R59 O;  1J9A A;  3U4L A;  2IOC A;  1S1X A;  1PCJ X;  1VSM A;  2QKK A;  1J54 A;  3MXI A;  3G0Z A;  4AH9 A;  1TBA B;  1UA1 A;  3OLP A;  4DUY K;  4DFM A;  4B9L A;  4CD1 A;  5KPR A;  4H0O A;  3QFP A;  1J6Z A;  1RT7 A;  4JI3 K;  1HKG A;  3M6G A;  3ULX A;  2QXL A;  1EO1 A;  1QHA A;  3I8D A;  4OGE A;  4CEQ A;  3OBW A;  1K2Y X;  2VG6 A;  3AY9 A;  1VOL B;  4BWJ A;  1QNA A;  4ISG A;  2DKA A;  5M1P A;  4CE9 A;  4DMN A;  4NLC A;  3RVC A;  4CZF A;  3K5M A;  5FPN A;  4BWM A;  1KYF A;  3O3F A;  4RCH A;  4CER A;  1DTQ A;  4AHV A;  3ZT4 A;  4CIF A;  3UE5 A;  1UT4 A;  1SL2 A;  4IOC L;  1HNI A;  4AHC A;  3CJ1 A;  4CFB A;  1DT9 A;  3PO4 A;  3DLK A;  4E7I A;  2KFN A;  3ZYY X;  4WXA A;  2OPS A;  3RSE B;  3O4Q A;  4DQS A;  3KK2 A;  1IH7 A;  3K57 A;  2PWW A;  4I2Q A;  3UW2 A;  2AA4 A;  5HRO A;  4C8N A;  3OTO K;  1IG9 A;  2QEX N;  4NO7 A;  4DG1 A;  1QHT A;  3VF6 A;  4F4K A;  4M7X A;  3G10 A;  4KHP K;  1QN9 A;  2Q1N A;  4JN4 A;  2QWR A;  2QRE A;  5AQQ A;  5ELZ A;  5AQU A;  5EY4 A;  1X9W A;  2GUP A;  4BR0 A;  1ZXO A;  3RR8 A;  4KPY A;  2HHQ A;  3IH7 A;  4OO1 J;  3HRG A;  3NF7 A;  4BRM A;  3DRR A;  4O0J A;  4E7H A;  2D4W A;  5SWM A;  3SPZ A;  2E6L A;  4DV4 K;  3PSI A;  2V51 B;  4B3T K;  3T1A A;  4MDA A;  3ASM A;  4KV8 A;  3NGY A;  3F0Z A;  1YJ9 N;  3VET A;  4ZTF A;  1S72 N;  3HM9 A;  2DPN A;  1G99 A;  2ZFD B;  4H0P A;  4ZTJ A;  2DTU A;  4BVP A;  4BQL A;  3H46 O;  3SZ2 A;  1SL1 A;  2FF6 A;  1L3T A;  1C1A A;  1HPZ A;  3KJV A;  3LPU A;  4O5B A;  4FLY A;  2QR1 A;  3AVB A;  2IC3 A;  3NA5 A;  2QRC A;  5FPM A;  4A5B A;  3SUQ A;  1TKX A;  2NRZ A;  4JKB A;  4A2A A;  2QA4 N;  1TYQ B;  4IJN A;  1LWC A;  4ISF A;  3CER A;  4QS9 A;  4G9Z A;  3HT3 A;  3AA2 A;  2VWK A;  3P1G A;  3O3G A;  3AVJ A;  5GAG P;  1YT3 A;  2IAJ A;  4IO8 A;  2E2N A;  4BJU A;  3LP3 A;  4E19 A;  3T69 A;  1V5S A;  3AVK A;  4HUG A;  3IAY A;  1NVP A;  1KAY A;  3TR8 A;  4BC5 A;  4F3T A;  3H1Q A;  1P90 A;  1N34 K;  3FZF A;  1T05 A;  3SNS A;  3ZLJ A;  1NJI O;  1A5V A;  5HBM A;  4FL9 A;  1RDD A;  3E66 A;  2E2P A;  1TVR A;  4CJQ A;  4H0Y B;  3QEI A;  4JI4 K;  4IG0 A;  4QS8 A;  2A1R A;  3H45 C;  2PFU A;  1TL3 A;  4Z4G A;  5AQV A;  1JDY A;  4YFU A;  3IMX A;  4ELV A;  3VPZ A;  3K9J A;  4JKG B;  1B9K A;  2J4R A;  4BY9 C;  5KQD A;  3OHR A;  2NRW A;  1T6C A;  3ZT0 A;  3VGK A;  4K41 A;  1VQ7 N;  3A8Y A;  3EAY A;  3RRG A;  3H3N O;  3VQ6 A;  3SV4 A;  1QSY A;  4KFB A;  5C0Y A;  3EKS A;  5EX5 A;  2YKN A;  1FN7 A;  4CHO A;  3MAQ A;  4GV9 A;  2AJQ A;  3H08 A;  5FDL A;  3DLR A;  3W3D A;  4CGJ A;  3LM2 A;  4O4G A;  2EHB D;  2GUI A;  1N3A A;  1YJN N;  4B9T A;  1GLF O;  3ATV A;  3NBP A;  5J2P A;  4OKK A;  4DV1 K;  1JXB A;  5I3U A;  3C6T A;  3E1Y A;  5J2N A;  4EZ6 A;  4JI6 K;  1HU0 A;  2FUV A;  1S1T A;  2A5X A;  3O9T A;  4O8K A;  3SAG A;  5AQX A;  2QWO A;  2FXU A;  3HPG A;  5DMR A;  3V4I A;  4FJ8 A;  1DTT A;  2FLO A;  1XC9 A;  4BR9 A;  1JLE A;  3HL8 A;  1YTA A;  2GEM A;  2KZZ A;  1UOC A;  4B9M A;  4B9N A;  4A61 A;  3AVL A;  3F2K A;  1KFD A;  5KL0 A;  4BRO A;  4DR2 K;  3HSC A;  1OH8 A;  5HRN A;  4NLB A;  1MDU B;  3DOK A;  3J81 O;  2D0A A;  4IKF A;  4N41 A;  3FE1 A;  3OYN A;  1VQ8 N;  1S5J A;  1SS6 A;  3DAW A;  3HPO A;  4EAG A;  4IL8 A;  3OYH A;  2D0B A;  1QTP A;  3O9R A;  4HCC A;  5BN8 A;  5GAH P;  5KRS A;  4E1M A;  3O8M A;  4CF1 A;  1L3U A;  3RR7 A;  1PVS A;  2P9L B;  3MXJ A;  4LD0 A;  3SQ1 A;  5IYC P;  2FBV A;  4H4O A;  5FPD A;  1VSL A;  3L3V A;  5AQS A;  1BA0 A;  4H5N A;  2QWP A;  1BI4 A;  3KRM A;  4Z0U A;  4CJ5 A;  3OCI A;  4BDZ A;  2MJ7 A;  3J7Y P;  2GV9 A;  4N5S A;  1WAJ A;  4FYD A;  4EJY A;  3AVA A;  1KQS M;  1C0F A;  4YOR A;  1RDA A;  4LFB K;  1R0A A;  4KHW A;  3QEW A;  3FFK B;  2RPI A;  4LF8 K;  2W42 A;  4CGG A;  1HMV A;  1VSK A;  2ZJQ L;  3I8B A;  1Q86 O;  1N5Y A;  3D2E A;  1KLN A;  4CJE A;  3VQQ A;  2O8C A;  5J2M A;  2FBT A;  4W5T A;  5JMV D;  4CGF A;  5BRD A;  5KPT A;  1TUO A;  2E8A A;  1WAF A;  4WFA L;  3AVC A;  4CZK A;  4FJ5 A;  2QI2 A;  3NVK A;  3OA9 A;  3GOI A;  2YCH A;  4DUZ K;  1IG8 A;  4H5V A;  4PY5 A;  1S22 A;  3P39 A;  2XHB A;  4FCY A;  1VQ6 N;  3ZSX A;  3OYB A;  2MZ8 A;  2UYT A;  4KHN A;  2P5O A;  5AZI A;  1C0U A;  3VQ4 A;  4EP4 A;  3D0P A;  1A5X A;  4H5W A;  4BRF A;  4FW1 A;  3KLH A;  3NH1 A;  4JLH A;  3HK2 A;  4CJ4 A;  4XH4 A;  5JMV A;  2QWL A;  1C0M A;  3KLE A;  2HB5 A;  1V4T A;  3QIP A;  5C24 A;  1NWK A;  3MXM A;  1A5W A;  1J53 A;  1V4S A;  3KTQ A;  3QBW A;  4E7J A;  4FJJ A;  3AVG A;  5BRH A;  3WXK A;  3GG4 A;  2XO7 A;  4DLG A;  3DLB A;  5AZJ A;  1W97 L;  4YOV A;  3WT0 A;  1BDG A;  4CEE A;  3BF1 A;  1VQ9 N;  2E5L K;  3CCE N;  3HP6 A;  1OH7 A;  3C0B A;  3LWL A;  2IGI A;  4Q11 A;  2HKP A;  4JKC A;  2DY4 A;  4OPH A;  3SMP A;  4CEC A;  1RDB A;  2XY6 A;  1KSP A;  2HMP A;  5JVH L;  4BGB A;  3DM2 A;  4CEA A;  1RBV A;  3PV8 A;  3E9L A;  2IS3 A;  4MLH A;  1BI4 B;  3N4Q A;  1TUU A;  3KKR A;  4W5N A;  2YHB A;  1B9F A;  3SMS A;  2FKM X;  4CEO A;  4DQP A;  4BG9 A;  3WXI A;  3DMJ A;  1KY7 A;  2P9I A;  5JVG L;  1DEJ A;  3CCS N;  4FVM A;  3O1W A;  4KH4 A;  2LSN A;  5AR0 A;  1JLG A;  1WSF A;  2A3Z A;  2HVH A;  1NKC A;  5FLX O;  4JS5 A;  3PUF A;  3C6H A;  5HL7 L;  1BIZ A;  3NF8 A;  4KO0 A;  3E9O A;  3QB0 A;  4B8A B;  4DCH A;  3D2E B;  3SQ2 A;  3CQ8 A;  2V92 A;  3QIO A;  3IKM A;  2O8C B;  3CC4 N;  1HX1 A;  1BU6 O;  4QCL A;  3CCJ N;  3VQ9 A;  5BPL A;  4JI2 K;  3L3U A;  3WNG A;  4DLE A;  3NGI A;  2ZF5 O;  4DR7 K;  4JYA K;  5GIO A;  2HVI A;  1I3A A;  1ZC6 A;  5C2F A;  3AAQ A;  1T03 A;  2QW9 A;  3H1Z A;  1OVY A;  3DLL L;  3KLI A;  1DGK N;  1WBB A;  3S41 A;  3OYM A;  1UT7 A;  4YNQ A;  1MWM A;  4FM0 A;  3CCR N;  1FJG K;  3LDL A;  5AQO A;  2OYQ A;  3AVF A;  3BKQ X;  4BRN A;  4GMJ B;  1IV0 A;  4K25 A;  3CCQ N;  3VEX A;  5AQI A;  2QK9 A;  3CYM A;  3U9D A;  4CZL A;  4YHH K;  2H3G X;  1W80 A;  3E01 A;  2YX6 A;  3G4S N;  4CZE A;  4KHQ A;  4PWD A;  3DXK A;  5AZJ B;  4C8O A;  4E3S A;  4TSX A;  3ZSY A;  3L2U A;  3P38 A;  1H1V A;  2HW3 A;  3MX2 A;  4DTU A;  4W5R A;  2P9U A;  3LP1 A;  4EAI A;  5FRN A;  1JXE A;  4IJA A;  4C8M A;  2QRD A;  1C0G A;  3LP0 A;  5IT9 O;  4XEI A;  1LWV A;  1QNE A;  1C1C A;  2CGL A;  2QXF A;  5E84 A;  4O55 A;  1VSD A;  4CJL A;  4FZZ A;  5C25 A;  5AQT A;  3D7E O;  3SYZ A;  2Z1G A;  3ENO C;  2P51 A;  3MEC A;  4B9Q A;  3OYG A;  2NNW A;  1NK7 A;  3T7Z A;  1K8K B;  3VF2 A;  1JJ2 M;  4BR2 A;  1NLV A;  3THY A;  4Z4C A;  4DR1 K;  2F8T A;  1EKE A;  1RT2 A;  4IOA L;  1OKJ A;  3PO5 A;  4C1N I;  3NF6 A;  4E89 A;  1HNX K;  3CC7 N;  4DSJ A;  2HZM A;  1YI2 N;  3H6E A;  5AQY A;  3DLG A;  4FWL A;  1FKP A;  3EY1 A;  3V6D A;  1E3M A;  4M3R A;  3HVR A;  1ASW A;  4FLZ A;  3I0W A;  3K5L A;  3AO4 A;  3R9P A;  1WSG A;  2KHO A;  2HOE A;  1X9M A;  1HYS A;  3HI0 A;  3WXJ A;  4B1Y B;  2GTD A;  3O4W A;  3NCI A;  1QTS A;  3C6U A;  3EN9 A;  4MLE A;  2P5G A;  1TK5 A;  3VF4 A;  3BY5 A;  3MN9 A;  4Q5V A;  1TAU A;  4HVJ A;  1YXQ A;  1RBU A;  2P9K A;  4BE0 A;  2HMI A;  5IYD P;  2I7P A;  4YOY A;  4CF9 A;  3CME N;  3BZC A;  4KB0 A;  2FBX A;  3C6A A;  3HXM A;  4LF4 K;  3OYL A;  4J2D A;  3TAR A;  4JS4 A;  5CY4 A;  2I7N A;  3LAN A;  4FK4 A;  1ASU A;  4ILG B;  3A0I X;  3AVI A;  2RKI A;  1CDW A;  3P83 D;  2F7T A;  3L8B A;  4O8U A;  1NGJ A;  3CJA A;  1RBS A;  2OCE A;  1YHQ N;  3DXK B;  4AHS A;  1VQK N;  1S1W A;  3P31 A;  2CH5 A;  2P9S B;  3PY8 A;  2ASO A;  3MEG A;  1SAZ A;  1VTL E;  4RW7 A;  3RMB A;  1BL3 A;  1S9E A;  1X9S A;  4FLW A;  2V8Q A;  3AGK A;  1U47 A;  3ZT3 A;  3AGR A;  3DI6 A;  3F5T A;  3ALY A;  4IBN A;  3GL1 A;  3NGZ A;  3CQX A;  1Q9Y A;  2HBM A;  5F1X A;  1TK0 A;  3QER A;  1HRH A;  3TAQ A;  3D7Q A;  3O08 A;  4DTX A;  4BRG A;  1S1V A;  1JLC A;  2QWN A;  1P5G X;  3T1H K;  4I9L A;  1K9M O;  1RTJ A;  2EHG A;  1D3U A;  2V7Z A;  3GE1 A;  1HYZ A;  4YOT A;  3M8S A;  4L8R B;  1HR0 K;  5AQN A;  4BVO A;  1QQO A;  4PKG A;  3L4Q A;  3OW2 M;  4UY8 O;  1C4G A;  3CET A;  4BDY A;  2NLV A;  1SUQ A;  4JKE A;  3T4N A;  5B8H A;  4DTR A;  2DFF A;  3S3N A;  1GLA G;  1D8Y A;  3KWG A;  4NYN A;  3OYD A;  3K9K A;  5BN9 A;  3K2P A;  4AHU A;  3WQT A;  4FJH A;  3F73 A;  1QNB A;  1ZBL A;  1YF5 L;  4A57 A;  4LF7 K;  2NOZ A;  2OAN A;  4L3Q A;  1QN8 A;  4U67 L;  1RNH A;  4O0I A;  2XY7 A;  4DTJ A;  2P9K B;  4CJP A;  4BR5 A;  2OPR A;  4ISE A;  3OYC A;  1VTO A;  4B9S A;  1HPM A;  2DFE A;  1I39 A;  4EAH D;  4M3T A;  3TPQ A;  1L5U A;  4ID1 A;  2XHI A;  3NF9 A;  3O6W A;  1K8A O;  2Z0F A;  4LF9 K;  1IKV A;  4I8O A;  3SLC A;  2YNH A;  3TDH A;  1J3M A;  1EUV A;  3C94 A;  4FJL A;  2F96 A;  2H5A X;  2HHV A;  1VAZ A;  1M1K O;  1WN7 A;  4K43 A;  5KGW A;  3MEE A;  3OYA A;  4CHP A;  4CF0 A;  3NDK A;  3I3W A;  4A62 A;  4DV0 K;  1HYV A;  4KRE A;  1C0T A;  2NLX A;  1NG9 A;  4H5R A;  5KGX A;  4M3Z A;  3LM9 A;  1UA0 A;  4BRD A;  4M3X A;  1VOK A;  2OTL N;  3SUP A;  4J2B A;  2DKD A;  4FO0 A;  4BRI A;  2Y8L A;  3I33 A;  3VQ8 A;  3D2F A;  4Z4H A;  4Q0B A;  2XY5 A;  3SUO A;  1NBW A;  3J80 O;  2JWK A;  1QN6 A;  2NOB A;  3CVT A;  3BDP A;  4FJ9 A;  2Z1J A;  2VYP A;  1NGC A;  2OZS A;  2YH5 A;  4EAJ A;  4E1N A;  1L3V A;  4QG5 A;  2JHN A;  1BIS A;  1ATS A;  3TAF A;  3BZK A;  3GBT A;  5HOO A;  4ROC B;  4XH1 A;  3VA3 A;  1BO5 O;  3LPT A;  4KBO A;  2PAV A;  5AQG A;  2RF2 A;  3CPW M;  5BR8 K;  4DS4 A;  4B3M K;  1EBM A;  2FBY A;  1NGA A;  3CCV N;  4DV3 K;  2X78 A;  2BDP A;  2YJF A;  1ZYQ A;  3PX4 A;  3CG7 A;  3KD1 E;  4OPJ A;  3SJJ A;  2QKB A;  3NH0 A;  2P1J A;  4EZ9 A;  2W6K A;  4B0A A;  4D7R A;  3QES A;  1JFI C;  1YTF A;  5HP1 A;  1SKR A;  3S3M A;  3MCP A;  4DTO A;  4IDH A;  4CED A;  3L6Q A;  5HSH A;  1FW6 A;  1S9G A;  3K59 A;  5JLH A;  2I5W A;  3P4I A;  1BQM A;  1YUW A;  1ASV A;  3ZSW A;  3TAN A;  4F2R A;  3CCL N;  4JNE A;  3O3H A;  5GIP A;  1E42 A;  2XY8 A;  4JI1 K;  5GIN A;  3CWA A;  1ATR A;  1WOQ A;  3HST B;  3HM8 A;  3AA5 X;  2D0O A;  3G6E N;  4CJ7 A;  4CHQ A;  5EPC A;  1K6Y A;  2HBK A;  2Z1I A;  4RW8 A;  5CHI A;  5KRT A;  4CD3 A;  1M5Q 1;  1EX4 A;  3LDO A;  3R1X A;  3RWU A;  3AA4 A;  4ILJ A;  1HQU A;  1NOZ A;  4F8R A;  3HP9 A;  4M3W A;  1QN4 A;  4E1J A;  5LL6 Z;  4B9V A;  3M3Z A;  4JD2 A;  5BMN A;  2CGJ A;  2VQE K;  4KTZ A;  2HBL A;  5JS1 A;  4M45 A;  3L2R A;  2ZM6 K;  1HLU A;  3VEW A;  2ETJ A;  1U04 A;  1GOA A;  1HNW K;  3NVM A;  3DXM A;  4MO4 A;  3CFP A;  4BDP A;  1FKO A;  1CZ9 A;  1ZBS A;  3V1Q A;  3OJU A;  2KLA A;  4DQQ A;  3WNF A;  3SAH A;  4AIL C;  3H3O B;  2EWS A;  3IG1 A;  1NJX A;  4DB3 A;  3CJ7 A;  5EVZ A;  1T3V A;  2F7L A;  3AVH A;  1TK8 A;  2PYJ A;  2HHT A;  3O9Q A;  5TKW A;  5BPM A;  3HS8 A;  3TSU A;  2ITG A;  4C8K A;  1OVQ A;  5JN5 A;  1X1P A;  4QAG A;  1RCH A;  2UXB K;  4BE2 A;  5C10 A;  1RTI A;  1Q18 A;  3CVS A;  3QBX A;  4KHS A;  3U3G A;  4FZY A;  3CJC A;  3A2F A;  3QDK A;  1EXQ A;  3LWM A;  1Y97 A;  4RW9 A;  4FM2 A;  1D9D A;  2G8W A;  1NGE A;  3ZSR A;  2FSN A;  4CJK A;  2G8U A;  4FK0 A;  4BRP A;  1IBL K;  2O4G A;  1RM1 A;  5AQR A;  4E0D A;  1VQ4 N;  3E9P A;  4CK2 A;  4HJH A;  1IKW A;  3VQC A;  2NOE A;  1WUA A;  4JKD A;  4LFC K;  3PSF A;  1KYU A;  1WSE A;  3OVN A;  4RW4 A;  1VKL A;  1IO2 A;  4FJG A;  3CIP A;  3BEX A;  4I6M A;  3WNE A;  1QS4 A;  4DR3 K;  5F0X A;  3O5B A;  4JK9 A;  1NM1 A;  4CJF A;  1HNV A;  4ELU A;  4LSN A;  5AFU A;  4I2P A;  5AQK A;  2BUP A;  4FOI A;  1D9F A;  5BRE A;  1VSF A;  5IWA K;  4JD2 B;  4NCB A;  4WX8 A;  3VEN A;  2O8B A;  1NK4 A;  1YTU A;  2F9T A;  4RTF D;  2CGK A;  3V9S A;  4B8C A;  4CCH A;  4WFN L;  3LDS A;  3AAP A;  1IKX A;  4J2A A;  2OPQ A;  3WEE A;  1ZBI A;  5AQW A;  1RDC A;  3NFA A;  1RT1 A;  2JGU A;  4PQU A;  4ID5 A;  2UXD K;  4Z4E A;  4IFE A;  3VQE A;  4CK3 A;  4CHY A;  3CM5 A;  1LOT B;  4CHN A;  1C1B A;  2E2Q A;  4KHY A;  2ZQB A;  4IOX A;  2A41 A;  3LDQ A;  5C12 A;  2JWL A;  3SUN A;  3OJS A;  4GKJ K;  2HHU A;  3CW7 A;  2E2O A;  4BR4 A;  1KD1 O;  1N33 K;  1Q81 O;  1YQK A;  4MO5 A;  3CQY A;  3OSM A;  2D1K A;  1WB9 A;  3EZW A;  1C6V A;  1GLJ O;  3OBY A;  1Z25 A;  5AQJ A;  1P8Z A;  3MN5 A;  3K5N A;  3PDK A;  4LC9 B;  2NVM A;  2B6A A;  4JK8 A;  2GWK A;  5GAE P;  2BE2 A;  2YHX A;  3C7N A;  3VN5 A;  4FJ7 A;  4CK1 A;  1QN7 A;  3OYF A;  2VG7 A;  4DS5 A;  4FZX C;  3KLF A;  1KVB A;  1YVN A;  3CD6 N;  4DHY A;  2UXC K;  1VQL N;  3C95 A;  3MED A;  2JHJ A;  3OSE A;  1U6Z A;  2YHA A;  3KHY A;  4CFC A;  2RE2 A;  4DV7 K;  5AQF A;  5BRF A;  1LCU A;  3CJB A;  1R4X A;  3SJH A;  3HYF A;  4BC3 A;  1X9J A;  3R6M A;  4PL7 A;  2Y1I A;  1PZD A;  4WYB A;  3RRH A;  1Y64 A;  4RW6 A;  4Y1D A;  3UB5 A;  3LDN A;  1YQL A;  3L2Q A;  1U49 A;  3I0S A;  1EET A;  4Y0W A;  3ID6 A;  5CZ2 A;  1Q9U A;  1KXP A;  2PBD A;  1D4X A;  3EE8 A;  3A5L C;  1KRP A;  1ZBF A;  4FJM A;  2E88 A;  3N4P A;  2RN2 A;  5BPN A;  1YQM A;  2A40 A;  4FVU A;  1Q82 O;  4DSI A;  3D45 A;  4JV5 K;  4GVM A;  5EXW A;  2O8B B;  2E1Z A;  3VGM A;  3V1R A;  4JHD A;  1Z6R A;  3KK1 A;  1KC8 O;  3O9S A;  1NGH A;  4DF4 A;  2HF4 A;  3FZL A;  4EHT A;  4FWS A;  4FWR A;  3M8P A;  1HKC A;  3WEE B;  1WQA A;  1VHX A;  4EFH A;  3CI5 A;  3NHG A;  2QWM A;  2YJE A;  4Z4F A;  2W6L A;  3NH2 A;  2UUA K;  2X6N A;  1S6Q A;  2KFZ A;  4DSL A;  1Z05 A;  4BGA A;  5AZI B;  2D0P A;  1XHZ A;  3J7Z O;  4KTQ A;  3VA0 A;  4Z4I A;  1RDW X;  1PCZ A;  2YNI A;  2Q3S A;  3I0X A;  1N32 K;  3MWT A;  4DFJ A;  4OLA A;  4X64 K;  3AO3 A;  5IYB P;  4PUO A;  2ASP A;  3F9M A;  5KQ8 A;  4RG8 A;  3ENC A;  2PY5 A;  1ILY A;  5HRR A;  3C7N B;  1KAZ A;  3QEV A;  4C7P A;  3QIC A;  1U4B A;  4I9Q A;  2FSJ A;  1S3X A;  4DQ8 A;  3TSQ A;  1IKY A;  2GBZ A;  1ZBH A;  4WFB L;  4FLV A;  4BRQ A;  3VEZ A;  1KYD A;  3K58 A;  1LWF A;  1GLE G;  4E7K A;  2QWQ A;  1MP9 A;  1XI1 A;  2OA8 A;  1VSH A;  2UUC K;  2IV8 A;  3FZH A;  3THW A;  4RWT A;  1XMO K;  5BMP A;  3RMD A;  1J5O A;  1VQO N;  1XMQ K;  4JI0 K;  4NCG A;  3VMF B;  3FFI A;  1DLO A; 
#chains in the Genus database with same CATH homology
 1A5V A;  4ROD B;  5HBM A;  4CIE A;  3KK3 A;  1QNB A;  4DTM A;  1NK8 A;  1RDD A;  1QSL A;  1ZBL A;  1TVR A;  3AO1 A;  4IDK A;  4CJQ A;  4CJS A;  2BAN A;  5FRO A;  4DU1 A;  1LAW A;  2B5J A;  3SQ4 A;  2NOZ A;  1QN8 A;  3CFO A;  1RIL A;  1RNH A;  4O0I A;  1JLB A;  3M8Q A;  4DTJ A;  3QEI A;  2XY7 A;  4IG0 A;  3B6P A;  3EZ5 A;  4FLU A;  3OYC A;  4CJP A;  2A1R A;  2OPR A;  2HHW A;  1VTO A;  1TL3 A;  4B9S A;  4Z4G A;  4KI6 A;  3OS2 A;  1NH2 A;  2NOI A;  2DFE A;  1I39 A;  4YFU A;  4DQS A;  1D5A A;  4M3T A;  4ELV A;  1QE1 A;  4MFB A;  5SZT A;  1B9K A;  3IRX A;  3RTV A;  1C9B B;  1L5U A;  4CJV A;  3OC3 C;  4ID1 A;  2OPP A;  3KD5 E;  2XHI A;  3NF9 A;  2WOM A;  1IKV A;  1SKW A;  4LY7 A;  3ZT0 A;  4I8O A;  4CHZ A;  3B6O A;  3RRG A;  2YNH A;  3VQ6 A;  1WSJ A;  3SV4 A;  3C94 A;  1QSY A;  4KFB A;  1TKZ A;  2B4J A;  2F96 A;  2YKN A;  1FN7 A;  3AV9 A;  3ZSO A;  4FJL A;  4M3Y A;  4G1Q A;  2HHV A;  4CHO A;  1M3H A;  2NOL A;  3MAQ A;  3LZJ A;  2AJQ A;  2JOI A;  3H08 A;  1WN7 A;  3DLR A;  5FDL A;  4CGJ A;  4O4G A;  2HZS A;  4OGC A;  2GUI A;  1N3A A;  3MEE A;  5KGW A;  3OYA A;  4CHP A;  4B9T A;  4K8X A;  3CFR A;  4Y1C A;  3UIQ A;  5CYQ A;  4CF0 A;  3NDK A;  3NBP A;  5J2P A;  3V81 A;  1TGO A;  1S6P A;  4OKK A;  5FRM A;  1HYV A;  4K8Z A;  1C0T A;  4KRE A;  1JXB A;  3S3O A;  5KGX A;  5I3U A;  3C6T A;  4CJW A;  4M3Z A;  2KW4 A;  3TAP A;  5J2N A;  4FLX A;  1UA0 A;  3QLH A;  4EZ6 A;  4CFA A;  4WZS D;  1QSS A;  4M3X A;  1VOK A;  1HU0 A;  4HHT A;  3TAB A;  1S1T A;  1ITG A;  2JLE A;  5KI6 A;  4DF8 A;  3SUP A;  4J2B A;  4F2S A;  3DRP A;  3HPG A;  3N89 A;  4TPS A;  5DMR A;  4ROE B;  1QTM A;  3V4I A;  4C8L A;  4FJ8 A;  1DTT A;  3VQA A;  4FW2 A;  3VQ8 A;  4Z4H A;  4Q0B A;  2Z1H A;  1XC9 A;  2XY5 A;  3SUO A;  1JLE A;  4CIG A;  3HL8 A;  1QN6 A;  1WNS A;  1YTA A;  1YVU A;  1NOY A;  4XIU A;  3F9K A;  4KI4 A;  2KZZ A;  1UOC A;  2NOB A;  4B9M A;  4B9N A;  3BDP A;  4KAZ A;  4ZHR A;  3AVL A;  2Z1J A;  3U6F A;  1N6Q A;  3VQP A;  4FJ9 A;  1WSI A;  3V9X A;  1KFD A;  2OZS A;  2YH5 A;  4E1N A;  4J2E A;  2NUB A;  1L3V A;  5HRN A;  2YNF A;  1QN3 A;  3DOK A;  2D0A A;  1VSI A;  4IKF A;  2FGT A;  1BIS A;  3TAF A;  4N41 A;  4CEF A;  3OYN A;  5D3G A;  1S5J A;  1W0H A;  3HPO A;  1T7P A;  4ROC B;  4W5O A;  2X6S A;  3VA3 A;  3OYH A;  2D0B A;  3LPT A;  4DSE A;  1LW2 A;  1CLQ A;  1QTP A;  1JKH A;  2RF2 A;  4HCC A;  4DS4 A;  2A1S A;  1EBM A;  1XWL A;  2FBY A;  2PZS A;  5KRS A;  1G15 A;  4E1M A;  3DLE A;  1SL0 A;  2X78 A;  4CF1 A;  3ZSZ A;  2I5J A;  3LAM A;  5J2Q A;  1L3U A;  3SNN A;  2BDP A;  3RR7 A;  1ZYQ A;  3T19 A;  3PX4 A;  3CG7 A;  3KD1 E;  3MXJ A;  4LD0 A;  3SQ1 A;  4FK2 A;  5IYC P;  4CJU A;  2FBV A;  4H4O A;  5CYM A;  4OPJ A;  3SJJ A;  2QKB A;  1VSL A;  3OYI A;  3L3V A;  3NH0 A;  1N3C A;  1UAX A;  4PA1 A;  2HNY A;  2P1J A;  1JL2 A;  4CES A;  1BI4 A;  3S9H A;  3KRM A;  4B0A A;  1KVA A;  4Z0U A;  1BGX T;  4H8K A;  3ZCM A;  3ZSQ A;  3QES A;  1NK0 A;  1JFI C;  1YTF A;  4CJ5 A;  5HP1 A;  3OCI A;  4BDZ A;  1SKR A;  2MJ7 A;  2NOF A;  2GV9 A;  4M3U A;  1HJR A;  3KIO A;  4DTO A;  3S3M A;  4CED A;  1LWY A;  2Y1J A;  4HUE A;  4N5S A;  2VWJ A;  4DWI A;  1S9G A;  1WAJ A;  2ZE2 A;  3K59 A;  4E7L A;  4FYD A;  2I5W A;  2VJ0 A;  4NCA A;  2BGG A;  4EJY A;  3AVA A;  1RT5 A;  4CJR A;  1BQM A;  1RDA A;  1ASV A;  1R0A A;  4KHW A;  2YKM A;  3ZSW A;  3QEW A;  3SI6 A;  3EYZ A;  3TAN A;  4F2R A;  2RPI A;  1TKD A;  1YQR A;  4FJN A;  4LH5 A;  4EZ9 A;  2YV0 X;  3O3H A;  2W42 A;  4C8O A;  2OZM A;  1HQE A;  4CGG A;  1HMV A;  1VSK A;  1E42 A;  5HRP A;  2XY8 A;  5DK5 A;  4MQ3 A;  3PX6 A;  1N5Y A;  1NK5 A;  1KO9 A;  3HST B;  4CEB A;  1KLN A;  4CJ3 A;  4CJE A;  4BE1 A;  3AA5 X;  1BCO A;  3VQQ A;  3OS0 A;  3U3Y A;  3THV A;  5J2M A;  2FBT A;  4CHQ A;  1RTH A;  4W5T A;  4CGF A;  1K6Y A;  2Z1I A;  1U48 A;  3OYK A;  4RW8 A;  3RMC A;  1WAF A;  2WON A;  3AVC A;  5KRT A;  1FK9 A;  1EX4 A;  4FJ5 A;  2D5R A;  3DLH A;  2DFH A;  3RWU A;  3AA4 A;  1BIU A;  4PY5 A;  1VK0 A;  1CXU A;  3AVN A;  2XHB A;  4FJK A;  4FCY A;  4EJZ A;  3ZSX A;  3OYB A;  2MZ8 A;  4KHN A;  1HQU A;  1NOZ A;  3BGR A;  2P5O A;  4F8R A;  3HP9 A;  3TAM A;  1C0U A;  4M3W A;  1LWE A;  3K5O A;  2O4I A;  1QN4 A;  3VQ4 A;  4EP4 A;  3ZT2 A;  1A5X A;  4IFV A;  3D0P A;  4B9V A;  4DUL A;  4FW1 A;  3KLH A;  1T8E A;  4B9U A;  3DPU A;  1KFS A;  1WLJ A;  3NH1 A;  4KTZ A;  4JLH A;  3HK2 A;  3AA3 A;  1NKB A;  5JS1 A;  1GOB A;  5HRS A;  4I7F A;  3ZSV A;  4M45 A;  4CJ4 A;  1KVC A;  1C0M A;  3L2R A;  1KY6 A;  1TKT A;  2HND A;  3KLE A;  3PX0 A;  2HB5 A;  3QIP A;  1CZB A;  4FJX A;  4N76 A;  5C24 A;  4M42 A;  2G8K A;  3MXM A;  1A5W A;  1F21 A;  1J53 A;  1TGH A;  1Q8I A;  3WNH A;  3TWH A;  2ETJ A;  4IG3 A;  1Q9X A;  3KTQ A;  4E7J A;  1U04 A;  4CF2 A;  4QOZ B;  4FJJ A;  1GOA A;  3AVG A;  1TBP A;  3ULD A;  3OYE A;  4M41 A;  3CFP A;  4BDP A;  1FKO A;  2XO7 A;  1CZ9 A;  4DSK A;  2XRI A;  1RT6 A;  1QQC A;  4DLG A;  1EP4 A;  3V1Q A;  3OJU A;  4DQQ A;  3WNF A;  3DLB A;  1RTD A;  4AIL C;  2LAE A;  3AO5 A;  3IG1 A;  1NJX A;  4CEE A;  3VQ7 A;  3NE6 A;  3LAL A;  3HP6 A;  3LWL A;  1S1U A;  3F10 A;  4Q11 A;  2IGI A;  4KTW A;  2DY4 A;  1LWW A;  2O3O A;  1BHL A;  3AVH A;  4CEC A;  1RDB A;  2XY6 A;  1KSP A;  1TK8 A;  1NJY A;  2PYJ A;  3P5J A;  4FM1 A;  2HHT A;  3HS8 A;  3DOL A;  3DM2 A;  3M8R A;  4F3O A;  4CEA A;  1RBV A;  2ITG A;  3PV8 A;  4NYF A;  4BAC A;  4C8K A;  1WSH A;  2IS3 A;  1LAV A;  4KKO A;  3DRS A;  3V9U A;  1BI4 B;  1FXX A;  3I0R A;  1X1P A;  3OST A;  3KKR A;  4QAG A;  1NK9 A;  1RCH A;  1LV5 A;  4BE2 A;  3QNN A;  4R5P A;  4W5N A;  1RTI A;  2YHB A;  1B9F A;  3LAK A;  5C42 A;  4CEO A;  4DQP A;  2E6M A;  4HUF A;  4KHS A;  3U3G A;  4DQI A;  4FZY A;  3A2F A;  3KLG A;  1EXQ A;  3LWM A;  1Y97 A;  3DMJ A;  4JRP A;  1KY7 A;  1TAQ A;  1RT4 A;  4FVM A;  2HNZ A;  2LSN A;  4RW9 A;  1JLG A;  1WSF A;  5I42 A;  3L2V A;  4FM2 A;  1D9D A;  2G8W A;  2HVH A;  3ZSR A;  2KTQ A;  4DU4 A;  1NKC A;  4CJK A;  4JS5 A;  2G30 A;  3PUF A;  4CGI A;  2G8H A;  4JRQ A;  2G8U A;  3HO1 A;  1TL1 A;  1SKS A;  4FK0 A;  1BIZ A;  2O4G A;  3NF8 A;  4KO0 A;  3AVM A;  2G8F A;  1RM1 A;  4B8A B;  3V1O A;  4CJT A;  4DU3 A;  4KRF A;  4E0D A;  4CK2 A;  1BQN A;  3CQ8 A;  1IKW A;  3VQC A;  2NOE A;  3SQ2 A;  3QIO A;  3SCX A;  2G8V A;  1JLA A;  3OS1 A;  2ATQ A;  4QCL A;  2X74 A;  1KYU A;  1WSE A;  3OVN A;  4RW4 A;  3VQ9 A;  4CFD A;  4N56 A;  2KQ2 A;  1QNC A;  1IO2 A;  3TAE A;  3L3U A;  3QO9 A;  1B9D A;  5HLF A;  3WNG A;  4FJG A;  4DLE A;  3NGI A;  4B3O A;  2R7Y A;  3WNE A;  3HS9 A;  1QS4 A;  3RMA A;  2HVI A;  4LH4 A;  1I3A A;  2IV9 A;  1L3S A;  3O4N A;  1T03 A;  4CJF A;  4DFK A;  1HNV A;  1W9H A;  4FJI A;  4ELU A;  1O1W A;  3H1Z A;  4LSN A;  2PYL A;  4I2P A;  4OPK A;  5JS2 A;  3V9Z A;  4EP5 A;  3KLI A;  5EU7 A;  1D9F A;  1VSF A;  3T3F A;  1NJW A;  3LP2 A;  3VQD A;  5AN4 A;  3OYM A;  1UT7 A;  4YNQ A;  4OLB A;  4NCB A;  4OVL A;  1RBT A;  5E41 A;  4W5Q A;  4FM0 A;  1NK4 A;  2OYQ A;  3AVF A;  1YTU A;  3KKS A;  4CF8 A;  2KZM A;  5KTQ A;  4GMJ B;  3V9S A;  4AHR A;  2E4L A;  4B8C A;  3CM6 A;  4CCH A;  2HHX A;  1VSE A;  3LDS A;  1B92 A;  4O44 A;  1KTQ A;  4CGD A;  4N47 A;  1IKX A;  3SQ0 A;  2QK9 A;  4J2A A;  3CYM A;  2OPQ A;  3EIK A;  4CEZ A;  2FC0 A;  1ZBI A;  3AO2 A;  2ZD1 A;  1W80 A;  1RDC A;  1SV5 A;  1RT1 A;  2JGU A;  3E01 A;  3NFA A;  4KHQ A;  4PQU A;  4ID5 A;  4B08 A;  4PWD A;  1J9A A;  4ICL A;  5T7B A;  4E3S A;  2IOC A;  4TSX A;  3VQE A;  1RT3 A;  3ZSY A;  4UQG A;  3L2U A;  4Z4E A;  2HHS A;  1S1X A;  1VSM A;  4CHY A;  3CM5 A;  4CK3 A;  1J54 A;  3MXI A;  2QKK A;  2HW3 A;  2EX3 A;  3G0Z A;  4CHN A;  1C1B A;  4W5R A;  4DTU A;  2ZQB A;  4KHY A;  3LP1 A;  4AH9 A;  1TBA B;  1REV A;  3OY9 A;  1UA1 A;  5FRN A;  1KLM A;  2IDO A;  1JXE A;  4C8M A;  4DFM A;  1VRT A;  3SUN A;  3LP0 A;  3OJS A;  4B9L A;  2HHU A;  3RPJ A;  1YQK A;  1LWV A;  1QNE A;  1C1C A;  3DYA A;  3OSM A;  2QXF A;  3ITH A;  4O55 A;  1RT7 A;  1C6V A;  1VSD A;  4CJL A;  1Z25 A;  4LSL A;  4FZZ A;  1MU2 A;  5C25 A;  3ULX A;  3K5N A;  3SYZ A;  2Z1G A;  3QNO A;  2B6A A;  2P51 A;  3MEC A;  3OYG A;  3I8D A;  1NK7 A;  4OGE A;  2BE2 A;  3HJF A;  4CEQ A;  4FJH A;  3VN5 A;  2VG6 A;  4FJ7 A;  5K14 A;  2VG5 A;  1VOL B;  4CK1 A;  1QN7 A;  4BWJ A;  1QNA A;  3OYF A;  4Z4C A;  2VG7 A;  3QEP A;  4DS5 A;  3SPY A;  4FZX C;  3RRH A;  2F8T A;  4CE9 A;  4IFY A;  4DMN A;  3KLF A;  1KVB A;  1EKE A;  1RT2 A;  3K5M A;  3TAG A;  4OKE A;  4BWM A;  1KYF A;  3O3F A;  4KHU A;  3C95 A;  3MED A;  3PO5 A;  4CER A;  1DTQ A;  3TI0 A;  2YHA A;  1AIS A;  4AHV A;  3NF6 A;  3ZT4 A;  4CIF A;  4E89 A;  4CFC A;  1UT4 A;  3KTU A;  3L2W A;  2HZM A;  1SL2 A;  4FLT A;  4DSJ A;  1R4X A;  1HNI A;  3DLG A;  4AHC A;  4CFB A;  1FKP A;  3DPT A;  4OKJ A;  4GW6 A;  3HYF A;  3EY1 A;  3V6D A;  1NJZ A;  3DLK A;  3PO4 A;  4E7I A;  3QET A;  4M3R A;  2G8I A;  3HVR A;  1ASW A;  2Y1I A;  1JLF A;  3IS9 A;  2NOH A;  4FLZ A;  2KFN A;  1PZD A;  2OPS A;  3I0W A;  1UWB A;  3ISN C;  3O4Q A;  3AO4 A;  4Y1D A;  1WSG A;  1IH7 A;  4RW6 A;  3KK2 A;  4I2Q A;  3K5L A;  3K57 A;  3VQ5 A;  1X9M A;  1HYS A;  1YQL A;  1NGM A;  3L2Q A;  1U49 A;  3I0S A;  1EET A;  5HRO A;  3NCI A;  4C8N A;  1IG9 A;  4HTU A;  5CZ2 A;  1QTS A;  4DG1 A;  1QHT A;  4FXD A;  3C6U A;  1KRP A;  2P5G A;  1TK5 A;  1NKE A;  4F4K A;  1ZBF A;  4Q5V A;  4FJM A;  4HVJ A;  1ZBU A;  3G10 A;  1TAU A;  1RBU A;  2RN2 A;  4BE0 A;  1YQM A;  1QN9 A;  2HMI A;  4DSI A;  1Z26 A;  3D45 A;  4DTP A;  4GVM A;  5IYD P;  4CF9 A;  1NK6 A;  3QEX A;  1X9W A;  4KB0 A;  4CGH A;  3V1R A;  4DTS A;  2FBX A;  3KK1 A;  3HXM A;  3RR8 A;  3OYL A;  4KPY A;  2HHQ A;  4J2D A;  3TAR A;  4H4M A;  4DF4 A;  3IH7 A;  4JS4 A;  5CY4 A;  3LAN A;  4FK4 A;  1ASU A;  4OJR A;  3AVI A;  2RKI A;  1CDW A;  3P83 D;  3M8P A;  3NF7 A;  1VRU A;  3DRR A;  3L8B A;  4O0J A;  4E7H A;  3NHG A;  1KCF A;  5SWM A;  3SPZ A;  3HVT A;  2E6L A;  4DQR A;  4Z4F A;  1JLQ A;  1RBS A;  3JYT A;  5CZ1 A;  3SV3 A;  2YNG A;  3LZI A;  4AHS A;  5J1E A;  1S1W A;  1VSJ A;  3NH2 A;  3OYJ A;  3T1A A;  4HCB A;  2X6N A;  3ASM A;  3PY8 A;  1S6Q A;  2KFZ A;  1M3Q A;  4KV8 A;  3NGY A;  1BCM A;  3MEG A;  3F0Z A;  1JL1 A;  1GOC A;  1VTL E;  1LW0 A;  4RW7 A;  4DSL A;  4KB1 A;  3RMB A;  1BL3 A;  1S9E A;  4ZTF A;  1QN5 A;  1X9S A;  4FLW A;  1U47 A;  1XHZ A;  1YTB A;  3HM9 A;  4KTQ A;  3VA0 A;  3HPH A;  3ZT3 A;  3DI6 A;  4DTN A;  4ZTJ A;  3ALY A;  4Z4I A;  2DTU A;  1PCZ A;  1SL1 A;  2YNI A;  4IBN A;  2Q3S A;  3SZ2 A;  3NGZ A;  3I0X A;  4WE1 A;  1Q9Y A;  4DFJ A;  4OLA A;  1L3T A;  1TK0 A;  1N39 A;  1C1A A;  3AO3 A;  5IYB P;  1HPZ A;  1HRH A;  3QER A;  3TAQ A;  4PUO A;  4DSF A;  3NAE A;  3KJV A;  3LPU A;  4DTX A;  4RG8 A;  1S1V A;  1CXQ A;  1JLC A;  2PY5 A;  5HRR A;  2Z8U A;  4I9L A;  4O5B A;  1U45 A;  1RTJ A;  2EHG A;  1D3U A;  3AVB A;  2IC3 A;  1HYZ A;  4FLY A;  3M8S A;  3QEV A;  1U4B A;  4I9Q A;  4L8R B;  3SUQ A;  1TKX A;  3V9W A;  3VQB A;  1IKY A;  2GBZ A;  1ZBH A;  4FLV A;  1LWC A;  1KYD A;  3HT3 A;  4BDY A;  3AA2 A;  2VWK A;  4AHT A;  3P1G A;  3O3G A;  3AVJ A;  3K58 A;  1SUQ A;  1LWF A;  3ZT1 A;  1YT3 A;  4DTR A;  2IAJ A;  2D0C A;  4DFP A;  2DFF A;  2F8S A;  4E7K A;  1XHX A;  1MP9 A;  3LP3 A;  3QIN A;  4E19 A;  3S3N A;  1XI1 A;  2OA8 A;  1VSH A;  3AVK A;  1TV6 A;  4HUG A;  3IAY A;  1NVP A;  2IV8 A;  3TR8 A;  4F3T A;  1J5O A;  1RBR A;  3RMD A;  1D8Y A;  3JSM A;  4NYN A;  3OYD A;  1T05 A;  4NCG A;  3SNS A;  3FFI A;  1DLO A;  3K2P A;  4ELT A;  4AHU A;  3F73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...