2D0CA

Crystal structure of bst-rnase hiii in complex with mn2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0cA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0cA02
1T7PA 1S1VA 2E6LA 4CHYA 3RMAA 2DTUA 3M8PA 4MFBA 5HRRA 3K58A 2GV9A 4PA1A 3S9HA 3O4NA 2JGUA 1KLMA 3SQ2A 1XHZA 4NCGA 1WAJA 4BWJA 1U49A 2Y1IA 3AVCA 3KTQA 3OYKA 2B4JA 1NH2A 4EZ9A 1HYVA 2HNDA 1FK9A 1VSJA 2Z1JA 3G10A 3HP9A 3P83D 5D3GA 4Z4GA 2JLEA 4EP4A 3NE6A 3K5LA 3RRHA 1RT7A 3SV3A 1IKVA 1WSJA 2YNIA 1BGXT 1D5AA 3LDSA 1AISA 1WAFA 2YHBA 4C8LA 4QOZB 1NKBA 1JXBA 3QIPA 4FZZA 4DQPA 3VQ7A 4PY5A 3SYZA 3WNEA 2XY8A 4B9UA 4FJLA 1SL0A 2FBVA 2X6SA 1KY7A 3AA4A 4CJPA 1VTLE 1IG9A 5CZ1A 2HNZA 3OJSA 3RR8A 1YT3A 1C6VA 3KK3A 3V9UA 3RMCA 3VQ6A 1YTUA 3ZSVA 4ID1A 1CZ9A 1GOAA 3KLEA 3T3FA 1UOCA 2OPRA 1JL1A 1QSSA 4QAGA 4FM1A 1VSKA 3S3MA 3OYMA 3U3GA 3HVRA 1KFDA 3QETA 4FJKA 2OPPA 3K59A 2VG6A 3LZJA 4BDZA 1ASUA 4O0IA 3LAKA 4HHTA 2HHWA 2IC3A 3VQ9A 4CIFA 4FM2A 2DY4A 4BDYA 2IS3A 4IFYA 4DTSA 1TGHA 3KIOA 1K6YA 4CJSA 3ZSZA 2PY5A 1QNCA 1KVBA 3TAEA 3PX6A 4DU4A 4ROCB 3NHGA 3QEIA 2YNHA 2NUBA 1JLAA 4O5BA 1GOCA 3LAMA 1X9SA 4AHTA 1MU2A 3OS0A 3D45A 3B6OA 3L2QA 3ASMA 4DTPA 1UWBA 1PZDA 1T8EA 3MXMA 3ALYA 3HT3A 2HHTA 1QQCA 1KYFA 3MAQA 1RBUA 3NF9A 4BE1A 2WOMA 3ZSXA 1ZBLA 3BDPA 4FZYA 2R7YA 1S1WA 1VK0A 2XY6A 2YKMA 3ZT2A 4DFMA 1CZBA 3AVNA 3LALA 3MEGA 4BACA 3NH1A 3AVFA 2QKKA 4LSLA 4FJHA 1UAXA 3DRPA 2DFEA 4FLYA 3TARA 4CJQA 4E19A 5KRTA 1NOYA 1CLQA 2PYLA 3SUNA 4GW6A 4CGIA 1U45A 1NJZA 4O4GA 2E4LA 3TAMA 4B08A 3AVHA 3DLHA 1B9DA 1E42A 1S1XA 1IKWA 3SV4A 4DSLA 4DF8A 4TSXA 1RT5A 4CJ5A 1A5VA 3AVGA 1EETA 1RT1A 3LANA 4CEZA 4OLAA 3AVKA 4DSEA 3RR7A 1HRHA 3SPZA 2IDOA 4DG1A 1SV5A 2VWJA 3KK1A 3AO2A 3VQEA 3TAGA 4HCCA 4HUGA 4I9LA 1G15A 4W5TA 4B3OA 4C8NA 3V9XA 4M3ZA 4KREA 2A1SA 4CFAA 5J2QA 4J2EA 4FJ7A 4FJ8A 3KK2A 1RT6A 4B9MA 1EP4A 1HMVA 3K5NA 1A5XA 4E7LA 1BL3A 1ITGA 2E6MA 2YNFA 4OKEA 3PO4A 5KTQA 3HL8A 2D0AA 2RPIA 5I3UA 3SUOA 3ZSRA 3OY9A 4N41A 1VRUA 1IH7A 3AA3A 4DLEA 4E0DA 4M3WA 2Z1HA 1C0TA 1LW0A 2VWKA 3HK2A 2KFZA 1XHXA 2OZMA 4O55A 3IS9A 4AHUA 4DFJA 2BGGA 3AVBA 3AVMA 4J2AA 4DWIA 1N6QA 3DI6A 3KLIA 1QN3A 4CF9A 4DU3A 4EP5A 2G30A 4NYFA 4DTUA 4C8MA 1CXUA 3ZT3A 4CJEA 4B9TA 5KI6A 3KLGA 3K57A 3IAYA 4FJXA 4WZSD 1RM1A 4DTNA 1W0HA 1NOZA 2YV0X 3OS1A 3RRGA 4B9LA 3CQ8A 3TAQA 4JS5A 4CECA 5I42A 4DQRA 1RTDA 1JXEA 5CY4A 4DU1A 2OA8A 4FYDA 2KTQA 3DYAA 3LP1A 4J2BA 4CJVA 4DSFA 2KZZA 2Z8UA 2GBZA 3OS2A 1TKDA 4DS4A 4CERA 3SCXA 4C8KA 3OYBA 3M8RA 1SKRA 3VQ4A 4M3TA 1RDCA 4BE0A 3PV8A 3NCIA 1Q9XA 1VSHA 4FK0A 1U4BA 4AH9A 3OYDA 5KGWA 3DOKA 4FLVA 4LH5A 1S9GA 4RW4A 4L8RB 4KO0A 4ZTJA 2IV9A 5FROA 3SQ1A 2VJ0A 3ZSYA 3L8BA 4JRQA 4CEQA 1N5YA 2B6AA 1JLQA 3LP0A 3LWLA 2YKNA 5J2NA 4HUEA 3D0PA 4FJGA 4DSIA 1W80A 1VSLA 3NGIA 3T19A 2ETJA 4CGGA 4RW9A 1JLCA 1RT4A 4RW6A 4CFBA 3QEPA 1FKOA 3AO3A 1UA1A 4CJ4A 1HQUA 4FJMA 3WNHA 2VG7A 1LWEA 4CIGA 1JL2A 1VSMA 3KD5E 3HPGA 3P1GA 1EXQA 3RTVA 4N5SA 1C1AA 4W5OA 4Z4FA 1LWCA 4DS5A 5EU7A 3NBPA 3SPYA 1D9FA 1KVCA 4CF1A 3S3NA 4M42A 2BE2A 1NK7A 4KRFA 3F73A 3C95A 1LWFA 2HMIA 1IO2A 2YNGA 3ISNC 4YNQA 2HHQA 2PYJA 5E41A 1TKTA 1L5UA 3ULDA 1J9AA 2X74A 1U04A 1KSPA 4CHQA 1R0AA 1QTMA 4EZ6A 4KTWA 2P5OA 1WN7A 3ZT0A 3OCIA 1NK9A 1DTTA 4KHUA 1TKZA 1UA0A 3I0SA 3HS9A 1QE1A 1VTOA 4HCBA 4CJ3A 1QN5A 2HNYA 4Z4IA 3A2FA 4F4KA 4I2QA 2DFHA 4NCBA 3OYIA 1B9FA 4M3RA 3O3GA 3G0ZA 2F8SA 4AHVA 4KAZA 5J2PA 3V9SA 3OYEA 3NF8A 5SWMA 5K14A 2HHVA 4KV8A 4ELUA 4J2DA 3MEDA 3O4QA 4CEDA 1QN4A 2W42A 1B92A 3QNOA 4I2PA 4UQGA 1TBAB 4OGCA 3C94A 1TK5A 3PO5A 3OYNA 4M3XA 1TKXA 1RTHA 2D0CA 1CXQA 4FJ9A 4RODB 3L3VA 3AVLA 1QN6A 4ZHRA 3L2VA 2HVHA 3SJJA 1L3SA 1QNAA 4E7IA 3SQ0A 3NF6A 2KW4A 1TL1A 2VG5A 3F9KA 4CHPA 5SZTA 1VSDA 2MJ7A 1C1CA 1VSFA 1BCOA 4CF8A 1XC9A 1NJWA 4NCAA 3THVA 4PUOA 3UIQA 3S3OA 3LP3A 4W5NA 3U3YA 1QN9A 4FW2A 5IYBP 2BANA 3VQDA 3CFRA 2F8TA 4LH4A 3SUQA 4Z4HA 1WSHA 5IYDP 1J54A 4H4OA 3DM2A 4CJWA 2PZSA 1HNIA 1C0MA 2HW3A 1BISA 4E1NA 2ZE2A 2KFNA 1RILA 3KKSA 4FLUA 1VSIA 2X6NA 4RW7A 3L2UA 3LZIA 2OPQA 1CDWA 4CGFA 4DTXA 2XY5A 2HVIA 1U47A 4ID5A 1NGMA 3HO1A 2G8HA 4ROEB 2X78A 5J1EA 3PX0A 5FRNA 2XO7A 4BE2A 2O4IA 1KYUA 2EX3A 2ZQBA 3NF7A 2EHGA 4NYNA 2G8VA 4CHZA 4Z4CA 2XRIA 1U48A 3ZCMA 3ZSQA 3VQBA 1NKCA 2BDPA 2OYQA 4FJJA 1SKSA 3DMJA 1Z26A 4F2SA 1BI4A 1KVAA 3DLEA 3FFIA 1VRTA 4ELVA 4KI4A 1YVUA 5JS1A 4CFDA 4YFUA 4IFVA 1NKEA 3HSTB 2O4GA 4CEOA 1T03A 3NDKA 4FLXA 3OYGA 3NGYA 3KLHA 2G8UA 4KPYA 4ICLA 3VA0A 1QHTA 3HPHA 1LAWA 4CFCA 4E89A 3CYMA 1KFSA 1KRPA 4CJKA 3U6FA 3L3UA 4KB1A 1YTAA 1J53A 3AVIA 3OYHA 2G8WA 4CJLA 2YHAA 1WLJA 4E1MA 4FLWA 4E7JA 2XY7A 1TAQA 3OYAA 3ITHA 1TK0A 1NK6A 3CFOA 4GMJB 2IV8A 3EYZA 3O3HA 1A5WA 2D5RA 1Y97A 4OKKA 3ZSWA 4K8ZA 1S1UA 4Y1DA 1WSIA 4B9SA 4IG3A 4MQ3A 1RBSA 2G8IA 2RKIA 1SL1A 4BWMA 4FK4A 3LPUA 4KHYA 1RDBA 1VOLB 1REVA 1B9KA 4DF4A 3MECA 3V1RA 4Q5VA 1ZYQA 1MP9A 2ATQA 3PX4A 1DTQA 4OLBA 1JLBA 1ZBUA 1JLFA 4FCYA 3HM9A 3OYCA 5JS2A 3OYFA 1TL3A 4O44A 1RCHA 3QO9A 3BGRA 3CFPA 1Q8IA 4F2RA 1C9BB 4HTUA 4OKJA 5KGXA 3O3FA 1QSYA 4F3TA 1BHLA 4CIEA 4AHCA 1C1BA 4KFBA 5CZ2A 5HRPA 2Q3SA 1NK5A 3IRXA 4M41A 1D8YA 1KCFA 1QS4A 1KYDA 3K5OA 3SUPA 1KTQA 4N47A 3RMDA 1EKEA 1HYSA 3QLHA 1SL2A 3NFAA 3DLRA 4F3OA 4B8AB 3WNGA 4FM0A 1T05A 3HVTA 3PY8A 3M8SA 4B0AA 1HNVA 2HHXA 1JLEA 1I39A 4CK2A 4IG0A 3M8QA 3TR8A 1RT2A 1RBVA 5DMRA 3WNFA 2FBTA 3VQ8A 1ZBIA 1W9HA 1RBRA 4ELTA 5IYCP 4HVJA 4I7FA 3CM5A 4Q0BA 4PWDA 1BQMA 3OYJA 5J2MA 3RMBA 3TWHA 3HS8A 3EIKA 4DFPA 4N56A 3HJFA 2HHSA 3HYFA 4FJNA 2WONA 1XI1A 4CHOA 4I9QA 1L3UA 1QNBA 3OC3C 5CYMA 1BQNA 5HROA 1D3UA 4FZXC 4F8RA 2OZSA 1BIZA 4CK3A 4QCLA 4CJTA 3ZSOA 4CE9A 1C0UA 3CM6A 2P1JA 3QINA 3VN5A 4Y1CA 1I3AA 4CGDA 4E3SA 1NVPA 3HXMA 1PCZA 1RNHA 2IGIA 1XWLA 3AA2A 3P5JA 1RBTA 5HRNA 4DLGA 1HJRA 5T7BA 4FJ5A 1F21A 1NJXA 1JFIC 3SQ4A 1HQEA 3DLBA 4KB0A 4FK2A 2P51A 4RG8A 3ZT4A 3V1QA 1WSEA 4RW8A 4DSJA 3NH0A 1ASWA 1JLGA 4DQQA 3AA5X 4AILC 2HHUA 4B8CA 3NAEA 4H4MA 4BDPA 1SUQA 1Z25A 3L2RA 4IKFA 1YTFA 4H8KA 3MXIA 1X9MA 4FJIA 4JLHA 1DLOA 1S5JA 4CEAA 2ITGA 3OYLA 5HLFA 3QEWA 4DQSA 4DQIA 1RTJA 4CF0A 1J5OA 2Z1GA 4CK1A 1HPZA 4W5QA 3AV9A 3KKRA 2RF2A 3MXJA 3AO5A 4FW1A 3PUFA 3CG7A 3NH2A 3EZ5A 2FBXA 3C6TA 3ZT1A 1FKPA 4CGHA 4JS4A 4XIUA 3V9ZA 1NK4A 4CCHA 3DLGA 4KHQA 4M3UA 2IOCA 3V9WA 3OJUA 3SZ2A 4E7HA 1ZBHA 2ZD1A 1ZBFA 4LD0A 4OGEA 2D0BA 1S1TA 3V4IA 5FRMA 3AO4A 1X9WA 3AVAA 1LAVA 3SNNA 1IKXA 4CF2A 4IDKA 1IKYA 5C24A 3KJVA 3VA3A 1VOKA 1RTIA 5KRSA 1TAUA 1Q9YA 2Y1JA 1TVRA 1LV5A 3MEEA 3QEVA 4DSKA 1FXXA 1EX4A 2G8FA 1KY6A 3V1OA 3DRSA 1LW2A 4AHRA 5CYQA 4O0JA 3AO1A 5HBMA 4DTJA 3OVNA 3LP2A 1R4XA 2QXFA 4OJRA 3VQQA 4OVLA 4DTRA 4CJFA 4CJUA 1TK8A 1NK0A 4N76A 3KD1E 4LSNA 4DMNA 4OPKA 1NK8A 4LY7A 3TI0A 3LPTA 3VQ5A 1KLNA 3RWUA 4CESA 1RDDA 2RN2A 2P5GA 4Z0UA 1TV6A 2XHBA 3T1AA 2FC0A 2I5JA 3HP6A 4CEFA 4FLTA 1S9EA 3H08A 3E01A 4JRPA 3TAFA 4ZTFA 4AHSA 1QTPA 3VQCA 3VQAA 2FBYA 4FLZA 1D9DA 4B9VA 1QSLA 3L2WA 4KHSA 1YTBA 3TANA 4DTOA 1L3TA 1RT3A 3K5MA 4W5RA 5FDLA 3EY1A 5HP1A 4B9NA 4KHWA 2KQ2A 3C6UA 3I0RA 4R5PA 2QK9A 1WSFA 3QEXA 4DTMA 3B6PA 4CEEA 1GOBA 3DRRA 3VQPA 3QESA 3K2PA 3QNNA 4KKOA 1O1WA 4IBNA 2A1RA 2IAJA 5HRSA 4OPJA 3TAPA 3SI6A 2OPSA 2G8KA 1BCMA 1S6QA 2GUIA 2F96A 3KLFA 1HYZA 1WNSA 4Z4EA 3JYTA 5C42A 2AJQA 4DFKA 4WE1A 3HPOA 3TABA 4CEBA 4GVMA 1BI4B 3H1ZA 1S6PA 5C25A 2KZMA 1ASVA 2B5JA 1QN8A 1SKWA 4M45A 1BIUA 3NGZA 4K8XA 1QN7A 4FVMA 1JKHA 1VSEA 4C8OA 3V81A 2DFFA 1TGOA 1L3VA 1WSGA 3QIOA 4CHNA 4PQUA 3I8DA 3JSMA 4FXDA 2HB5A 1TBPA 1X1PA 4HUFA 1QTSA 3QERA 5DK5A 2QKBA 4CJRA 2LSNA 3V6DA 4G1QA 4KTQA 3IG1A 4CGJA 4KI6A 1QNEA 4KTZA 3DOLA 4M3YA 1RDAA 1NJYA 4E7KA 4KHNA 3AVJA 3DLKA 3LWMA 2Z1IA
chains in the Genus database with same CATH superfamily
4CHYA 5HRRA 3VERA 5CHIA 3K0SA 4XEIA 3KTQA 4JI6K 3UKUA 4MO4A 1HU0A 1HYVA 2Z1JA 3KWIA 4B1XB 3K5LA 2O8FA 2XHIA 3D2FB 1AISA 3W0LA 4JKAA 1Q82O 4Z94A 2NVMA 4JI7K 4BJUA 1IG9A 4BGBA 3RR8A 4LFCK 3KK3A 3VQ6A 1GOAA 3T3FA 2NOBA 1ZXOA 4LF5K 1YJWN 1QSSA 4LFAK 1Q81O 3TSPA 2NOZA 4JKGA 4WYBA 1KFDA 3I0XA 3HRGA 3QETA 3K59A 1ASUA 3I3WA 3F10A 4LC9B 4HHTA 3EN9A 1PCJX 3WEEB 4CJSA 5LJVA 1QNCA 3PX6A 3O80A 4IOAL 1MU2A 1E4GT 3ZEUB 3ASMA 2QI2A 1VQ6N 1P8ZA 1RGIA 1PZDA 3MAQA 4BE1A 1RBUA 3NF9A 1ZBLA 2WOMA 2YKMA 3ZT2A 2Y8LA 1YQKA 3AVNA 3LALA 1UAXA 2D1KA 2DFEA 2QWMA 4CJQA 2WC9A 3SAGA 1NJZA 5BMNA 4B08A 4FPBA 1LXTA 4GKKK 2JWLA 1VQ8N 1T6DA 4TSXA 1RT5A 4FOEA 1NGDA 1RT1A 2CGLA 4DSEA 1UL7A 4O5FA 3KK1A 3JAMO 5EX5A 4FPAA 4B3OA 1YIJN 2P9IA 3V9XA 4KREA 4CFAA 1NG9A 4FJ7A 4J2EA 4FJ8A 4LF8K 1RT6A 3L0QA 2R5XA 3SK3A 3ID6A 3HL8A 2RPIA 3ZSRA 3CXCM 4N41A 1IH7A 4A5AA 4ILJA 2NOLA 4JHDA 3ATUA 4WQ5C 3ULEB 2YA3A 2BGGA 4DWIA 1N6QA 3KLIA 4EP5A 3T7ZA 1RM1A 1D4XA 5AN4A 1JXEA 4DU1A 5C10A 4FYDA 3BF1A 3GL1A 3E9PA 5C15A 4DSFA 5JMVA 2P9PB 5M1OA 4FWNA 3SCXA 4H5TA 1RDCA 3D7EO 3PV8A 4FK0A 4Q11A 3OW2M 4AH9A 4EJZA 3O1WA 5KGWA 3MCAB 3TTCA 4RW4A 3A0IX 1N32K 5FROA 3SQ1A 3A5NC 1N5YA 3LP0A 3TE5A 5J2NA 4FJGA 3OSTA 2GWJA 4C7PA 1NBWA 1VSLA 4CGGA 4CZKA 4X66K 1RT4A 3THXB 1FKOA 2ZWHA 5AQYA 4JD2B 1HQUA 2VG7A 2E2NA 5EPCA 2AP1A 1JL2A 5AJ3K 3HPGA 1YVNA 3VTHA 4DUYK 4DS5A 5EU7A 3FZHA 1XNRK 4M42A 4KRFA 4GY2B 3F73A 2HKPA 2HBLA 1IO2A 3CVSA 3C6AA 1KSPA 4CHQA 3B8AX 4H5NA 2P5OA 1DTTA 1UA0A 3HS9A 1VTOA 4CJ3A 3EE8A 4BRIA 3L4QA 4V19S 4KAZA 3V9SA 3A5OC 5K14A 5M1QA 4J2DA 3IH7A 3O4QA 3KVGA 3ATVA 4UQGA 1M5Q1 4OGCA 3C94A 1TK5A 3PO5A 1TKXA 3L3VA 3AVLA 2JOIA 4WQ4C 5KQDA 3SQ0A 3NF6A 2AA4A 4MLHA 3F9KA 4A57A 4YDUC 1BCOA 4B9QA 2E2PA 3CCMN 3LP3A 4BC2A 3ENCA 2CGJA 1N8RO 2NNWA 4IJNA 3DAWA 2F8TA 3SUQA 1WSHA 4H4OA 1J54A 4CJWA 3IMXA 2PZSA 3OSMA 1C0MA 1BISA 2IVNA 2KFNA 1RILA 3KKSA 2YI1A 2OPQA 4CGFA 4DTXA 3HO1A 5J1EA 3PX0A 2O4IA 4NXNK 2EX3A 2ZQBA 3NF7A 2HHHK 2EHGA 2UXCK 2Q1NA 4CHZA 1NGIA 1NKCA 3VQBA 5MLCQ 4OPAA 1SKSA 4CJ7A 1YQLA 2ASOA 2HBMA 1VRTA 3DLEA 3FFIA 4EALA 4BVOA 4IO8A 4CVNE 4YFUA 3HSTB 2O4GA 5AQQA 4H0XB 4R79A 3KLHA 2NOEA 4ICLA 4IEEA 1KRPA 3U6FA 3CF5L 5BN9A 1M90O 2G8WA 1KD1O 2YHAA 3OYAA 3ITHA 2ITMA 1NK6A 3NVKA 3EYZA 4PHTX 2Q0RA 2GWKA 2HZSA 1S1UA 1IG8A 2Q0UA 1ZBSA 1RBSA 2G8IA 1SL1A 3MDQA 4KHYA 2HMPA 4JK8A 2V52B 4FO0A 3D2FA 4JNEA 1HNWK 5KL0A 4YOXA 4JI5K 4OLBA 3OYFA 5LL6Z 4KHPK 2ZFDB 1C9BB 3ZX3A 4F3TA 4OX9K 1NMNA 3J81O 3K5OA 4HTLA 5ADXH 3MK6A 2FUVA 1EKEA 1S22A 3H45C 4A5BA 1HYSA 3VEVA 3E9OA 4EAKA 3NFAA 3WT0A 1T05A 5BRFA 4FM0A 3HVTA 4B0AA 2HHXA 1JLEA 1Z05A 4QG5A 1RT2A 1G99A 2VYPA 2CH5A 3H46O 3TR8A 1I94K 3VQ8A 4HVJA 2ASPA 1QZ6A 2UUAK 2O8CA 3J8AA 4N56A 4PL8A 3WEEA 3HJFA 3HYFA 4A59A 4CHOA 4A61A 4I9QA 4MO5A 4DR6K 4BRAA 3HOTA 3TSQA 4RCHA 4F8RA 1BIZA 4JKHA 3ZSOA 3ZEUA 1C0UA 4CE9A 3VN5A 1GLJO 4AM7A 2IGIA 1KAXA 3AA2A 3TSUA 5T7BA 4FJ5A 1NJXA 4IEIA 2P51A 4FWMA 3I55N 4JI8K 2YH5A 4RW8A 4DSJA 5F1XA 3N4PA 5F9CA 1NGJA 4AILC 1NJIO 2GUPA 1Z25A 4IKFA 3L2RA 4M7YA 4CEAA 4MRQA 1RTJA 2QWQA 5AQIA 2YCHA 4G9ZA 2FBXA 1CLQA 4XIUA 3CCUN 4M3UA 2HBJA 2IOCA 1W2BM 4E7HA 1GLDG 5E84A 2D0BA 4IO9L 3V4IA 2NRHA 3KJVA 5C24A 3AAQA 1VOKA 4DHYA 1LV5A 3MEEA 4DSKA 1RDUA 2G8FA 1KY6A 1BWFO 1KFIA 4AHRA 4OJRA 3LP2A 1TK8A 1NK0A 4CJUA 1C0GA 4N76A 4BC3A 1NK8A 4LY7A 3VEYA 3LPTA 3VQ5A 1JCGA 4CESA 3SLCA 2RN2A 3H1QA 4Z0UA 1TV6A 3E1YA 3HP6A 1YTUA 4AHSA 1QTPA 2HF4A 2P9PA 3VQAA 4EAIA 1L3TA 5B8HA 4D7QA 1RT3A 4CBUA 3K5MA 2QWOA 4W5RA 3GOIA 3TU5A 5HOOA 4FWQA 5AR0A 1OVYA 3KWGA 3B6PA 3DRRA 3QESA 3K2PA 1TUYA 4RTFD 1VQKN 3VGMA 4IBNA 3AARA 4FSVA 4WFNL 2IAJA 5F0XA 4JEPA 2GUIA 4A62A 3KLFA 3THXA 4WE1A 2UYTA 4JD2A 4GVMA 5C25A 4DV7K 1ASVA 1V5SA 4KBOA 1SKWA 1BIUA 3PSFA 3NGZA 2A42A 4K0KK 2RHKA 1TGOA 2PWWA 1EWRA 2NRZA 3I8DA 3CCVN 3QERA 4CJRA 3V6DA 3EL2A 3F0ZA 4KI6A 4B1YB 1TUOA 4B3MK 1S72N 3A5MC 1NJYA 4E7KA 3DLKA 1KC8O 2NRWA 1V4TA 1S1VA 5AQLA 4CZFA 4YHHK 1ATSA 2GV9A 5AQUA 3S9HA 3OYKA 2HNDA 3P83D 4EP4A 3RRHA 2FSJA 1WAFA 3IDHA 3CWAA 1JXBA 2E20A 1YI2N 1IBMK 4DQPA 3DPTA 3SYZA 3WNEA 3M6GA 2XY8A 1VQ5N 4B9UA 4FJLA 2ASMA 4BR0A 2X6SA 1C4GA 3LDNA 2YHWA 4XH4A 5AFUH 4CJPA 4U67L 5AQVA 3VMFB 4BGAA 3RMCA 3ZSVA 3IUCA 1CZ9A 5JN5A 1JL1A 4B3TK 4QAGA 3EEQA 4FM1A 1ATRA 1VSKA 1LOTB 3HVRA 1SS6A 4FJKA 2OPPA 2VG6A 3J7AP 2HSTA 3LZJA 2IC3A 4FM2A 4CIFA 4JKBA 3QB0A 2ZM6K 4DTSA 1TGHA 4DR3K 2QW9A 1TYQB 1KVBA 4ROCB 5DM7L 4O5BA 3MMVA 3OS0A 3D45A 5FPMA 1T8EA 4IZ9A 1QQCA 3CQYA 4CD1A 3ZSXA 2UXDK 2R7YA 1S1WA 4CZHA 2HZMA 2LAEA 1FN7A 3DRPA 4B1WB 2F7TA 4E19A 5LMNK 3WXJA 4PL7A 1NOYA 3SUNA 4CGIA 3R3LA 4H0PA 2E4LA 3AVHA 3L6QA 3DLHA 1IKWA 3DLLL 3OBWA 4H0TB 4CZGA 3AVGA 1RFQA 2W40A 3LANA 5BREA 3D2EB 3FR0A 4OLAA 3AVKA 1W7AA 2QWPA 4I9LA 4B1ZA 4IOCL 4IOXA 3UE5A 3KK2A 4H03B 2VQEK 4B9MA 4NLBA 1EP4A 1HMVA 3G6EN 1ITGA 2E6MA 3PO4A 3SUOA 2E5LK 4JI1K 5ELZA 1VRUA 3AA3A 4DLEA 3M3ZA 2VWKA 4X64K 4O55A 3VPZA 3IS9A 3AVBA 3AVMA 3BY5A 2WTUA 4CF9A 1QN3A 3EZWA 4NYFA 5M1PA 4C8MA 1CXUA 3ZT3A 4F9OA 4CJEA 4FJXA 5AFUA 4WZSD 3BF3A 3RRGA 4B9LA 3TAQA 4JS5A 4CECA 5I42A 5CY4A 3T1HK 3DYAA 3LP1A 4Y0WA 1T3VA 4D7RA 2Z8UA 1TKDA 4DS4A 4CERA 2YJEA 4C8KA 4BRMA 3OYBA 1SKRA 3VQ4A 4M3TA 2HF3A 2QM1A 4BE0A 3NCIA 1VSHA 3OA9A 3DOKA 4KH6A 4FLVA 1OH8A 4LH5A 4KO0A 3L8BA 4JRQA 4CEQA 2D4WA 2O3OA 2YKNA 3CETA 2H4LX 4GV9A 4B3RK 2IVPA 1UA1A 1YQMA 1LWEA 4CIGA 1VSMA 1EXQA 5BR9A 3RTVA 4N5SA 3SAFA 2IIRA 1LWCA 3H6EA 4OPHA 2A5XA 3CCJN 3U4LA 1NK7A 5TKWA 3C95A 1OKJA 3CCLN 3PIOL 3BEXA 2FXUA 2PYJA 1XMQK 3QFUA 2I7PA 1XC3A 1U04A 1R0AA 1QTMA 3CHWA 2F9TA 3ZLJA 1WN7A 1NK9A 3T69A 1QE1A 4HCBA 1RDWX 3A2FA 4F4KA 2Q2RA 3OYIA 1B9FA 3BZKA 3G0ZA 4JI3K 2W6KA 5BRHA 4YOYA 5SWMA 3QNOA 1B92A 3OYNA 1RTHA 2D0CA 1CXQA 4FJ9A 3L2VA 4A2AA 2KW4A 2VG5A 4CHPA 1QVFM 4CF8A 1C1CA 1NGFA 4LF9K 4NCAA 3U3YA 1QN9A 4FW2A 2BANA 3CFRA 4LH4A 4Z4HA 4CZMA 5IYDP 4XH5A 1EBMA 2YX6A 3MCPA 3WUHA 4E1NA 3O4WA 5KPTA 1K73O 4FLUA 2W6LA 1J6ZA 3PLAA 4ID5A 2G8HA 2X78A 2Q31A 5FRNA 2XO7A 4BE2A 4YY3K 2G8VA 1WOQA 3OTOK 3ZSQA 2OYQA 3THYB 4IWVA 1Z26A 1KVAA 1Q7YO 4ELVA 3KZBA 3CC2N 2ZF5O 2IVOA 3ENHA 4H5WA 4IFVA 1NKEA 4FLXA 4LF7K 3NGYA 3RSMA 3IFRA 3HPHA 2BUPA 3BKQX 3K9KA 3U8XA 4BREA 3L3UA 1VQMN 3JXUA 4BR5A 3D4VA 4E1MA 1TK0A 1TAQA 3CFOA 4WF9L 2IV8A 4CFFA 1A5WA 2D5RA 1Y97A 1NGEA 5FLXO 1NM1A 3F5TA 1WSIA 3ENBA 4MQ3A 2RKIA 4BWMA 4FK4A 3LPUA 1RDBA 3ENOA 1WJWA 4LF4K 3V1RA 3ZYYX 3P4IA 1MP9A 2ATQA 3PX4A 1JLBA 1JLFA 5JS2A 4F2RA 1TL3A 1BG3A 1Q8IA 4OKJA 1LWVA 3O3FA 4CIEA 3UB5A 1C1BA 2Q3SA 1D8YA 1KCFA 1QS4A 3SUPA 4CBXA 2RE2A 3QLHA 4K41A 1HNVA 4BG8A 5GAGP 4CK2A 4IG0A 3K9JA 4ELTA 1RBRA 4I7FA 1BQMA 5J2MA 3TWHA 1VQNN 3HS8A 4FJNA 1XI1A 1P5DX 1TYQA 1QNBA 2QWRA 5CYMA 3DJCA 1HNZK 4I8OA 4QCLA 2OZSA 4CK3A 3CQXA 5AQFA 3CM6A 1NGAA 3A8YA 4BQZA 3CERA 1RNHA 4DLGA 1XWLA 1O13A 5HRNA 4EAGA 3DLBA 1HQEA 4FK2A 4RG8A 3ZT4A 2E8AA 4IXCA 4K43A 4TPSA 4H4MA 4H8KA 4JLHA 1NNEA 1ZC6A 4BC4A 4CZEA 3MWTA 3LL3A 4CF0A 1GLCG 2RF2A 2A41A 2O8BB 3PUFA 3NH2A 1WBBA 4L8RB 3C6TA 1NK4A 4KHQA 3DLGA 3VF6A 3SZ2A 4OGEA 2QXLA 1VAZA 4H0YB 2F9WA 1DGKN 1YITN 1IBKK 4CF2A 4IDKA 3VA3A 2ZJPL 5AQMA 1RTIA 3MN5A 1E3MA 4ISEA 2Y1JA 3CC4N 3QEVA 4WXAA 1EX4A 1YHQN 1LW2A 4EAJA 3AO1A 4DTJA 3OVNA 4DTRA 1C0FA 2QXFA 4DR7K 4OPKA 2UUCK 3TI0A 3GDQA 1RDDA 2P5GA 3VENA 3T1AA 2P9SB 4DULA 3E01A 3H08A 4DR5K 3TAFA 3VQCA 4YOUA 4FLZA 4B9VA 1U2VB 1OH7A 2DKAA 4KHSA 3THWB 3TANA 4DTOA 1N36K 3VEWA 3EY1A 1NMDA 1DT9A 5GIPA 3GG4A 3QEXA 4DTMA 1GOBA 3MWPA 3O8MA 5AQZA 2A1RA 3O1BA 5GIOA 3SI6A 2O8EB 1WNSA 4CZLA 3NA5A 1J5EK 4DFKA 4CEBA 1BI4B 2B5JA 1UT4A 4M45A 3PSIA 2PFUA 1JKHA 2PAVA 1VSEA 4C8OA 1L3VA 1WSGA 5AZIB 4CHNA 1NGCA 4PQUA 3JSMA 2HB5A 1X1PA 4I6MB 1QTSA 1K2YX 5DK5A 4G1QA 4KTQA 1RDAA 1CZAN 4KHNA 3EKSA 2A6AA 1BUPA 4ISFA 1T7PA 3RMAA 5JLFA 4MFBA 3MN7A 4PA1A 4M7XA 1KLMA 3SQ2A 1XHZA 4NCGA 4C1NI 1U49A 2Y1IA 3AVCA 4WQ5A 3ZX0A 2B4JA 3HM8A 4EZ9A 1FK9A 2MZ8A 3G10A 2FKFA 3HP9A 2JLEA 3SV3A 1JDYA 4KH4A 1WSJA 3WQTA 1BGXT 1D5AA 3CC7N 2YHBA 4QOZB 2YJFA 1GLFO 3G4SN 1KXPA 4FZZA 3VQ7A 1K8KB 2Q36A 4PY5A 4BRQA 1SL0A 2FBVA 3P31A 3AA4A 1KY7A 1X3MA 3WXIA 1VTLE 4M63C 5CZ1A 2HNZA 3OJSA 1YT3A 1C6VA 3EKUA 2FF3B 3V9UA 2HOEA 1K9MO 3S3MA 4JV5K 3U3GA 1HNXK 3CCEN 3CWUA 3LAKA 2BH1A 5HL7L 2HHWA 3UKUB 4BDYA 1YQRA 2IS3A 5CE3A 3O9RA 1KFQA 1K6YA 2UU9K 2PY5A 3I33A 3TAEA 1X3NA 3QEIA 1EUVA 2YNHA 2NUBA 2GTDA 3RVCA 1X9SA 1X9JA 3L2QA 1K8AO 3THYA 1UWBA 1XNQK 3MXMA 3ALYA 4BRFA 3HT3A 2HHTA 2NRVA 1S3XA 3DXKB 4JKFA 5F2RA 3NH1A 2QKKA 4LSLA 4FJHA 3ULEA 4FLYA 3TARA 2J4RA 2PYLA 1U45A 3DXMB 3H3NO 4ILGB 4O4GA 3TAMA 1B9DA 1E42A 4DR2K 1S1XA 3SV4A 5KQ8A 4DSLA 4DF8A 4BRNA 4CJ5A 3BP8A 4CEZA 3FGUA 1HRHA 3SPZA 2IDOA 2VWJA 1R59O 1SV5A 4HUGA 1G15A 3VEZA 3R1XA 4C8NA 3C6HA 3LM2A 4M3ZA 2D0PA 3HBTA 2DPNA 1NGBA 2CGKA 3LM9A 4XH1A 5J2QA 2JWKA 3Q7BA 3K5NA 3PDKA 1BL3A 2YNFA 5KTQA 3ZX2A 2NWVA 3OY9A 4DV2K 3HK2A 4EHTA 2KFZA 1XHXA 4YDUA 4AHUA 4DFJA 4J2AA 1YF5L 3SNSA 4DU3A 4U7BA 4DTUA 4H0OA 1KQSM 3KLGA 4B9TA 3IAYA 1TUUA 1NOZA 2YV0X 3CQ8A 2OA8A 1RTDA 1XQSC 2KTQA 4IJAA 5H1SQ 4J2BA 2GX9A 4B1UB 3RSEB 1QQOA 2QWNA 1HKBA 3TTFA 1U4BA 4X65K 3F2KA 3OYDA 5LJWA 1VQON 1PVSA 3QBWA 2V51B 2NOHA 4ZTJA 3J7YP 2Y8QA 1M1KO 2IV9A 5IWAK 2VJ0A 2H5AX 2B6AA 1JLQA 1NGHA 4C1NK 3LWLA 1MPGA 4HUEA 3D0PA 1NWKA 3CJ9A 3T19A 4DKWA 4RW9A 1JLCA 4RW6A 3AO3A 4CJ4A 3GE1A 3WNHA 4H5RA 3P1GA 5C2FA 1SZ2A 4HJHA 4AF1A 4W5OA 1HR0K 4QS7A 1MDUB 1NLVA 1Y64A 3NBPA 5AQPA 3SPYA 5AQRA 1P5GX 1LWFA 2HMIA 2YNGA 2O8BA 3LDQA 4YNQA 3FZKA 3CI5A 4CW7B 3ULDA 1J9AA 3ULXA 4EZ6A 4KHUA 4FWKA 3I0SA 3NMUA 4Z4IA 2HNYA 2DFHA 1DKGD 5EVZA 4NCBA 3TDHA 4M3RA 2OANA 3KK7A 4AHVA 2KKZA 4GV6A 3NF8A 4KV8A 4ELUA 3MEDA 2W42A 1QN4A 4I2PA 1TBAB 3M1FA 1M3HA 3VF4A 1GLLO 1YXQA 4BG9A 4RODB 1QN6A 4ZHRA 3VEXA 1QZ5A 4IL8A 2P9SA 5SZTA 1ESVA 3L4IA 2MJ7A 1VSFA 1XC9A 2V7YA 2YHXA 1NJWA 3THVA 3UIQA 3S3OA 4W5NA 1U2VA 2FF6A 5IYBP 3THWA 3VQDA 4CBWA 4BR2A 3QBXA 3DM2A 2DKDA 1DIZA 3MX2A 1MWMA 5KPRA 2X6NA 4BRDA 4DV3K 2XY5A 2HVIA 1U47A 1NGMA 4ROEB 1T44A 2P9NB 5I9EB 1XUPO 1Q86O 1JCFA 2NLXA 4Z4CA 4DV6K 2O8EA 5AQHA 3ZCMA 4FJJA 3ENOC 4FWPA 3OH9A 1BI4A 4F2SA 1YVUA 1T03A 3NDKA 3OYGA 2G8UA 4JN4A 3VA0A 1LAWA 4E89A 2EHBD 4CZJA 3CYMA 4B3SK 4I6MA 4FVUA 1J53A 3AVIA 3OYHA 3TTDA 2P9KB 2OOXA 2NOIA 3G25A 4CJLA 1WLJA 4E7JA 4FLWA 2XY7A 3C7NB 3O3HA 3CW7A 3MN6A 4K8ZA 3LDOA 2FSNA 4Y1DA 4B9SA 4DR1K 1N39A 3HOSA 2QA4N 1VKLA 1VOLB 1REVA 1B9KA 3QMLA 1JCEA 4Q5VA 4UY8O 2A40A 4X62K 1K8KA 3HM9A 4FCYA 5HLFA 1C47A 1RCHA 3QO9A 3CFPA 1DEJA 5KGXA 3CCQN 1BHLA 5AQKA 4AHCA 1NK5A 3IRXA 4M41A 1KYDA 1OH5A 4N47A 4BC5A 3VTIA 3WNGA 3PY8A 3M8SA 4DUZK 3CVTA 2ZJRL 3WNFA 3OH6A 4DR4K 1W9HA 1EWQA 4Q0BA 3RMBA 3EIKA 3IKMA 1ILYA 2WONA 2WUSA 3HI0A 4J8FA 1L3UA 3RPJA 3OC3C 5TKYA 1BQNA 5EOYA 4O8KA 2F4VK 1D3UA 5HSHA 4BY9C 4FZXC 3EO3A 1NU0A 3CIPA 3SMPA 2QRCA 4Y1CA 4C23A 1NVPA 1PCZA 2V8QA 1F21A 3DXKA 3LDLA 1JFIC 4KB0A 2FKMX 3V1QA 2O8DB 1ASWA 5AQJA 4DQQA 2HL8A 4NXMK 2HHUA 3NAEA 5AQTA 3SJHA 4BDPA 1YTFA 1GLEG 3DXMA 3FLCO 5FPNA 1DLOA 3FZMA 4EAHD 2ITGA 3OYLA 4DQSA 4DQIA 3I56N 3CWSA 4CK1A 3VEOA 1HPZA 2O8CB 3AV9A 2NLVA 3AO5A 3SAHA 3P39A 3CG7A 3EZ5A 3ZT1A 1FKPA 3V9ZA 4DV1K 1NGGA 3OJUA 2ZD1A 1ZBFA 4LD0A 4CI6A 4FOIA 1S1TA 5FRMA 3SNNA 1IKYA 3CJ7A 5KRSA 5GADP 1TVRA 1V4SA 4K42A 1VQ9N 4PKHA 3DRSA 5EY4A 4JKCA 5CYQA 3VESA 4BVPA 1R4XA 1MA9B 4WCEL 4BROA 3KHYA 4LSNA 3KD1E 3TPQA 1KLNA 3RWUA 4DV4K 4FWLA 1PCMX 4CEFA 4FLTA 1S9EA 4JRPA 3S41A 1BOTO 5EXWA 3CCSN 3T4NA 2KHOA 2P9LB 1D9DA 3RSEA 1YJ9N 5JVGL 3SBTA 3N89A 4H5VA 3L2WA 5AQNA 3MX5A 5FDLA 5HP1A 2I5WA 2KQ2A 3C6UA 4H0VB 3I0RA 3PIPL 1HJOA 4CEEA 3A5LC 3QNNA 3QICA 1O1WA 4BRLA 5HRSA 4OPJA 3TAPA 2NRTA 2GELA 2OPSA 1BCMA 3OBYA 2WBNA 2F96A 3VOVA 1HYZA 2HL9A 5JICA 5KPZA 5M1NA 5C42A 5BR8K 2AJQA 3TABA 4DB3A 3P38A 1N3CA 5C12A 3HPOA 1S6PA 3H1ZA 2KZMA 5IT9O 4FL9A 4K8XA 1QN7A 4FVMA 5LY3A 4QS8A 3HTVA 3QIOA 3QDKA 3SMSA 1TBPA 3OGDA 1T6AA 4M3YA 3D7QA 1QHAA 3IG1A 4KTZA 4CGJA 3DOLA 1KAZA 3EE9A 2Z1IA 4DQ8A 4L3QA 2E6LA 3U9DA 2DTUA 3M8PA 4ISGA 3K58A 5BPNA 3O4NA 2JGUA 2HBKA 2E2QA 1WAJA 4BWJA 1NH2A 5D3GA 1VSJA 4Z4GA 2QRDA 1VQLN 3NE6A 2NOFA 1RT7A 1BDGA 1IKVA 2NRXA 4O8UA 3UKRB 2YNIA 3LDSA 4C8LA 1XSZA 1NKBA 3QIPA 3CPEA 5AQGA 2E2OA 3NVMA 4BR9A 1QVGM 2GEMA 4YOVA 4ID1A 1LCUA 3BZCA 3ZETB 3KLEA 1XMOK 1UOCA 2OPRA 4WX8A 1IV0A 4AM6A 2PBDA 3OHRA 4WFBL 3OYMA 3U9ZA 4BDZA 4O0IA 3D2EA 2DY4A 3VQ9A 1VQPN 4IFYA 5JMVD 3KIOA 3ZSZA 3WXLA 2P9NA 4DU4A 3NHGA 1JLAA 1GOCA 3LAMA 4MDBA 4AHTA 3B6OA 4DTPA 1VQ7N 2JPIA 3W3DA 5C2DA 3F9MA 3R8EA 1KYFA 1ZBHA 3BDPA 4FZYA 1VK0A 3H3OB 2XY6A 4DFMA 1CZBA 3MEGA 4BACA 4ILHA 2VCPA 3AVFA 3CJ1A 2H3GX 4YOWA 3SBGA 5FPEA 4A2BA 5KRTA 4GW6A 3M5RA 2P9KA 2I7NA 3C7NA 1Q18A 1A5VA 1EETA 3RR7A 3TAGA 3OLPA 3AGKA 5AQSA 4PKGA 3AO2A 3VQEA 4DG1A 4HCCA 4EFHA 4EJYA 4W5TA 4K25A 2QLVA 4AQYK 2VGNA 2A1SA 1A5XA 2VQFK 4E7LA 4OKEA 1KAYA 5CR4A 2D0AA 5I3UA 4E0DA 4M3WA 2Z1HA 1C0TA 1LW0A 5FPDA 5E26A 2OZMA 4BRPA 1SQKA 3AAPA 3EAYA 3DI6A 2G30A 3JS6A 4JYAK 3CMEN 5KI6A 3K57A 4DTNA 5BRDA 1W0HA 3AGRA 3KRMA 3O9UA 4NB4A 3OS1A 1VQ4N 1K35A 4DQRA 3CD6N 1HPMA 4CJVA 1LWWA 2KZZA 2GBZA 3CJCA 3OS2A 3M8RA 4RWTA 4HWIA 5BPMA 1Q9XA 3O08A 2OCEA 2P9UB 4FWSA 1IBLK 1S9GA 2JHNA 1QQMA 2VWBA 3ZSYA 5AZJB 3VGLA 4BRGA 3DPUA 2UUBK 3GBTA 1BO5O 4DSIA 2O8DA 1W80A 3NGIA 4YOTA 2ETJA 1MWKA 4CFBA 3QEPA 4FJMA 3T1YK 1HLUA 5DM6L 2BTFA 2ZGZA 3FFKB 3KD5E 1C1AA 2E88A 5M1KA 4Z4FA 1WUAA 4FWRA 1D9FA 1KVCA 4BRHA 4CF1A 3S3NA 2BE2A 3I8BA 2V92A 3ISNC 3QFPA 3HSCA 1YAGA 2HHQA 5E41A 4DV5K 1TKTA 1L5UA 5AQXA 2X74A 4KTWA 3ZT0A 3OCIA 1EQYA 3PMGA 1TKZA 3CJBA 4OO1J 1QN5A 1KO9A 4I2QA 1HX1A 2O8FB 1H1VA 4BRKA 3O3GA 2F8SA 4EIAA 5J2PA 3OYEA 5LMUK 2HHVA 1IJJA 4CEDA 2YHYA 2ZJQL 3R9PA 5GAEP 4M3XA 2FLOA 1JJ2M 2HVHA 3SJJA 4MDAA 1L3SA 1QNAA 4E7IA 4IDHA 1TL1A 1VSDA 1QQNA 2P9LA 1WB9A 4PUOA 2F7LA 4JKGB 4GVEA 2Q97A 4EHUA 3CPWM 4DV0K 2UXBK 1P90A 1GLAG 2HW3A 1HNIA 4JKDA 1EO1A 3KTUA 2ZE2A 4BQLA 3J80O 1VSIA 4RW7A 3L2UA 3LZIA 1KFSA 1CDWA 1U6ZA 3J7ZO 1ATNA 4JAXA 3O9QA 1KYUA 2ZGYA 4NYNA 4CD3A 2OTLN 2VGMA 2XRIA 1U48A 1OVQA 2BDPA 3OSEA 3DMJA 3E66A 5GINA 3VF2A 3CJAA 4YORA 4KI4A 5JS1A 4CFDA 1LWYA 4WQ4A 3C0BA 4CEOA 5ADXA 3G71N 3CWTA 4BR4A 4KPYA 3CCRN 3O9SA 1QHTA 4CFCA 5GAHP 4LFBK 4GKJK 4CJKA 3ID8A 4KB1A 1YTAA 1W97L 1GLBG 3WXMB 1WQAA 1BA0A 2V9JA 4GMJB 4BRCA 3UW2A 3R6MA 3C04A 4OKKA 3ZSWA 1J3MA 4IG3A 1Q9UA 2NRRA 5C0YA 2P9IB 5A2QO 2JHJA 3O9TA 3LDPA 3AY9A 3UKRA 3VETA 4DF4A 1WBDA 3MECA 5AQOA 1N33K 3FZFA 3WXKA 4DCHA 1ZYQA 4E1JA 3D6RA 1DTQA 1ZBUA 1UT7A 3OYCA 4JK7A 4O44A 3BGRA 3VGKA 4HTUA 4GNIA 1QSYA 1N34K 4GV3A 4JHDB 5CZ2A 4KFBA 5HRPA 2A3ZA 2WFBA 1KTQA 3RMDA 4PKIA 4KH5A 1SL2A 3ZETA 3DLRA 5JVHL 4F3OA 4B8AB 4FWOA 5AQWA 4IFEA 2NZTA 1I39A 1HKCA 3M8QA 5M1FA 1RBVA 3C65A 5DMRA 2FBTA 3HZ6A 1ZBIA 4JI4K 5IYCP 3CM5A 4PWDA 3OYJA 4DFPA 2HHSA 2E1YA 5HROA 2DKCA 1T6CA 4CJTA 4CGDA 2P1JA 3QINA 4E3SA 1I3AA 3HXMA 3CMAN 3P5JA 1RBTA 1HJRA 1BU6O 3FZLA 3SQ4A 1WSEA 1M3QA 3NH0A 1E4FT 1Z6RA 1JLGA 3AA5X 4B8CA 4QS9A 2QREA 1SUQA 2QWLA 2D0OA 3MXIA 1X9MA 4FJIA 1S5JA 3QEWA 1J5OA 1SAZA 2Z1GA 3MN9A 2E1ZA 4W5QA 3KKRA 3MXJA 4FW1A 2OTJN 4JK9A 4JS4A 4CGHA 3O6WA 4CCHA 4JKEA 2FGTA 3V9WA 3AO4A 1X9WA 3AVAA 1LAVA 1IKXA 1FJGK 1YJNN 3Q7CA 1TAUA 3WQUA 2QTDA 1Q9YA 4JI0K 4WFAL 1FXXA 4CZIA 3N4QA 3V1OA 2EWSA 4O0JA 5HBMA 2Z0FA 2V7ZA 2FSKA 3VQQA 4OVLA 4CJFA 1HKGA 4DMNA 3O5BA 5JLHA 2QEXN 2CH6A 5AZIA 2XHBA 2FC0A 1YUWA 2I5JA 4JI2K 4ZTFA 3BUZB 2FBYA 3I0WA 1QSLA 1YTBA 3FE1A 2P9UA 4B9NA 2KLAA 4KHWA 1FW6A 4MLEA 4R5PA 2W41A 1WSFA 2QK9A 5BMPA 3VQPA 1OH6A 5AZJA 4KKOA 4BR7A 2G8KA 1S6QA 4Z4EA 1N3AA 3JYTA 5BPLA 4LF6K 1HUXA 1VHXA 1QN8A 3DWLA 2OOYA 3H1VX 4NO7A 3V81A 2DFFA 2QR1A 3E9LA 4FXDA 4HUFA 4B1VA 2QKBA 2LSNA 1QNEA 5BN8A 4NLCA 3AVJA 3LWMA 1BA1A
chains in the Genus database with same CATH topology
1T7PA 1S1VA 2E6LA 4CHYA 3RMAA 2DTUA 3M8PA 4MFBA 5HRRA 3K58A 2GV9A 4PA1A 3S9HA 3O4NA 2JGUA 1KLMA 3SQ2A 1XHZA 4NCGA 1WAJA 4BWJA 1U49A 2Y1IA 3AVCA 3KTQA 3OYKA 2B4JA 1NH2A 1HU0A 4EZ9A 1HYVA 2HNDA 1FK9A 2MZ8A 1VSJA 2Z1JA 3G10A 3HP9A 3P83D 5D3GA 2JLEA 4Z4GA 4EP4A 3NE6A 2NOFA 3K5LA 1RT7A 3SV3A 3RRHA 1IKVA 1WSJA 2YNIA 2XHIA 1BGXT 1D5AA 3LDSA 1AISA 1WAFA 2YHBA 4C8LA 4QOZB 1NKBA 1JXBA 3QIPA 4FZZA 4DQPA 3VQ7A 3DPTA 4PY5A 3SYZA 3WNEA 2XY8A 4B9UA 4FJLA 1SL0A 2FBVA 2X6SA 1KY7A 3AA4A 4CJPA 1VTLE 1IG9A 5CZ1A 2HNZA 3OJSA 3RR8A 1YT3A 1C6VA 3KK3A 3V9UA 3RMCA 3VQ6A 1YTUA 3ZSVA 4ID1A 1CZ9A 1GOAA 3KLEA 2NOBA 1UOCA 3T3FA 2OPRA 1JL1A 1QSSA 4QAGA 4FM1A 1VSKA 3S3MA 2NOZA 3OYMA 3U3GA 3HVRA 1KFDA 3I0XA 3QETA 2OPPA 4FJKA 3K59A 2VG6A 3LZJA 4BDZA 1ASUA 4O0IA 3F10A 3LAKA 4HHTA 2HHWA 2IC3A 3VQ9A 4CIFA 4FM2A 2DY4A 4BDYA 1YQRA 2IS3A 4IFYA 4DTSA 1TGHA 3KIOA 1K6YA 4CJSA 3ZSZA 2PY5A 1QNCA 1KVBA 3TAEA 3PX6A 4DU4A 4ROCB 3NHGA 3QEIA 2YNHA 2NUBA 1JLAA 4O5BA 1GOCA 3LAMA 1X9SA 4AHTA 1MU2A 3OS0A 3D45A 3B6OA 3L2QA 3ASMA 4DTPA 1UWBA 1PZDA 1T8EA 3MXMA 3ALYA 3HT3A 3HK2A 1QQCA 1KYFA 3MAQA 1RBUA 3NF9A 4BE1A 2WOMA 3ZSXA 1ZBLA 3BDPA 4FZYA 2R7YA 1S1WA 1VK0A 2XY6A 2YKMA 3ZT2A 4DFMA 1YQKA 1CZBA 3AVNA 3LALA 3MEGA 4BACA 3NH1A 3AVFA 2QKKA 2HZMA 4LSLA 4FJHA 1UAXA 2LAEA 1FN7A 3DRPA 2DFEA 4FLYA 3TARA 4CJQA 4E19A 5KRTA 1NOYA 1CLQA 2PYLA 3SUNA 4GW6A 4CGIA 1U45A 1NJZA 4O4GA 2E4LA 3TAMA 4B08A 3AVHA 3DLHA 1B9DA 1E42A 1S1XA 1IKWA 3SV4A 4DSLA 4DF8A 4TSXA 1RT5A 4CJ5A 1A5VA 3AVGA 1EETA 1RT1A 3LANA 4CEZA 4OLAA 3AVKA 4DSEA 3RR7A 1HRHA 3SPZA 2IDOA 4DG1A 1SV5A 2VWJA 3KK1A 3AO2A 3VQEA 3TAGA 4HCCA 4HUGA 4I9LA 4EJYA 1G15A 4W5TA 4B3OA 4C8NA 3V9XA 4M3ZA 4KREA 2A1SA 4CFAA 5J2QA 4J2EA 4FJ7A 4FJ8A 3KK2A 1RT6A 4B9MA 1EP4A 1HMVA 3K5NA 1A5XA 4E7LA 1BL3A 1ITGA 2E6MA 2YNFA 4OKEA 3PO4A 5KTQA 3HL8A 2D0AA 2RPIA 5I3UA 3SUOA 3ZSRA 3OY9A 4N41A 1VRUA 1IH7A 3AA3A 4DLEA 4E0DA 4M3WA 2Z1HA 1C0TA 1LW0A 2VWKA 4FJMA 2KFZA 1XHXA 2NOLA 2OZMA 4O55A 3IS9A 4AHUA 4DFJA 2BGGA 3AVBA 3AVMA 4J2AA 4DWIA 1N6QA 3SNSA 3DI6A 3KLIA 1QN3A 4CF9A 4DU3A 4EP5A 2G30A 4NYFA 4DTUA 4C8MA 1CXUA 3ZT3A 4CJEA 4B9TA 5KI6A 3KLGA 3K57A 3IAYA 4FJXA 4WZSD 1RM1A 4DTNA 1W0HA 3KRMA 1NOZA 2YV0X 3OS1A 3RRGA 5AN4A 4B9LA 3CQ8A 3TAQA 4JS5A 4CECA 5I42A 4DQRA 1RTDA 1JXEA 5CY4A 4DU1A 2OA8A 4FYDA 2KTQA 3DYAA 3LP1A 4J2BA 4CJVA 4DSFA 1LWWA 2KZZA 2Z8UA 2GBZA 3OS2A 1TKDA 4DS4A 4CERA 3SCXA 4C8KA 3OYBA 3M8RA 1SKRA 3VQ4A 4M3TA 1RDCA 4BE0A 3PV8A 3NCIA 1Q9XA 1VSHA 4FK0A 4Q11A 1U4BA 4AH9A 4EJZA 3OYDA 5KGWA 3DOKA 4FLVA 4LH5A 1S9GA 4RW4A 4L8RB 2NOHA 4KO0A 4ZTJA 2IV9A 5FROA 3SQ1A 2VJ0A 3ZSYA 3L8BA 4JRQA 4CEQA 1N5YA 2B6AA 1JLQA 3LP0A 3DPUA 3LWLA 2O3OA 2YKNA 5J2NA 4HUEA 3D0PA 4FJGA 3OSTA 4DSIA 1W80A 1VSLA 3NGIA 3T19A 2ETJA 4CGGA 4RW9A 1JLCA 1RT4A 4RW6A 4CFBA 3QEPA 1FKOA 1YQMA 3AO3A 4CJ4A 1HQUA 1UA1A 3WNHA 2VG7A 1LWEA 4CIGA 1JL2A 1VSMA 3KD5E 3HPGA 3P1GA 1EXQA 3RTVA 4N5SA 1C1AA 4W5OA 4Z4FA 1LWCA 4DS5A 5EU7A 3NBPA 3SPYA 1D9FA 1KVCA 4CF1A 3S3NA 4M42A 2BE2A 1NK7A 4KRFA 3F73A 3C95A 1LWFA 2HMIA 1IO2A 2YNGA 3ISNC 4YNQA 2HHQA 2PYJA 5E41A 1TKTA 1L5UA 3ULDA 1J9AA 2X74A 1U04A 1KSPA 4CHQA 1R0AA 1QTMA 3ULXA 4EZ6A 4KTWA 2P5OA 1WN7A 3ZT0A 3OCIA 1NK9A 1DTTA 4KHUA 1TKZA 1UA0A 3I0SA 3HS9A 1QE1A 1VTOA 4HCBA 4CJ3A 1QN5A 2HNYA 4Z4IA 3A2FA 4F4KA 1KO9A 4I2QA 2DFHA 4NCBA 3OYIA 1B9FA 4M3RA 3O3GA 3G0ZA 2F8SA 4AHVA 4KAZA 5J2PA 3V9SA 3OYEA 3NF8A 5SWMA 5K14A 2HHVA 4KV8A 4ELUA 4J2DA 3IH7A 3MEDA 3O4QA 1QN4A 4CEDA 1B92A 2W42A 3QNOA 4I2PA 4UQGA 1TBAB 4OGCA 3C94A 1M3HA 1TK5A 3PO5A 3OYNA 4M3XA 1TKXA 1RTHA 2D0CA 1CXQA 4FJ9A 4RODB 3L3VA 3AVLA 1QN6A 4ZHRA 3L2VA 2HVHA 2JOIA 3SJJA 1L3SA 1QNAA 4E7IA 3SQ0A 3NF6A 1TL1A 2KW4A 2VG5A 3F9KA 4CHPA 5SZTA 1VSDA 2MJ7A 1C1CA 1VSFA 1BCOA 4CF8A 1XC9A 1NJWA 4NCAA 3THVA 4PUOA 3UIQA 3S3OA 3LP3A 4W5NA 3U3YA 1QN9A 4FW2A 5IYBP 2BANA 3VQDA 3CFRA 2F8TA 4LH4A 3SUQA 4Z4HA 1WSHA 5IYDP 1J54A 4H4OA 1EBMA 3DM2A 4CJWA 1HNIA 3OSMA 1C0MA 2PZSA 2HW3A 1BISA 4E1NA 3KTUA 2ZE2A 2KFNA 1RILA 2HHTA 3KKSA 4FLUA 1VSIA 2X6NA 4RW7A 3L2UA 3LZIA 2OPQA 1CDWA 4CGFA 4DTXA 2XY5A 2HVIA 1U47A 4ID5A 1NGMA 3HO1A 2G8HA 4ROEB 2X78A 5J1EA 3PX0A 5FRNA 2XO7A 4BE2A 2O4IA 1KYUA 2EX3A 2ZQBA 3NF7A 4FCYA 2EHGA 4NYNA 2G8VA 4CHZA 4Z4CA 2XRIA 1U48A 3ZCMA 3ZSQA 3VQBA 1NKCA 2BDPA 2OYQA 4FJJA 1SKSA 3DMJA 1YQLA 1Z26A 4F2SA 1BI4A 1KVAA 3DLEA 3FFIA 1VRTA 4ELVA 4KI4A 1YVUA 5JS1A 4CFDA 1LWYA 4YFUA 4IFVA 1NKEA 3HSTB 2O4GA 4CEOA 1T03A 3NDKA 4FLXA 3OYGA 3NGYA 3KLHA 2G8UA 4KPYA 2NOEA 4ICLA 3VA0A 1QHTA 3HPHA 1LAWA 4CFCA 4E89A 3CYMA 1KFSA 1KRPA 4CJKA 3U6FA 3L3UA 4KB1A 1YTAA 4KI6A 1J53A 3AVIA 3OYHA 2G8WA 2NOIA 4CJLA 2YHAA 1WLJA 4E1MA 4FLWA 4E7JA 2XY7A 1TAQA 3OYAA 3ITHA 1TK0A 1NK6A 3CFOA 4GMJB 2IV8A 3EYZA 3O3HA 1A5WA 2D5RA 1Y97A 4OKKA 3ZSWA 4K8ZA 2HZSA 1S1UA 4Y1DA 1WSIA 4B9SA 4IG3A 1N39A 4MQ3A 1RBSA 2G8IA 2RKIA 1SL1A 4BWMA 4FK4A 3LPUA 4KHYA 1RDBA 1VOLB 1REVA 1B9KA 4DF4A 3MECA 3V1RA 4Q5VA 1ZYQA 1MP9A 2ATQA 3PX4A 1DTQA 4OLBA 1JLBA 1UT7A 1JLFA 1ZBUA 3HM9A 3OYCA 5JS2A 3OYFA 1TL3A 4O44A 1RCHA 3QO9A 3BGRA 3CFPA 1Q8IA 4F2RA 1C9BB 4HTUA 4OKJA 1LWVA 5KGXA 3O3FA 1QSYA 4F3TA 1BHLA 4CIEA 4AHCA 1C1BA 4KFBA 5CZ2A 5HRPA 2Q3SA 1NK5A 3IRXA 4M41A 1D8YA 1KCFA 1QS4A 1KYDA 3K5OA 3SUPA 1KTQA 4N47A 3RMDA 1EKEA 1HYSA 3QLHA 1SL2A 3NFAA 3DLRA 4F3OA 4B8AB 3WNGA 4FM0A 1T05A 3HVTA 3PY8A 3M8SA 4B0AA 1HNVA 2HHXA 1JLEA 1I39A 4CK2A 4IG0A 3M8QA 3TR8A 1RT2A 1RBVA 5DMRA 3WNFA 2FBTA 3VQ8A 1ZBIA 1W9HA 1RBRA 4ELTA 5IYCP 4HVJA 4I7FA 3CM5A 4Q0BA 4PWDA 1BQMA 3OYJA 5J2MA 3RMBA 3TWHA 3HS8A 3EIKA 4DFPA 4N56A 3HJFA 2HHSA 3HYFA 4FJNA 2WONA 1XI1A 4CHOA 4I9QA 1L3UA 1QNBA 3RPJA 3OC3C 5CYMA 1BQNA 5HROA 4I8OA 1D3UA 4FZXC 4F8RA 2OZSA 1BIZA 4CK3A 4QCLA 4CJTA 3ZSOA 4CE9A 1C0UA 3CM6A 2P1JA 3QINA 3VN5A 4Y1CA 1I3AA 4CGDA 4E3SA 1NVPA 3HXMA 1PCZA 1RNHA 2IGIA 1XWLA 3AA2A 3P5JA 1RBTA 5HRNA 4DLGA 1HJRA 5T7BA 4FJ5A 1F21A 1NJXA 1JFIC 3SQ4A 1HQEA 3DLBA 4KB0A 4FK2A 2P51A 4RG8A 3ZT4A 3V1QA 2YH5A 1WSEA 4RW8A 4DSJA 1M3QA 3NH0A 1ASWA 1JLGA 4DQQA 3AA5X 4AILC 2HHUA 4B8CA 3NAEA 4TPSA 4H4MA 4BDPA 1SUQA 1Z25A 3L2RA 4IKFA 1YTFA 4H8KA 3MXIA 1X9MA 4FJIA 4JLHA 1DLOA 1S5JA 4CEAA 2ITGA 3OYLA 5HLFA 3QEWA 4DQSA 4DQIA 1RTJA 4CF0A 1J5OA 2Z1GA 4CK1A 1HPZA 4W5QA 3AV9A 3KKRA 2RF2A 3MXJA 3AO5A 4FW1A 3PUFA 3CG7A 3NH2A 3EZ5A 2FBXA 3C6TA 3ZT1A 1FKPA 4CGHA 4JS4A 4XIUA 3V9ZA 1NK4A 4CCHA 3DLGA 4KHQA 4M3UA 2FGTA 2IOCA 3V9WA 3OJUA 3SZ2A 4E7HA 1ZBHA 2ZD1A 1ZBFA 4LD0A 4OGEA 2D0BA 1S1TA 3V4IA 5FRMA 3AO4A 1X9WA 3AVAA 1LAVA 3SNNA 1IKXA 4CF2A 4IDKA 1IKYA 5C24A 3KJVA 3VA3A 1VOKA 1RTIA 5KRSA 1TAUA 1Q9YA 2Y1JA 1TVRA 1LV5A 3MEEA 3QEVA 4DSKA 1FXXA 1EX4A 2G8FA 1KY6A 3V1OA 3DRSA 1LW2A 4AHRA 5CYQA 4O0JA 3AO1A 5HBMA 4DTJA 3OVNA 3LP2A 1R4XA 2QXFA 4OJRA 3VQQA 4OVLA 4DTRA 4CJFA 4CJUA 1TK8A 1NK0A 4N76A 3KD1E 4LSNA 4DMNA 4OPKA 1NK8A 4LY7A 3TI0A 3LPTA 3VQ5A 1KLNA 3RWUA 4CESA 1RDDA 2RN2A 2P5GA 4Z0UA 1TV6A 2XHBA 3T1AA 2FC0A 2I5JA 3HP6A 4CEFA 4FLTA 1S9EA 4DULA 3E01A 3H08A 4JRPA 3TAFA 4AHSA 4ZTFA 1QTPA 3VQCA 3VQAA 2FBYA 4FLZA 1D9DA 4B9VA 3I0WA 3N89A 1QSLA 3L2WA 4KHSA 1YTBA 3TANA 4DTOA 1L3TA 1RT3A 3K5MA 4W5RA 5FDLA 3EY1A 5HP1A 4B9NA 4KHWA 2I5WA 2KQ2A 3C6UA 3I0RA 4R5PA 2QK9A 1WSFA 3QEXA 4DTMA 3B6PA 4CEEA 1GOBA 3DRRA 3VQPA 3QESA 3K2PA 3QNNA 4KKOA 1O1WA 4IBNA 2A1RA 2IAJA 5HRSA 4OPJA 3TAPA 3SI6A 2OPSA 2G8KA 1BCMA 1S6QA 1N3AA 2F96A 2GUIA 1HYZA 1WNSA 3KLFA 3JYTA 4Z4EA 5C42A 2AJQA 4DFKA 4WE1A 3HPOA 3TABA 1N3CA 4GVMA 4CEBA 1BI4B 3H1ZA 1S6PA 5C25A 2KZMA 1ASVA 2B5JA 1UT4A 1QN8A 1SKWA 4M45A 1BIUA 3NGZA 4K8XA 1QN7A 4FVMA 1JKHA 1VSEA 4C8OA 3V81A 2DFFA 1TGOA 1L3VA 1WSGA 3QIOA 4CHNA 4PQUA 3I8DA 3JSMA 4FXDA 2HB5A 1TBPA 1X1PA 4HUFA 1QTSA 3QERA 5DK5A 2QKBA 4CJRA 2LSNA 3V6DA 3F0ZA 4G1QA 3IG1A 4CGJA 4KTQA 1QNEA 4KTZA 3DOLA 4M3YA 1RDAA 1NJYA 4E7KA 4KHNA 3AVJA 3DLKA 3LWMA 2Z1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7P A;  1S1V A;  2E6L A;  4CHY A;  3RMA A;  2DTU A;  3M8P A;  4MFB A;  5HRR A;  3K58 A;  2GV9 A;  4PA1 A;  3S9H A;  3O4N A;  2JGU A;  1KLM A;  3SQ2 A;  1XHZ A;  4NCG A;  1WAJ A;  4BWJ A;  1U49 A;  2Y1I A;  3AVC A;  3KTQ A;  3OYK A;  2B4J A;  1NH2 A;  4EZ9 A;  1HYV A;  2HND A;  1FK9 A;  1VSJ A;  2Z1J A;  3G10 A;  3HP9 A;  3P83 D;  5D3G A;  4Z4G A;  2JLE A;  4EP4 A;  3NE6 A;  3K5L A;  3RRH A;  1RT7 A;  3SV3 A;  1IKV A;  1WSJ A;  2YNI A;  1BGX T;  1D5A A;  3LDS A;  1AIS A;  1WAF A;  2YHB A;  4C8L A;  4QOZ B;  1NKB A;  1JXB A;  3QIP A;  4FZZ A;  4DQP A;  3VQ7 A;  4PY5 A;  3SYZ A;  3WNE A;  2XY8 A;  4B9U A;  4FJL A;  1SL0 A;  2FBV A;  2X6S A;  1KY7 A;  3AA4 A;  4CJP A;  1VTL E;  1IG9 A;  5CZ1 A;  2HNZ A;  3OJS A;  3RR8 A;  1YT3 A;  1C6V A;  3KK3 A;  3V9U A;  3RMC A;  3VQ6 A;  1YTU A;  3ZSV A;  4ID1 A;  1CZ9 A;  1GOA A;  3KLE A;  3T3F A;  1UOC A;  2OPR A;  1JL1 A;  1QSS A;  4QAG A;  4FM1 A;  1VSK A;  3S3M A;  3OYM A;  3U3G A;  3HVR A;  1KFD A;  3QET A;  4FJK A;  2OPP A;  3K59 A;  2VG6 A;  3LZJ A;  4BDZ A;  1ASU A;  4O0I A;  3LAK A;  4HHT A;  2HHW A;  2IC3 A;  3VQ9 A;  4CIF A;  4FM2 A;  2DY4 A;  4BDY A;  2IS3 A;  4IFY A;  4DTS A;  1TGH A;  3KIO A;  1K6Y A;  4CJS A;  3ZSZ A;  2PY5 A;  1QNC A;  1KVB A;  3TAE A;  3PX6 A;  4DU4 A;  4ROC B;  3NHG A;  3QEI A;  2YNH A;  2NUB A;  1JLA A;  4O5B A;  1GOC A;  3LAM A;  1X9S A;  4AHT A;  1MU2 A;  3OS0 A;  3D45 A;  3B6O A;  3L2Q A;  3ASM A;  4DTP A;  1UWB A;  1PZD A;  1T8E A;  3MXM A;  3ALY A;  3HT3 A;  2HHT A;  1QQC A;  1KYF A;  3MAQ A;  1RBU A;  3NF9 A;  4BE1 A;  2WOM A;  3ZSX A;  1ZBL A;  3BDP A;  4FZY A;  2R7Y A;  1S1W A;  1VK0 A;  2XY6 A;  2YKM A;  3ZT2 A;  4DFM A;  1CZB A;  3AVN A;  3LAL A;  3MEG A;  4BAC A;  3NH1 A;  3AVF A;  2QKK A;  4LSL A;  4FJH A;  1UAX A;  3DRP A;  2DFE A;  4FLY A;  3TAR A;  4CJQ A;  4E19 A;  5KRT A;  1NOY A;  1CLQ A;  2PYL A;  3SUN A;  4GW6 A;  4CGI A;  1U45 A;  1NJZ A;  4O4G A;  2E4L A;  3TAM A;  4B08 A;  3AVH A;  3DLH A;  1B9D A;  1E42 A;  1S1X A;  1IKW A;  3SV4 A;  4DSL A;  4DF8 A;  4TSX A;  1RT5 A;  4CJ5 A;  1A5V A;  3AVG A;  1EET A;  1RT1 A;  3LAN A;  4CEZ A;  4OLA A;  3AVK A;  4DSE A;  3RR7 A;  1HRH A;  3SPZ A;  2IDO A;  4DG1 A;  1SV5 A;  2VWJ A;  3KK1 A;  3AO2 A;  3VQE A;  3TAG A;  4HCC A;  4HUG A;  4I9L A;  1G15 A;  4W5T A;  4B3O A;  4C8N A;  3V9X A;  4M3Z A;  4KRE A;  2A1S A;  4CFA A;  5J2Q A;  4J2E A;  4FJ7 A;  4FJ8 A;  3KK2 A;  1RT6 A;  4B9M A;  1EP4 A;  1HMV A;  3K5N A;  1A5X A;  4E7L A;  1BL3 A;  1ITG A;  2E6M A;  2YNF A;  4OKE A;  3PO4 A;  5KTQ A;  3HL8 A;  2D0A A;  2RPI A;  5I3U A;  3SUO A;  3ZSR A;  3OY9 A;  4N41 A;  1VRU A;  1IH7 A;  3AA3 A;  4DLE A;  4E0D A;  4M3W A;  2Z1H A;  1C0T A;  1LW0 A;  2VWK A;  3HK2 A;  2KFZ A;  1XHX A;  2OZM A;  4O55 A;  3IS9 A;  4AHU A;  4DFJ A;  2BGG A;  3AVB A;  3AVM A;  4J2A A;  4DWI A;  1N6Q A;  3DI6 A;  3KLI A;  1QN3 A;  4CF9 A;  4DU3 A;  4EP5 A;  2G30 A;  4NYF A;  4DTU A;  4C8M A;  1CXU A;  3ZT3 A;  4CJE A;  4B9T A;  5KI6 A;  3KLG A;  3K57 A;  3IAY A;  4FJX A;  4WZS D;  1RM1 A;  4DTN A;  1W0H A;  1NOZ A;  2YV0 X;  3OS1 A;  3RRG A;  4B9L A;  3CQ8 A;  3TAQ A;  4JS5 A;  4CEC A;  5I42 A;  4DQR A;  1RTD A;  1JXE A;  5CY4 A;  4DU1 A;  2OA8 A;  4FYD A;  2KTQ A;  3DYA A;  3LP1 A;  4J2B A;  4CJV A;  4DSF A;  2KZZ A;  2Z8U A;  2GBZ A;  3OS2 A;  1TKD A;  4DS4 A;  4CER A;  3SCX A;  4C8K A;  3OYB A;  3M8R A;  1SKR A;  3VQ4 A;  4M3T A;  1RDC A;  4BE0 A;  3PV8 A;  3NCI A;  1Q9X A;  1VSH A;  4FK0 A;  1U4B A;  4AH9 A;  3OYD A;  5KGW A;  3DOK A;  4FLV A;  4LH5 A;  1S9G A;  4RW4 A;  4L8R B;  4KO0 A;  4ZTJ A;  2IV9 A;  5FRO A;  3SQ1 A;  2VJ0 A;  3ZSY A;  3L8B A;  4JRQ A;  4CEQ A;  1N5Y A;  2B6A A;  1JLQ A;  3LP0 A;  3LWL A;  2YKN A;  5J2N A;  4HUE A;  3D0P A;  4FJG A;  4DSI A;  1W80 A;  1VSL A;  3NGI A;  3T19 A;  2ETJ A;  4CGG A;  4RW9 A;  1JLC A;  1RT4 A;  4RW6 A;  4CFB A;  3QEP A;  1FKO A;  3AO3 A;  1UA1 A;  4CJ4 A;  1HQU A;  4FJM A;  3WNH A;  2VG7 A;  1LWE A;  4CIG A;  1JL2 A;  1VSM A;  3KD5 E;  3HPG A;  3P1G A;  1EXQ A;  3RTV A;  4N5S A;  1C1A A;  4W5O A;  4Z4F A;  1LWC A;  4DS5 A;  5EU7 A;  3NBP A;  3SPY A;  1D9F A;  1KVC A;  4CF1 A;  3S3N A;  4M42 A;  2BE2 A;  1NK7 A;  4KRF A;  3F73 A;  3C95 A;  1LWF A;  2HMI A;  1IO2 A;  2YNG A;  3ISN C;  4YNQ A;  2HHQ A;  2PYJ A;  5E41 A;  1TKT A;  1L5U A;  3ULD A;  1J9A A;  2X74 A;  1U04 A;  1KSP A;  4CHQ A;  1R0A A;  1QTM A;  4EZ6 A;  4KTW A;  2P5O A;  1WN7 A;  3ZT0 A;  3OCI A;  1NK9 A;  1DTT A;  4KHU A;  1TKZ A;  1UA0 A;  3I0S A;  3HS9 A;  1QE1 A;  1VTO A;  4HCB A;  4CJ3 A;  1QN5 A;  2HNY A;  4Z4I A;  3A2F A;  4F4K A;  4I2Q A;  2DFH A;  4NCB A;  3OYI A;  1B9F A;  4M3R A;  3O3G A;  3G0Z A;  2F8S A;  4AHV A;  4KAZ A;  5J2P A;  3V9S A;  3OYE A;  3NF8 A;  5SWM A;  5K14 A;  2HHV A;  4KV8 A;  4ELU A;  4J2D A;  3MED A;  3O4Q A;  4CED A;  1QN4 A;  2W42 A;  1B92 A;  3QNO A;  4I2P A;  4UQG A;  1TBA B;  4OGC A;  3C94 A;  1TK5 A;  3PO5 A;  3OYN A;  4M3X A;  1TKX A;  1RTH A;  2D0C A;  1CXQ A;  4FJ9 A;  4ROD B;  3L3V A;  3AVL A;  1QN6 A;  4ZHR A;  3L2V A;  2HVH A;  3SJJ A;  1L3S A;  1QNA A;  4E7I A;  3SQ0 A;  3NF6 A;  2KW4 A;  1TL1 A;  2VG5 A;  3F9K A;  4CHP A;  5SZT A;  1VSD A;  2MJ7 A;  1C1C A;  1VSF A;  1BCO A;  4CF8 A;  1XC9 A;  1NJW A;  4NCA A;  3THV A;  4PUO A;  3UIQ A;  3S3O A;  3LP3 A;  4W5N A;  3U3Y A;  1QN9 A;  4FW2 A;  5IYB P;  2BAN A;  3VQD A;  3CFR A;  2F8T A;  4LH4 A;  3SUQ A;  4Z4H A;  1WSH A;  5IYD P;  1J54 A;  4H4O A;  3DM2 A;  4CJW A;  2PZS A;  1HNI A;  1C0M A;  2HW3 A;  1BIS A;  4E1N A;  2ZE2 A;  2KFN A;  1RIL A;  3KKS A;  4FLU A;  1VSI A;  2X6N A;  4RW7 A;  3L2U A;  3LZI A;  2OPQ A;  1CDW A;  4CGF A;  4DTX A;  2XY5 A;  2HVI A;  1U47 A;  4ID5 A;  1NGM A;  3HO1 A;  2G8H A;  4ROE B;  2X78 A;  5J1E A;  3PX0 A;  5FRN A;  2XO7 A;  4BE2 A;  2O4I A;  1KYU A;  2EX3 A;  2ZQB A;  3NF7 A;  2EHG A;  4NYN A;  2G8V A;  4CHZ A;  4Z4C A;  2XRI A;  1U48 A;  3ZCM A;  3ZSQ A;  3VQB A;  1NKC A;  2BDP A;  2OYQ A;  4FJJ A;  1SKS A;  3DMJ A;  1Z26 A;  4F2S A;  1BI4 A;  1KVA A;  3DLE A;  3FFI A;  1VRT A;  4ELV A;  4KI4 A;  1YVU A;  5JS1 A;  4CFD A;  4YFU A;  4IFV A;  1NKE A;  3HST B;  2O4G A;  4CEO A;  1T03 A;  3NDK A;  4FLX A;  3OYG A;  3NGY A;  3KLH A;  2G8U A;  4KPY A;  4ICL A;  3VA0 A;  1QHT A;  3HPH A;  1LAW A;  4CFC A;  4E89 A;  3CYM A;  1KFS A;  1KRP A;  4CJK A;  3U6F A;  3L3U A;  4KB1 A;  1YTA A;  1J53 A;  3AVI A;  3OYH A;  2G8W A;  4CJL A;  2YHA A;  1WLJ A;  4E1M A;  4FLW A;  4E7J A;  2XY7 A;  1TAQ A;  3OYA A;  3ITH A;  1TK0 A;  1NK6 A;  3CFO A;  4GMJ B;  2IV8 A;  3EYZ A;  3O3H A;  1A5W A;  2D5R A;  1Y97 A;  4OKK A;  3ZSW A;  4K8Z A;  1S1U A;  4Y1D A;  1WSI A;  4B9S A;  4IG3 A;  4MQ3 A;  1RBS A;  2G8I A;  2RKI A;  1SL1 A;  4BWM A;  4FK4 A;  3LPU A;  4KHY A;  1RDB A;  1VOL B;  1REV A;  1B9K A;  4DF4 A;  3MEC A;  3V1R A;  4Q5V A;  1ZYQ A;  1MP9 A;  2ATQ A;  3PX4 A;  1DTQ A;  4OLB A;  1JLB A;  1ZBU A;  1JLF A;  4FCY A;  3HM9 A;  3OYC A;  5JS2 A;  3OYF A;  1TL3 A;  4O44 A;  1RCH A;  3QO9 A;  3BGR A;  3CFP A;  1Q8I A;  4F2R A;  1C9B B;  4HTU A;  4OKJ A;  5KGX A;  3O3F A;  1QSY A;  4F3T A;  1BHL A;  4CIE A;  4AHC A;  1C1B A;  4KFB A;  5CZ2 A;  5HRP A;  2Q3S A;  1NK5 A;  3IRX A;  4M41 A;  1D8Y A;  1KCF A;  1QS4 A;  1KYD A;  3K5O A;  3SUP A;  1KTQ A;  4N47 A;  3RMD A;  1EKE A;  1HYS A;  3QLH A;  1SL2 A;  3NFA A;  3DLR A;  4F3O A;  4B8A B;  3WNG A;  4FM0 A;  1T05 A;  3HVT A;  3PY8 A;  3M8S A;  4B0A A;  1HNV A;  2HHX A;  1JLE A;  1I39 A;  4CK2 A;  4IG0 A;  3M8Q A;  3TR8 A;  1RT2 A;  1RBV A;  5DMR A;  3WNF A;  2FBT A;  3VQ8 A;  1ZBI A;  1W9H A;  1RBR A;  4ELT A;  5IYC P;  4HVJ A;  4I7F A;  3CM5 A;  4Q0B A;  4PWD A;  1BQM A;  3OYJ A;  5J2M A;  3RMB A;  3TWH A;  3HS8 A;  3EIK A;  4DFP A;  4N56 A;  3HJF A;  2HHS A;  3HYF A;  4FJN A;  2WON A;  1XI1 A;  4CHO A;  4I9Q A;  1L3U A;  1QNB A;  3OC3 C;  5CYM A;  1BQN A;  5HRO A;  1D3U A;  4FZX C;  4F8R A;  2OZS A;  1BIZ A;  4CK3 A;  4QCL A;  4CJT A;  3ZSO A;  4CE9 A;  1C0U A;  3CM6 A;  2P1J A;  3QIN A;  3VN5 A;  4Y1C A;  1I3A A;  4CGD A;  4E3S A;  1NVP A;  3HXM A;  1PCZ A;  1RNH A;  2IGI A;  1XWL A;  3AA2 A;  3P5J A;  1RBT A;  5HRN A;  4DLG A;  1HJR A;  5T7B A;  4FJ5 A;  1F21 A;  1NJX A;  1JFI C;  3SQ4 A;  1HQE A;  3DLB A;  4KB0 A;  4FK2 A;  2P51 A;  4RG8 A;  3ZT4 A;  3V1Q A;  1WSE A;  4RW8 A;  4DSJ A;  3NH0 A;  1ASW A;  1JLG A;  4DQQ A;  3AA5 X;  4AIL C;  2HHU A;  4B8C A;  3NAE A;  4H4M A;  4BDP A;  1SUQ A;  1Z25 A;  3L2R A;  4IKF A;  1YTF A;  4H8K A;  3MXI A;  1X9M A;  4FJI A;  4JLH A;  1DLO A;  1S5J A;  4CEA A;  2ITG A;  3OYL A;  5HLF A;  3QEW A;  4DQS A;  4DQI A;  1RTJ A;  4CF0 A;  1J5O A;  2Z1G A;  4CK1 A;  1HPZ A;  4W5Q A;  3AV9 A;  3KKR A;  2RF2 A;  3MXJ A;  3AO5 A;  4FW1 A;  3PUF A;  3CG7 A;  3NH2 A;  3EZ5 A;  2FBX A;  3C6T A;  3ZT1 A;  1FKP A;  4CGH A;  4JS4 A;  4XIU A;  3V9Z A;  1NK4 A;  4CCH A;  3DLG A;  4KHQ A;  4M3U A;  2IOC A;  3V9W A;  3OJU A;  3SZ2 A;  4E7H A;  1ZBH A;  2ZD1 A;  1ZBF A;  4LD0 A;  4OGE A;  2D0B A;  1S1T A;  3V4I A;  5FRM A;  3AO4 A;  1X9W A;  3AVA A;  1LAV A;  3SNN A;  1IKX A;  4CF2 A;  4IDK A;  1IKY A;  5C24 A;  3KJV A;  3VA3 A;  1VOK A;  1RTI A;  5KRS A;  1TAU A;  1Q9Y A;  2Y1J A;  1TVR A;  1LV5 A;  3MEE A;  3QEV A;  4DSK A;  1FXX A;  1EX4 A;  2G8F A;  1KY6 A;  3V1O A;  3DRS A;  1LW2 A;  4AHR A;  5CYQ A;  4O0J A;  3AO1 A;  5HBM A;  4DTJ A;  3OVN A;  3LP2 A;  1R4X A;  2QXF A;  4OJR A;  3VQQ A;  4OVL A;  4DTR A;  4CJF A;  4CJU A;  1TK8 A;  1NK0 A;  4N76 A;  3KD1 E;  4LSN A;  4DMN A;  4OPK A;  1NK8 A;  4LY7 A;  3TI0 A;  3LPT A;  3VQ5 A;  1KLN A;  3RWU A;  4CES A;  1RDD A;  2RN2 A;  2P5G A;  4Z0U A;  1TV6 A;  2XHB A;  3T1A A;  2FC0 A;  2I5J A;  3HP6 A;  4CEF A;  4FLT A;  1S9E A;  3H08 A;  3E01 A;  4JRP A;  3TAF A;  4ZTF A;  4AHS A;  1QTP A;  3VQC A;  3VQA A;  2FBY A;  4FLZ A;  1D9D A;  4B9V A;  1QSL A;  3L2W A;  4KHS A;  1YTB A;  3TAN A;  4DTO A;  1L3T A;  1RT3 A;  3K5M A;  4W5R A;  5FDL A;  3EY1 A;  5HP1 A;  4B9N A;  4KHW A;  2KQ2 A;  3C6U A;  3I0R A;  4R5P A;  2QK9 A;  1WSF A;  3QEX A;  4DTM A;  3B6P A;  4CEE A;  1GOB A;  3DRR A;  3VQP A;  3QES A;  3K2P A;  3QNN A;  4KKO A;  1O1W A;  4IBN A;  2A1R A;  2IAJ A;  5HRS A;  4OPJ A;  3TAP A;  3SI6 A;  2OPS A;  2G8K A;  1BCM A;  1S6Q A;  2GUI A;  2F96 A;  3KLF A;  1HYZ A;  1WNS A;  4Z4E A;  3JYT A;  5C42 A;  2AJQ A;  4DFK A;  4WE1 A;  3HPO A;  3TAB A;  4CEB A;  4GVM A;  1BI4 B;  3H1Z A;  1S6P A;  5C25 A;  2KZM A;  1ASV A;  2B5J A;  1QN8 A;  1SKW A;  4M45 A;  1BIU A;  3NGZ A;  4K8X A;  1QN7 A;  4FVM A;  1JKH A;  1VSE A;  4C8O A;  3V81 A;  2DFF A;  1TGO A;  1L3V A;  1WSG A;  3QIO A;  4CHN A;  4PQU A;  3I8D A;  3JSM A;  4FXD A;  2HB5 A;  1TBP A;  1X1P A;  4HUF A;  1QTS A;  3QER A;  5DK5 A;  2QKB A;  4CJR A;  2LSN A;  3V6D A;  4G1Q A;  4KTQ A;  3IG1 A;  4CGJ A;  4KI6 A;  1QNE A;  4KTZ A;  3DOL A;  4M3Y A;  1RDA A;  1NJY A;  4E7K A;  4KHN A;  3AVJ A;  3DLK A;  3LWM A;  2Z1I A; 
#chains in the Genus database with same CATH topology
 4CHY A;  5HRR A;  3VER A;  5CHI A;  3K0S A;  4XEI A;  3KTQ A;  4JI6 K;  3UKU A;  4MO4 A;  1HU0 A;  1HYV A;  2Z1J A;  3KWI A;  4B1X B;  3K5L A;  2O8F A;  2XHI A;  3D2F B;  1AIS A;  3W0L A;  4JKA A;  1Q82 O;  4Z94 A;  2NVM A;  4JI7 K;  4BJU A;  1IG9 A;  4BGB A;  3RR8 A;  4LFC K;  3KK3 A;  3VQ6 A;  1GOA A;  3T3F A;  2NOB A;  1ZXO A;  4LF5 K;  1YJW N;  1QSS A;  4LFA K;  1Q81 O;  3TSP A;  2NOZ A;  4JKG A;  4WYB A;  1KFD A;  3I0X A;  3HRG A;  3QET A;  3K59 A;  1ASU A;  3I3W A;  3F10 A;  4LC9 B;  4HHT A;  3EN9 A;  1PCJ X;  3WEE B;  4CJS A;  5LJV A;  1QNC A;  3PX6 A;  3O80 A;  4IOA L;  1MU2 A;  1E4G T;  3ZEU B;  3ASM A;  2QI2 A;  1VQ6 N;  1P8Z A;  1RGI A;  1PZD A;  3MAQ A;  4BE1 A;  1RBU A;  3NF9 A;  1ZBL A;  2WOM A;  2YKM A;  3ZT2 A;  2Y8L A;  1YQK A;  3AVN A;  3LAL A;  1UAX A;  2D1K A;  2DFE A;  2QWM A;  4CJQ A;  2WC9 A;  3SAG A;  1NJZ A;  5BMN A;  4B08 A;  4FPB A;  1LXT A;  4GKK K;  2JWL A;  1VQ8 N;  1T6D A;  4TSX A;  1RT5 A;  4FOE A;  1NGD A;  1RT1 A;  2CGL A;  4DSE A;  1UL7 A;  4O5F A;  3KK1 A;  3JAM O;  5EX5 A;  4FPA A;  4B3O A;  1YIJ N;  2P9I A;  3V9X A;  4KRE A;  4CFA A;  1NG9 A;  4FJ7 A;  4J2E A;  4FJ8 A;  4LF8 K;  1RT6 A;  3L0Q A;  2R5X A;  3SK3 A;  3ID6 A;  3HL8 A;  2RPI A;  3ZSR A;  3CXC M;  4N41 A;  1IH7 A;  4A5A A;  4ILJ A;  2NOL A;  4JHD A;  3ATU A;  4WQ5 C;  3ULE B;  2YA3 A;  2BGG A;  4DWI A;  1N6Q A;  3KLI A;  4EP5 A;  3T7Z A;  1RM1 A;  1D4X A;  5AN4 A;  1JXE A;  4DU1 A;  5C10 A;  4FYD A;  3BF1 A;  3GL1 A;  3E9P A;  5C15 A;  4DSF A;  5JMV A;  2P9P B;  5M1O A;  4FWN A;  3SCX A;  4H5T A;  1RDC A;  3D7E O;  3PV8 A;  4FK0 A;  4Q11 A;  3OW2 M;  4AH9 A;  4EJZ A;  3O1W A;  5KGW A;  3MCA B;  3TTC A;  4RW4 A;  3A0I X;  1N32 K;  5FRO A;  3SQ1 A;  3A5N C;  1N5Y A;  3LP0 A;  3TE5 A;  5J2N A;  4FJG A;  3OST A;  2GWJ A;  4C7P A;  1NBW A;  1VSL A;  4CGG A;  4CZK A;  4X66 K;  1RT4 A;  3THX B;  1FKO A;  2ZWH A;  5AQY A;  4JD2 B;  1HQU A;  2VG7 A;  2E2N A;  5EPC A;  2AP1 A;  1JL2 A;  5AJ3 K;  3HPG A;  1YVN A;  3VTH A;  4DUY K;  4DS5 A;  5EU7 A;  3FZH A;  1XNR K;  4M42 A;  4KRF A;  4GY2 B;  3F73 A;  2HKP A;  2HBL A;  1IO2 A;  3CVS A;  3C6A A;  1KSP A;  4CHQ A;  3B8A X;  4H5N A;  2P5O A;  1DTT A;  1UA0 A;  3HS9 A;  1VTO A;  4CJ3 A;  3EE8 A;  4BRI A;  3L4Q A;  4V19 S;  4KAZ A;  3V9S A;  3A5O C;  5K14 A;  5M1Q A;  4J2D A;  3IH7 A;  3O4Q A;  3KVG A;  3ATV A;  4UQG A;  1M5Q 1;  4OGC A;  3C94 A;  1TK5 A;  3PO5 A;  1TKX A;  3L3V A;  3AVL A;  2JOI A;  4WQ4 C;  5KQD A;  3SQ0 A;  3NF6 A;  2AA4 A;  4MLH A;  3F9K A;  4A57 A;  4YDU C;  1BCO A;  4B9Q A;  2E2P A;  3CCM N;  3LP3 A;  4BC2 A;  3ENC A;  2CGJ A;  1N8R O;  2NNW A;  4IJN A;  3DAW A;  2F8T A;  3SUQ A;  1WSH A;  4H4O A;  1J54 A;  4CJW A;  3IMX A;  2PZS A;  3OSM A;  1C0M A;  1BIS A;  2IVN A;  2KFN A;  1RIL A;  3KKS A;  2YI1 A;  2OPQ A;  4CGF A;  4DTX A;  3HO1 A;  5J1E A;  3PX0 A;  2O4I A;  4NXN K;  2EX3 A;  2ZQB A;  3NF7 A;  2HHH K;  2EHG A;  2UXC K;  2Q1N A;  4CHZ A;  1NGI A;  1NKC A;  3VQB A;  5MLC Q;  4OPA A;  1SKS A;  4CJ7 A;  1YQL A;  2ASO A;  2HBM A;  1VRT A;  3DLE A;  3FFI A;  4EAL A;  4BVO A;  4IO8 A;  4CVN E;  4YFU A;  3HST B;  2O4G A;  5AQQ A;  4H0X B;  4R79 A;  3KLH A;  2NOE A;  4ICL A;  4IEE A;  1KRP A;  3U6F A;  3CF5 L;  5BN9 A;  1M90 O;  2G8W A;  1KD1 O;  2YHA A;  3OYA A;  3ITH A;  2ITM A;  1NK6 A;  3NVK A;  3EYZ A;  4PHT X;  2Q0R A;  2GWK A;  2HZS A;  1S1U A;  1IG8 A;  2Q0U A;  1ZBS A;  1RBS A;  2G8I A;  1SL1 A;  3MDQ A;  4KHY A;  2HMP A;  4JK8 A;  2V52 B;  4FO0 A;  3D2F A;  4JNE A;  1HNW K;  5KL0 A;  4YOX A;  4JI5 K;  4OLB A;  3OYF A;  5LL6 Z;  4KHP K;  2ZFD B;  1C9B B;  3ZX3 A;  4F3T A;  4OX9 K;  1NMN A;  3J81 O;  3K5O A;  4HTL A;  5ADX H;  3MK6 A;  2FUV A;  1EKE A;  1S22 A;  3H45 C;  4A5B A;  1HYS A;  3VEV A;  3E9O A;  4EAK A;  3NFA A;  3WT0 A;  1T05 A;  5BRF A;  4FM0 A;  3HVT A;  4B0A A;  2HHX A;  1JLE A;  1Z05 A;  4QG5 A;  1RT2 A;  1G99 A;  2VYP A;  2CH5 A;  3H46 O;  3TR8 A;  1I94 K;  3VQ8 A;  4HVJ A;  2ASP A;  1QZ6 A;  2UUA K;  2O8C A;  3J8A A;  4N56 A;  4PL8 A;  3WEE A;  3HJF A;  3HYF A;  4A59 A;  4CHO A;  4A61 A;  4I9Q A;  4MO5 A;  4DR6 K;  4BRA A;  3HOT A;  3TSQ A;  4RCH A;  4F8R A;  1BIZ A;  4JKH A;  3ZSO A;  3ZEU A;  1C0U A;  4CE9 A;  3VN5 A;  1GLJ O;  4AM7 A;  2IGI A;  1KAX A;  3AA2 A;  3TSU A;  5T7B A;  4FJ5 A;  1NJX A;  4IEI A;  2P51 A;  4FWM A;  3I55 N;  4JI8 K;  2YH5 A;  4RW8 A;  4DSJ A;  5F1X A;  3N4P A;  5F9C A;  1NGJ A;  4AIL C;  1NJI O;  2GUP A;  1Z25 A;  4IKF A;  3L2R A;  4M7Y A;  4CEA A;  4MRQ A;  1RTJ A;  2QWQ A;  5AQI A;  2YCH A;  4G9Z A;  2FBX A;  1CLQ A;  4XIU A;  3CCU N;  4M3U A;  2HBJ A;  2IOC A;  1W2B M;  4E7H A;  1GLD G;  5E84 A;  2D0B A;  4IO9 L;  3V4I A;  2NRH A;  3KJV A;  5C24 A;  3AAQ A;  1VOK A;  4DHY A;  1LV5 A;  3MEE A;  4DSK A;  1RDU A;  2G8F A;  1KY6 A;  1BWF O;  1KFI A;  4AHR A;  4OJR A;  3LP2 A;  1TK8 A;  1NK0 A;  4CJU A;  1C0G A;  4N76 A;  4BC3 A;  1NK8 A;  4LY7 A;  3VEY A;  3LPT A;  3VQ5 A;  1JCG A;  4CES A;  3SLC A;  2RN2 A;  3H1Q A;  4Z0U A;  1TV6 A;  3E1Y A;  3HP6 A;  1YTU A;  4AHS A;  1QTP A;  2HF4 A;  2P9P A;  3VQA A;  4EAI A;  1L3T A;  5B8H A;  4D7Q A;  1RT3 A;  4CBU A;  3K5M A;  2QWO A;  4W5R A;  3GOI A;  3TU5 A;  5HOO A;  4FWQ A;  5AR0 A;  1OVY A;  3KWG A;  3B6P A;  3DRR A;  3QES A;  3K2P A;  1TUY A;  4RTF D;  1VQK N;  3VGM A;  4IBN A;  3AAR A;  4FSV A;  4WFN L;  2IAJ A;  5F0X A;  4JEP A;  2GUI A;  4A62 A;  3KLF A;  3THX A;  4WE1 A;  2UYT A;  4JD2 A;  4GVM A;  5C25 A;  4DV7 K;  1ASV A;  1V5S A;  4KBO A;  1SKW A;  1BIU A;  3PSF A;  3NGZ A;  2A42 A;  4K0K K;  2RHK A;  1TGO A;  2PWW A;  1EWR A;  2NRZ A;  3I8D A;  3CCV N;  3QER A;  4CJR A;  3V6D A;  3EL2 A;  3F0Z A;  4KI6 A;  4B1Y B;  1TUO A;  4B3M K;  1S72 N;  3A5M C;  1NJY A;  4E7K A;  3DLK A;  1KC8 O;  2NRW A;  1V4T A;  1S1V A;  5AQL A;  4CZF A;  4YHH K;  1ATS A;  2GV9 A;  5AQU A;  3S9H A;  3OYK A;  2HND A;  3P83 D;  4EP4 A;  3RRH A;  2FSJ A;  1WAF A;  3IDH A;  3CWA A;  1JXB A;  2E20 A;  1YI2 N;  1IBM K;  4DQP A;  3DPT A;  3SYZ A;  3WNE A;  3M6G A;  2XY8 A;  1VQ5 N;  4B9U A;  4FJL A;  2ASM A;  4BR0 A;  2X6S A;  1C4G A;  3LDN A;  2YHW A;  4XH4 A;  5AFU H;  4CJP A;  4U67 L;  5AQV A;  3VMF B;  4BGA A;  3RMC A;  3ZSV A;  3IUC A;  1CZ9 A;  5JN5 A;  1JL1 A;  4B3T K;  4QAG A;  3EEQ A;  4FM1 A;  1ATR A;  1VSK A;  1LOT B;  3HVR A;  1SS6 A;  4FJK A;  2OPP A;  2VG6 A;  3J7A P;  2HST A;  3LZJ A;  2IC3 A;  4FM2 A;  4CIF A;  4JKB A;  3QB0 A;  2ZM6 K;  4DTS A;  1TGH A;  4DR3 K;  2QW9 A;  1TYQ B;  1KVB A;  4ROC B;  5DM7 L;  4O5B A;  3MMV A;  3OS0 A;  3D45 A;  5FPM A;  1T8E A;  4IZ9 A;  1QQC A;  3CQY A;  4CD1 A;  3ZSX A;  2UXD K;  2R7Y A;  1S1W A;  4CZH A;  2HZM A;  2LAE A;  1FN7 A;  3DRP A;  4B1W B;  2F7T A;  4E19 A;  5LMN K;  3WXJ A;  4PL7 A;  1NOY A;  3SUN A;  4CGI A;  3R3L A;  4H0P A;  2E4L A;  3AVH A;  3L6Q A;  3DLH A;  1IKW A;  3DLL L;  3OBW A;  4H0T B;  4CZG A;  3AVG A;  1RFQ A;  2W40 A;  3LAN A;  5BRE A;  3D2E B;  3FR0 A;  4OLA A;  3AVK A;  1W7A A;  2QWP A;  4I9L A;  4B1Z A;  4IOC L;  4IOX A;  3UE5 A;  3KK2 A;  4H03 B;  2VQE K;  4B9M A;  4NLB A;  1EP4 A;  1HMV A;  3G6E N;  1ITG A;  2E6M A;  3PO4 A;  3SUO A;  2E5L K;  4JI1 K;  5ELZ A;  1VRU A;  3AA3 A;  4DLE A;  3M3Z A;  2VWK A;  4X64 K;  4O55 A;  3VPZ A;  3IS9 A;  3AVB A;  3AVM A;  3BY5 A;  2WTU A;  4CF9 A;  1QN3 A;  3EZW A;  4NYF A;  5M1P A;  4C8M A;  1CXU A;  3ZT3 A;  4F9O A;  4CJE A;  4FJX A;  5AFU A;  4WZS D;  3BF3 A;  3RRG A;  4B9L A;  3TAQ A;  4JS5 A;  4CEC A;  5I42 A;  5CY4 A;  3T1H K;  3DYA A;  3LP1 A;  4Y0W A;  1T3V A;  4D7R A;  2Z8U A;  1TKD A;  4DS4 A;  4CER A;  2YJE A;  4C8K A;  4BRM A;  3OYB A;  1SKR A;  3VQ4 A;  4M3T A;  2HF3 A;  2QM1 A;  4BE0 A;  3NCI A;  1VSH A;  3OA9 A;  3DOK A;  4KH6 A;  4FLV A;  1OH8 A;  4LH5 A;  4KO0 A;  3L8B A;  4JRQ A;  4CEQ A;  2D4W A;  2O3O A;  2YKN A;  3CET A;  2H4L X;  4GV9 A;  4B3R K;  2IVP A;  1UA1 A;  1YQM A;  1LWE A;  4CIG A;  1VSM A;  1EXQ A;  5BR9 A;  3RTV A;  4N5S A;  3SAF A;  2IIR A;  1LWC A;  3H6E A;  4OPH A;  2A5X A;  3CCJ N;  3U4L A;  1NK7 A;  5TKW A;  3C95 A;  1OKJ A;  3CCL N;  3PIO L;  3BEX A;  2FXU A;  2PYJ A;  1XMQ K;  3QFU A;  2I7P A;  1XC3 A;  1U04 A;  1R0A A;  1QTM A;  3CHW A;  2F9T A;  3ZLJ A;  1WN7 A;  1NK9 A;  3T69 A;  1QE1 A;  4HCB A;  1RDW X;  3A2F A;  4F4K A;  2Q2R A;  3OYI A;  1B9F A;  3BZK A;  3G0Z A;  4JI3 K;  2W6K A;  5BRH A;  4YOY A;  5SWM A;  3QNO A;  1B92 A;  3OYN A;  1RTH A;  2D0C A;  1CXQ A;  4FJ9 A;  3L2V A;  4A2A A;  2KW4 A;  2VG5 A;  4CHP A;  1QVF M;  4CF8 A;  1C1C A;  1NGF A;  4LF9 K;  4NCA A;  3U3Y A;  1QN9 A;  4FW2 A;  2BAN A;  3CFR A;  4LH4 A;  4Z4H A;  4CZM A;  5IYD P;  4XH5 A;  1EBM A;  2YX6 A;  3MCP A;  3WUH A;  4E1N A;  3O4W A;  5KPT A;  1K73 O;  4FLU A;  2W6L A;  1J6Z A;  3PLA A;  4ID5 A;  2G8H A;  2X78 A;  2Q31 A;  5FRN A;  2XO7 A;  4BE2 A;  4YY3 K;  2G8V A;  1WOQ A;  3OTO K;  3ZSQ A;  2OYQ A;  3THY B;  4IWV A;  1Z26 A;  1KVA A;  1Q7Y O;  4ELV A;  3KZB A;  3CC2 N;  2ZF5 O;  2IVO A;  3ENH A;  4H5W A;  4IFV A;  1NKE A;  4FLX A;  4LF7 K;  3NGY A;  3RSM A;  3IFR A;  3HPH A;  2BUP A;  3BKQ X;  3K9K A;  3U8X A;  4BRE A;  3L3U A;  1VQM N;  3JXU A;  4BR5 A;  3D4V A;  4E1M A;  1TK0 A;  1TAQ A;  3CFO A;  4WF9 L;  2IV8 A;  4CFF A;  1A5W A;  2D5R A;  1Y97 A;  1NGE A;  5FLX O;  1NM1 A;  3F5T A;  1WSI A;  3ENB A;  4MQ3 A;  2RKI A;  4BWM A;  4FK4 A;  3LPU A;  1RDB A;  3ENO A;  1WJW A;  4LF4 K;  3V1R A;  3ZYY X;  3P4I A;  1MP9 A;  2ATQ A;  3PX4 A;  1JLB A;  1JLF A;  5JS2 A;  4F2R A;  1TL3 A;  1BG3 A;  1Q8I A;  4OKJ A;  1LWV A;  3O3F A;  4CIE A;  3UB5 A;  1C1B A;  2Q3S A;  1D8Y A;  1KCF A;  1QS4 A;  3SUP A;  4CBX A;  2RE2 A;  3QLH A;  4K41 A;  1HNV A;  4BG8 A;  5GAG P;  4CK2 A;  4IG0 A;  3K9J A;  4ELT A;  1RBR A;  4I7F A;  1BQM A;  5J2M A;  3TWH A;  1VQN N;  3HS8 A;  4FJN A;  1XI1 A;  1P5D X;  1TYQ A;  1QNB A;  2QWR A;  5CYM A;  3DJC A;  1HNZ K;  4I8O A;  4QCL A;  2OZS A;  4CK3 A;  3CQX A;  5AQF A;  3CM6 A;  1NGA A;  3A8Y A;  4BQZ A;  3CER A;  1RNH A;  4DLG A;  1XWL A;  1O13 A;  5HRN A;  4EAG A;  3DLB A;  1HQE A;  4FK2 A;  4RG8 A;  3ZT4 A;  2E8A A;  4IXC A;  4K43 A;  4TPS A;  4H4M A;  4H8K A;  4JLH A;  1NNE A;  1ZC6 A;  4BC4 A;  4CZE A;  3MWT A;  3LL3 A;  4CF0 A;  1GLC G;  2RF2 A;  2A41 A;  2O8B B;  3PUF A;  3NH2 A;  1WBB A;  4L8R B;  3C6T A;  1NK4 A;  4KHQ A;  3DLG A;  3VF6 A;  3SZ2 A;  4OGE A;  2QXL A;  1VAZ A;  4H0Y B;  2F9W A;  1DGK N;  1YIT N;  1IBK K;  4CF2 A;  4IDK A;  3VA3 A;  2ZJP L;  5AQM A;  1RTI A;  3MN5 A;  1E3M A;  4ISE A;  2Y1J A;  3CC4 N;  3QEV A;  4WXA A;  1EX4 A;  1YHQ N;  1LW2 A;  4EAJ A;  3AO1 A;  4DTJ A;  3OVN A;  4DTR A;  1C0F A;  2QXF A;  4DR7 K;  4OPK A;  2UUC K;  3TI0 A;  3GDQ A;  1RDD A;  2P5G A;  3VEN A;  3T1A A;  2P9S B;  4DUL A;  3E01 A;  3H08 A;  4DR5 K;  3TAF A;  3VQC A;  4YOU A;  4FLZ A;  4B9V A;  1U2V B;  1OH7 A;  2DKA A;  4KHS A;  3THW B;  3TAN A;  4DTO A;  1N36 K;  3VEW A;  3EY1 A;  1NMD A;  1DT9 A;  5GIP A;  3GG4 A;  3QEX A;  4DTM A;  1GOB A;  3MWP A;  3O8M A;  5AQZ A;  2A1R A;  3O1B A;  5GIO A;  3SI6 A;  2O8E B;  1WNS A;  4CZL A;  3NA5 A;  1J5E K;  4DFK A;  4CEB A;  1BI4 B;  2B5J A;  1UT4 A;  4M45 A;  3PSI A;  2PFU A;  1JKH A;  2PAV A;  1VSE A;  4C8O A;  1L3V A;  1WSG A;  5AZI B;  4CHN A;  1NGC A;  4PQU A;  3JSM A;  2HB5 A;  1X1P A;  4I6M B;  1QTS A;  1K2Y X;  5DK5 A;  4G1Q A;  4KTQ A;  1RDA A;  1CZA N;  4KHN A;  3EKS A;  2A6A A;  1BUP A;  4ISF A;  1T7P A;  3RMA A;  5JLF A;  4MFB A;  3MN7 A;  4PA1 A;  4M7X A;  1KLM A;  3SQ2 A;  1XHZ A;  4NCG A;  4C1N I;  1U49 A;  2Y1I A;  3AVC A;  4WQ5 A;  3ZX0 A;  2B4J A;  3HM8 A;  4EZ9 A;  1FK9 A;  2MZ8 A;  3G10 A;  2FKF A;  3HP9 A;  2JLE A;  3SV3 A;  1JDY A;  4KH4 A;  1WSJ A;  3WQT A;  1BGX T;  1D5A A;  3CC7 N;  2YHB A;  4QOZ B;  2YJF A;  1GLF O;  3G4S N;  1KXP A;  4FZZ A;  3VQ7 A;  1K8K B;  2Q36 A;  4PY5 A;  4BRQ A;  1SL0 A;  2FBV A;  3P31 A;  3AA4 A;  1KY7 A;  1X3M A;  3WXI A;  1VTL E;  4M63 C;  5CZ1 A;  2HNZ A;  3OJS A;  1YT3 A;  1C6V A;  3EKU A;  2FF3 B;  3V9U A;  2HOE A;  1K9M O;  3S3M A;  4JV5 K;  3U3G A;  1HNX K;  3CCE N;  3CWU A;  3LAK A;  2BH1 A;  5HL7 L;  2HHW A;  3UKU B;  4BDY A;  1YQR A;  2IS3 A;  5CE3 A;  3O9R A;  1KFQ A;  1K6Y A;  2UU9 K;  2PY5 A;  3I33 A;  3TAE A;  1X3N A;  3QEI A;  1EUV A;  2YNH A;  2NUB A;  2GTD A;  3RVC A;  1X9S A;  1X9J A;  3L2Q A;  1K8A O;  3THY A;  1UWB A;  1XNQ K;  3MXM A;  3ALY A;  4BRF A;  3HT3 A;  2HHT A;  2NRV A;  1S3X A;  3DXK B;  4JKF A;  5F2R A;  3NH1 A;  2QKK A;  4LSL A;  4FJH A;  3ULE A;  4FLY A;  3TAR A;  2J4R A;  2PYL A;  1U45 A;  3DXM B;  3H3N O;  4ILG B;  4O4G A;  3TAM A;  1B9D A;  1E42 A;  4DR2 K;  1S1X A;  3SV4 A;  5KQ8 A;  4DSL A;  4DF8 A;  4BRN A;  4CJ5 A;  3BP8 A;  4CEZ A;  3FGU A;  1HRH A;  3SPZ A;  2IDO A;  2VWJ A;  1R59 O;  1SV5 A;  4HUG A;  1G15 A;  3VEZ A;  3R1X A;  4C8N A;  3C6H A;  3LM2 A;  4M3Z A;  2D0P A;  3HBT A;  2DPN A;  1NGB A;  2CGK A;  3LM9 A;  4XH1 A;  5J2Q A;  2JWK A;  3Q7B A;  3K5N A;  3PDK A;  1BL3 A;  2YNF A;  5KTQ A;  3ZX2 A;  2NWV A;  3OY9 A;  4DV2 K;  3HK2 A;  4EHT A;  2KFZ A;  1XHX A;  4YDU A;  4AHU A;  4DFJ A;  4J2A A;  1YF5 L;  3SNS A;  4DU3 A;  4U7B A;  4DTU A;  4H0O A;  1KQS M;  3KLG A;  4B9T A;  3IAY A;  1TUU A;  1NOZ A;  2YV0 X;  3CQ8 A;  2OA8 A;  1RTD A;  1XQS C;  2KTQ A;  4IJA A;  5H1S Q;  4J2B A;  2GX9 A;  4B1U B;  3RSE B;  1QQO A;  2QWN A;  1HKB A;  3TTF A;  1U4B A;  4X65 K;  3F2K A;  3OYD A;  5LJW A;  1VQO N;  1PVS A;  3QBW A;  2V51 B;  2NOH A;  4ZTJ A;  3J7Y P;  2Y8Q A;  1M1K O;  2IV9 A;  5IWA K;  2VJ0 A;  2H5A X;  2B6A A;  1JLQ A;  1NGH A;  4C1N K;  3LWL A;  1MPG A;  4HUE A;  3D0P A;  1NWK A;  3CJ9 A;  3T19 A;  4DKW A;  4RW9 A;  1JLC A;  4RW6 A;  3AO3 A;  4CJ4 A;  3GE1 A;  3WNH A;  4H5R A;  3P1G A;  5C2F A;  1SZ2 A;  4HJH A;  4AF1 A;  4W5O A;  1HR0 K;  4QS7 A;  1MDU B;  1NLV A;  1Y64 A;  3NBP A;  5AQP A;  3SPY A;  5AQR A;  1P5G X;  1LWF A;  2HMI A;  2YNG A;  2O8B A;  3LDQ A;  4YNQ A;  3FZK A;  3CI5 A;  4CW7 B;  3ULD A;  1J9A A;  3ULX A;  4EZ6 A;  4KHU A;  4FWK A;  3I0S A;  3NMU A;  4Z4I A;  2HNY A;  2DFH A;  1DKG D;  5EVZ A;  4NCB A;  3TDH A;  4M3R A;  2OAN A;  3KK7 A;  4AHV A;  2KKZ A;  4GV6 A;  3NF8 A;  4KV8 A;  4ELU A;  3MED A;  2W42 A;  1QN4 A;  4I2P A;  1TBA B;  3M1F A;  1M3H A;  3VF4 A;  1GLL O;  1YXQ A;  4BG9 A;  4ROD B;  1QN6 A;  4ZHR A;  3VEX A;  1QZ5 A;  4IL8 A;  2P9S A;  5SZT A;  1ESV A;  3L4I A;  2MJ7 A;  1VSF A;  1XC9 A;  2V7Y A;  2YHX A;  1NJW A;  3THV A;  3UIQ A;  3S3O A;  4W5N A;  1U2V A;  2FF6 A;  5IYB P;  3THW A;  3VQD A;  4CBW A;  4BR2 A;  3QBX A;  3DM2 A;  2DKD A;  1DIZ A;  3MX2 A;  1MWM A;  5KPR A;  2X6N A;  4BRD A;  4DV3 K;  2XY5 A;  2HVI A;  1U47 A;  1NGM A;  4ROE B;  1T44 A;  2P9N B;  5I9E B;  1XUP O;  1Q86 O;  1JCF A;  2NLX A;  4Z4C A;  4DV6 K;  2O8E A;  5AQH A;  3ZCM A;  4FJJ A;  3ENO C;  4FWP A;  3OH9 A;  1BI4 A;  4F2S A;  1YVU A;  1T03 A;  3NDK A;  3OYG A;  2G8U A;  4JN4 A;  3VA0 A;  1LAW A;  4E89 A;  2EHB D;  4CZJ A;  3CYM A;  4B3S K;  4I6M A;  4FVU A;  1J53 A;  3AVI A;  3OYH A;  3TTD A;  2P9K B;  2OOX A;  2NOI A;  3G25 A;  4CJL A;  1WLJ A;  4E7J A;  4FLW A;  2XY7 A;  3C7N B;  3O3H A;  3CW7 A;  3MN6 A;  4K8Z A;  3LDO A;  2FSN A;  4Y1D A;  4B9S A;  4DR1 K;  1N39 A;  3HOS A;  2QA4 N;  1VKL A;  1VOL B;  1REV A;  1B9K A;  3QML A;  1JCE A;  4Q5V A;  4UY8 O;  2A40 A;  4X62 K;  1K8K A;  3HM9 A;  4FCY A;  5HLF A;  1C47 A;  1RCH A;  3QO9 A;  3CFP A;  1DEJ A;  5KGX A;  3CCQ N;  1BHL A;  5AQK A;  4AHC A;  1NK5 A;  3IRX A;  4M41 A;  1KYD A;  1OH5 A;  4N47 A;  4BC5 A;  3VTI A;  3WNG A;  3PY8 A;  3M8S A;  4DUZ K;  3CVT A;  2ZJR L;  3WNF A;  3OH6 A;  4DR4 K;  1W9H A;  1EWQ A;  4Q0B A;  3RMB A;  3EIK A;  3IKM A;  1ILY A;  2WON A;  2WUS A;  3HI0 A;  4J8F A;  1L3U A;  3RPJ A;  3OC3 C;  5TKY A;  1BQN A;  5EOY A;  4O8K A;  2F4V K;  1D3U A;  5HSH A;  4BY9 C;  4FZX C;  3EO3 A;  1NU0 A;  3CIP A;  3SMP A;  2QRC A;  4Y1C A;  4C23 A;  1NVP A;  1PCZ A;  2V8Q A;  1F21 A;  3DXK A;  3LDL A;  1JFI C;  4KB0 A;  2FKM X;  3V1Q A;  2O8D B;  1ASW A;  5AQJ A;  4DQQ A;  2HL8 A;  4NXM K;  2HHU A;  3NAE A;  5AQT A;  3SJH A;  4BDP A;  1YTF A;  1GLE G;  3DXM A;  3FLC O;  5FPN A;  1DLO A;  3FZM A;  4EAH D;  2ITG A;  3OYL A;  4DQS A;  4DQI A;  3I56 N;  3CWS A;  4CK1 A;  3VEO A;  1HPZ A;  2O8C B;  3AV9 A;  2NLV A;  3AO5 A;  3SAH A;  3P39 A;  3CG7 A;  3EZ5 A;  3ZT1 A;  1FKP A;  3V9Z A;  4DV1 K;  1NGG A;  3OJU A;  2ZD1 A;  1ZBF A;  4LD0 A;  4CI6 A;  4FOI A;  1S1T A;  5FRM A;  3SNN A;  1IKY A;  3CJ7 A;  5KRS A;  5GAD P;  1TVR A;  1V4S A;  4K42 A;  1VQ9 N;  4PKH A;  3DRS A;  5EY4 A;  4JKC A;  5CYQ A;  3VES A;  4BVP A;  1R4X A;  1MA9 B;  4WCE L;  4BRO A;  3KHY A;  4LSN A;  3KD1 E;  3TPQ A;  1KLN A;  3RWU A;  4DV4 K;  4FWL A;  1PCM X;  4CEF A;  4FLT A;  1S9E A;  4JRP A;  3S41 A;  1BOT O;  5EXW A;  3CCS N;  3T4N A;  2KHO A;  2P9L B;  1D9D A;  3RSE A;  1YJ9 N;  5JVG L;  3SBT A;  3N89 A;  4H5V A;  3L2W A;  5AQN A;  3MX5 A;  5FDL A;  5HP1 A;  2I5W A;  2KQ2 A;  3C6U A;  4H0V B;  3I0R A;  3PIP L;  1HJO A;  4CEE A;  3A5L C;  3QNN A;  3QIC A;  1O1W A;  4BRL A;  5HRS A;  4OPJ A;  3TAP A;  2NRT A;  2GEL A;  2OPS A;  1BCM A;  3OBY A;  2WBN A;  2F96 A;  3VOV A;  1HYZ A;  2HL9 A;  5JIC A;  5KPZ A;  5M1N A;  5C42 A;  5BR8 K;  2AJQ A;  3TAB A;  4DB3 A;  3P38 A;  1N3C A;  5C12 A;  3HPO A;  1S6P A;  3H1Z A;  2KZM A;  5IT9 O;  4FL9 A;  4K8X A;  1QN7 A;  4FVM A;  5LY3 A;  4QS8 A;  3HTV A;  3QIO A;  3QDK A;  3SMS A;  1TBP A;  3OGD A;  1T6A A;  4M3Y A;  3D7Q A;  1QHA A;  3IG1 A;  4KTZ A;  4CGJ A;  3DOL A;  1KAZ A;  3EE9 A;  2Z1I A;  4DQ8 A;  4L3Q A;  2E6L A;  3U9D A;  2DTU A;  3M8P A;  4ISG A;  3K58 A;  5BPN A;  3O4N A;  2JGU A;  2HBK A;  2E2Q A;  1WAJ A;  4BWJ A;  1NH2 A;  5D3G A;  1VSJ A;  4Z4G A;  2QRD A;  1VQL N;  3NE6 A;  2NOF A;  1RT7 A;  1BDG A;  1IKV A;  2NRX A;  4O8U A;  3UKR B;  2YNI A;  3LDS A;  4C8L A;  1XSZ A;  1NKB A;  3QIP A;  3CPE A;  5AQG A;  2E2O A;  3NVM A;  4BR9 A;  1QVG M;  2GEM A;  4YOV A;  4ID1 A;  1LCU A;  3BZC A;  3ZET B;  3KLE A;  1XMO K;  1UOC A;  2OPR A;  4WX8 A;  1IV0 A;  4AM6 A;  2PBD A;  3OHR A;  4WFB L;  3OYM A;  3U9Z A;  4BDZ A;  4O0I A;  3D2E A;  2DY4 A;  3VQ9 A;  1VQP N;  4IFY A;  5JMV D;  3KIO A;  3ZSZ A;  3WXL A;  2P9N A;  4DU4 A;  3NHG A;  1JLA A;  1GOC A;  3LAM A;  4MDB A;  4AHT A;  3B6O A;  4DTP A;  1VQ7 N;  2JPI A;  3W3D A;  5C2D A;  3F9M A;  3R8E A;  1KYF A;  1ZBH A;  3BDP A;  4FZY A;  1VK0 A;  3H3O B;  2XY6 A;  4DFM A;  1CZB A;  3MEG A;  4BAC A;  4ILH A;  2VCP A;  3AVF A;  3CJ1 A;  2H3G X;  4YOW A;  3SBG A;  5FPE A;  4A2B A;  5KRT A;  4GW6 A;  3M5R A;  2P9K A;  2I7N A;  3C7N A;  1Q18 A;  1A5V A;  1EET A;  3RR7 A;  3TAG A;  3OLP A;  3AGK A;  5AQS A;  4PKG A;  3AO2 A;  3VQE A;  4DG1 A;  4HCC A;  4EFH A;  4EJY A;  4W5T A;  4K25 A;  2QLV A;  4AQY K;  2VGN A;  2A1S A;  1A5X A;  2VQF K;  4E7L A;  4OKE A;  1KAY A;  5CR4 A;  2D0A A;  5I3U A;  4E0D A;  4M3W A;  2Z1H A;  1C0T A;  1LW0 A;  5FPD A;  5E26 A;  2OZM A;  4BRP A;  1SQK A;  3AAP A;  3EAY A;  3DI6 A;  2G30 A;  3JS6 A;  4JYA K;  3CME N;  5KI6 A;  3K57 A;  4DTN A;  5BRD A;  1W0H A;  3AGR A;  3KRM A;  3O9U A;  4NB4 A;  3OS1 A;  1VQ4 N;  1K35 A;  4DQR A;  3CD6 N;  1HPM A;  4CJV A;  1LWW A;  2KZZ A;  2GBZ A;  3CJC A;  3OS2 A;  3M8R A;  4RWT A;  4HWI A;  5BPM A;  1Q9X A;  3O08 A;  2OCE A;  2P9U B;  4FWS A;  1IBL K;  1S9G A;  2JHN A;  1QQM A;  2VWB A;  3ZSY A;  5AZJ B;  3VGL A;  4BRG A;  3DPU A;  2UUB K;  3GBT A;  1BO5 O;  4DSI A;  2O8D A;  1W80 A;  3NGI A;  4YOT A;  2ETJ A;  1MWK A;  4CFB A;  3QEP A;  4FJM A;  3T1Y K;  1HLU A;  5DM6 L;  2BTF A;  2ZGZ A;  3FFK B;  3KD5 E;  1C1A A;  2E88 A;  5M1K A;  4Z4F A;  1WUA A;  4FWR A;  1D9F A;  1KVC A;  4BRH A;  4CF1 A;  3S3N A;  2BE2 A;  3I8B A;  2V92 A;  3ISN C;  3QFP A;  3HSC A;  1YAG A;  2HHQ A;  5E41 A;  4DV5 K;  1TKT A;  1L5U A;  5AQX A;  2X74 A;  4KTW A;  3ZT0 A;  3OCI A;  1EQY A;  3PMG A;  1TKZ A;  3CJB A;  4OO1 J;  1QN5 A;  1KO9 A;  4I2Q A;  1HX1 A;  2O8F B;  1H1V A;  4BRK A;  3O3G A;  2F8S A;  4EIA A;  5J2P A;  3OYE A;  5LMU K;  2HHV A;  1IJJ A;  4CED A;  2YHY A;  2ZJQ L;  3R9P A;  5GAE P;  4M3X A;  2FLO A;  1JJ2 M;  2HVH A;  3SJJ A;  4MDA A;  1L3S A;  1QNA A;  4E7I A;  4IDH A;  1TL1 A;  1VSD A;  1QQN A;  2P9L A;  1WB9 A;  4PUO A;  2F7L A;  4JKG B;  4GVE A;  2Q97 A;  4EHU A;  3CPW M;  4DV0 K;  2UXB K;  1P90 A;  1GLA G;  2HW3 A;  1HNI A;  4JKD A;  1EO1 A;  3KTU A;  2ZE2 A;  4BQL A;  3J80 O;  1VSI A;  4RW7 A;  3L2U A;  3LZI A;  1KFS A;  1CDW A;  1U6Z A;  3J7Z O;  1ATN A;  4JAX A;  3O9Q A;  1KYU A;  2ZGY A;  4NYN A;  4CD3 A;  2OTL N;  2VGM A;  2XRI A;  1U48 A;  1OVQ A;  2BDP A;  3OSE A;  3DMJ A;  3E66 A;  5GIN A;  3VF2 A;  3CJA A;  4YOR A;  4KI4 A;  5JS1 A;  4CFD A;  1LWY A;  4WQ4 A;  3C0B A;  4CEO A;  5ADX A;  3G71 N;  3CWT A;  4BR4 A;  4KPY A;  3CCR N;  3O9S A;  1QHT A;  4CFC A;  5GAH P;  4LFB K;  4GKJ K;  4CJK A;  3ID8 A;  4KB1 A;  1YTA A;  1W97 L;  1GLB G;  3WXM B;  1WQA A;  1BA0 A;  2V9J A;  4GMJ B;  4BRC A;  3UW2 A;  3R6M A;  3C04 A;  4OKK A;  3ZSW A;  1J3M A;  4IG3 A;  1Q9U A;  2NRR A;  5C0Y A;  2P9I B;  5A2Q O;  2JHJ A;  3O9T A;  3LDP A;  3AY9 A;  3UKR A;  3VET A;  4DF4 A;  1WBD A;  3MEC A;  5AQO A;  1N33 K;  3FZF A;  3WXK A;  4DCH A;  1ZYQ A;  4E1J A;  3D6R A;  1DTQ A;  1ZBU A;  1UT7 A;  3OYC A;  4JK7 A;  4O44 A;  3BGR A;  3VGK A;  4HTU A;  4GNI A;  1QSY A;  1N34 K;  4GV3 A;  4JHD B;  5CZ2 A;  4KFB A;  5HRP A;  2A3Z A;  2WFB A;  1KTQ A;  3RMD A;  4PKI A;  4KH5 A;  1SL2 A;  3ZET A;  3DLR A;  5JVH L;  4F3O A;  4B8A B;  4FWO A;  5AQW A;  4IFE A;  2NZT A;  1I39 A;  1HKC A;  3M8Q A;  5M1F A;  1RBV A;  3C65 A;  5DMR A;  2FBT A;  3HZ6 A;  1ZBI A;  4JI4 K;  5IYC P;  3CM5 A;  4PWD A;  3OYJ A;  4DFP A;  2HHS A;  2E1Y A;  5HRO A;  2DKC A;  1T6C A;  4CJT A;  4CGD A;  2P1J A;  3QIN A;  4E3S A;  1I3A A;  3HXM A;  3CMA N;  3P5J A;  1RBT A;  1HJR A;  1BU6 O;  3FZL A;  3SQ4 A;  1WSE A;  1M3Q A;  3NH0 A;  1E4F T;  1Z6R A;  1JLG A;  3AA5 X;  4B8C A;  4QS9 A;  2QRE A;  1SUQ A;  2QWL A;  2D0O A;  3MXI A;  1X9M A;  4FJI A;  1S5J A;  3QEW A;  1J5O A;  1SAZ A;  2Z1G A;  3MN9 A;  2E1Z A;  4W5Q A;  3KKR A;  3MXJ A;  4FW1 A;  2OTJ N;  4JK9 A;  4JS4 A;  4CGH A;  3O6W A;  4CCH A;  4JKE A;  2FGT A;  3V9W A;  3AO4 A;  1X9W A;  3AVA A;  1LAV A;  1IKX A;  1FJG K;  1YJN N;  3Q7C A;  1TAU A;  3WQU A;  2QTD A;  1Q9Y A;  4JI0 K;  4WFA L;  1FXX A;  4CZI A;  3N4Q A;  3V1O A;  2EWS A;  4O0J A;  5HBM A;  2Z0F A;  2V7Z A;  2FSK A;  3VQQ A;  4OVL A;  4CJF A;  1HKG A;  4DMN A;  3O5B A;  5JLH A;  2QEX N;  2CH6 A;  5AZI A;  2XHB A;  2FC0 A;  1YUW A;  2I5J A;  4JI2 K;  4ZTF A;  3BUZ B;  2FBY A;  3I0W A;  1QSL A;  1YTB A;  3FE1 A;  2P9U A;  4B9N A;  2KLA A;  4KHW A;  1FW6 A;  4MLE A;  4R5P A;  2W41 A;  1WSF A;  2QK9 A;  5BMP A;  3VQP A;  1OH6 A;  5AZJ A;  4KKO A;  4BR7 A;  2G8K A;  1S6Q A;  4Z4E A;  1N3A A;  3JYT A;  5BPL A;  4LF6 K;  1HUX A;  1VHX A;  1QN8 A;  3DWL A;  2OOY A;  3H1V X;  4NO7 A;  3V81 A;  2DFF A;  2QR1 A;  3E9L A;  4FXD A;  4HUF A;  4B1V A;  2QKB A;  2LSN A;  1QNE A;  5BN8 A;  4NLC A;  3AVJ A;  3LWM A;  1BA1 A; 
#chains in the Genus database with same CATH homology
 1T7P A;  1S1V A;  2E6L A;  4CHY A;  3RMA A;  2DTU A;  3M8P A;  4MFB A;  5HRR A;  3K58 A;  2GV9 A;  4PA1 A;  3S9H A;  3O4N A;  2JGU A;  1KLM A;  3SQ2 A;  1XHZ A;  4NCG A;  1WAJ A;  4BWJ A;  1U49 A;  2Y1I A;  3AVC A;  3KTQ A;  3OYK A;  2B4J A;  1NH2 A;  1HU0 A;  4EZ9 A;  1HYV A;  2HND A;  1FK9 A;  2MZ8 A;  1VSJ A;  2Z1J A;  3G10 A;  3HP9 A;  3P83 D;  5D3G A;  2JLE A;  4Z4G A;  4EP4 A;  3NE6 A;  2NOF A;  3K5L A;  1RT7 A;  3SV3 A;  3RRH A;  1IKV A;  1WSJ A;  2YNI A;  2XHI A;  1BGX T;  1D5A A;  3LDS A;  1AIS A;  1WAF A;  2YHB A;  4C8L A;  4QOZ B;  1NKB A;  1JXB A;  3QIP A;  4FZZ A;  4DQP A;  3VQ7 A;  3DPT A;  4PY5 A;  3SYZ A;  3WNE A;  2XY8 A;  4B9U A;  4FJL A;  1SL0 A;  2FBV A;  2X6S A;  1KY7 A;  3AA4 A;  4CJP A;  1VTL E;  1IG9 A;  5CZ1 A;  2HNZ A;  3OJS A;  3RR8 A;  1YT3 A;  1C6V A;  3KK3 A;  3V9U A;  3RMC A;  3VQ6 A;  1YTU A;  3ZSV A;  4ID1 A;  1CZ9 A;  1GOA A;  3KLE A;  2NOB A;  1UOC A;  3T3F A;  2OPR A;  1JL1 A;  1QSS A;  4QAG A;  4FM1 A;  1VSK A;  3S3M A;  2NOZ A;  3OYM A;  3U3G A;  3HVR A;  1KFD A;  3I0X A;  3QET A;  2OPP A;  4FJK A;  3K59 A;  2VG6 A;  3LZJ A;  4BDZ A;  1ASU A;  4O0I A;  3F10 A;  3LAK A;  4HHT A;  2HHW A;  2IC3 A;  3VQ9 A;  4CIF A;  4FM2 A;  2DY4 A;  4BDY A;  1YQR A;  2IS3 A;  4IFY A;  4DTS A;  1TGH A;  3KIO A;  1K6Y A;  4CJS A;  3ZSZ A;  2PY5 A;  1QNC A;  1KVB A;  3TAE A;  3PX6 A;  4DU4 A;  4ROC B;  3NHG A;  3QEI A;  2YNH A;  2NUB A;  1JLA A;  4O5B A;  1GOC A;  3LAM A;  1X9S A;  4AHT A;  1MU2 A;  3OS0 A;  3D45 A;  3B6O A;  3L2Q A;  3ASM A;  4DTP A;  1UWB A;  1PZD A;  1T8E A;  3MXM A;  3ALY A;  3HT3 A;  3HK2 A;  1QQC A;  1KYF A;  3MAQ A;  1RBU A;  3NF9 A;  4BE1 A;  2WOM A;  3ZSX A;  1ZBL A;  3BDP A;  4FZY A;  2R7Y A;  1S1W A;  1VK0 A;  2XY6 A;  2YKM A;  3ZT2 A;  4DFM A;  1YQK A;  1CZB A;  3AVN A;  3LAL A;  3MEG A;  4BAC A;  3NH1 A;  3AVF A;  2QKK A;  2HZM A;  4LSL A;  4FJH A;  1UAX A;  2LAE A;  1FN7 A;  3DRP A;  2DFE A;  4FLY A;  3TAR A;  4CJQ A;  4E19 A;  5KRT A;  1NOY A;  1CLQ A;  2PYL A;  3SUN A;  4GW6 A;  4CGI A;  1U45 A;  1NJZ A;  4O4G A;  2E4L A;  3TAM A;  4B08 A;  3AVH A;  3DLH A;  1B9D A;  1E42 A;  1S1X A;  1IKW A;  3SV4 A;  4DSL A;  4DF8 A;  4TSX A;  1RT5 A;  4CJ5 A;  1A5V A;  3AVG A;  1EET A;  1RT1 A;  3LAN A;  4CEZ A;  4OLA A;  3AVK A;  4DSE A;  3RR7 A;  1HRH A;  3SPZ A;  2IDO A;  4DG1 A;  1SV5 A;  2VWJ A;  3KK1 A;  3AO2 A;  3VQE A;  3TAG A;  4HCC A;  4HUG A;  4I9L A;  4EJY A;  1G15 A;  4W5T A;  4B3O A;  4C8N A;  3V9X A;  4M3Z A;  4KRE A;  2A1S A;  4CFA A;  5J2Q A;  4J2E A;  4FJ7 A;  4FJ8 A;  3KK2 A;  1RT6 A;  4B9M A;  1EP4 A;  1HMV A;  3K5N A;  1A5X A;  4E7L A;  1BL3 A;  1ITG A;  2E6M A;  2YNF A;  4OKE A;  3PO4 A;  5KTQ A;  3HL8 A;  2D0A A;  2RPI A;  5I3U A;  3SUO A;  3ZSR A;  3OY9 A;  4N41 A;  1VRU A;  1IH7 A;  3AA3 A;  4DLE A;  4E0D A;  4M3W A;  2Z1H A;  1C0T A;  1LW0 A;  2VWK A;  4FJM A;  2KFZ A;  1XHX A;  2NOL A;  2OZM A;  4O55 A;  3IS9 A;  4AHU A;  4DFJ A;  2BGG A;  3AVB A;  3AVM A;  4J2A A;  4DWI A;  1N6Q A;  3SNS A;  3DI6 A;  3KLI A;  1QN3 A;  4CF9 A;  4DU3 A;  4EP5 A;  2G30 A;  4NYF A;  4DTU A;  4C8M A;  1CXU A;  3ZT3 A;  4CJE A;  4B9T A;  5KI6 A;  3KLG A;  3K57 A;  3IAY A;  4FJX A;  4WZS D;  1RM1 A;  4DTN A;  1W0H A;  3KRM A;  1NOZ A;  2YV0 X;  3OS1 A;  3RRG A;  5AN4 A;  4B9L A;  3CQ8 A;  3TAQ A;  4JS5 A;  4CEC A;  5I42 A;  4DQR A;  1RTD A;  1JXE A;  5CY4 A;  4DU1 A;  2OA8 A;  4FYD A;  2KTQ A;  3DYA A;  3LP1 A;  4J2B A;  4CJV A;  4DSF A;  1LWW A;  2KZZ A;  2Z8U A;  2GBZ A;  3OS2 A;  1TKD A;  4DS4 A;  4CER A;  3SCX A;  4C8K A;  3OYB A;  3M8R A;  1SKR A;  3VQ4 A;  4M3T A;  1RDC A;  4BE0 A;  3PV8 A;  3NCI A;  1Q9X A;  1VSH A;  4FK0 A;  4Q11 A;  1U4B A;  4AH9 A;  4EJZ A;  3OYD A;  5KGW A;  3DOK A;  4FLV A;  4LH5 A;  1S9G A;  4RW4 A;  4L8R B;  2NOH A;  4KO0 A;  4ZTJ A;  2IV9 A;  5FRO A;  3SQ1 A;  2VJ0 A;  3ZSY A;  3L8B A;  4JRQ A;  4CEQ A;  1N5Y A;  2B6A A;  1JLQ A;  3LP0 A;  3DPU A;  3LWL A;  2O3O A;  2YKN A;  5J2N A;  4HUE A;  3D0P A;  4FJG A;  3OST A;  4DSI A;  1W80 A;  1VSL A;  3NGI A;  3T19 A;  2ETJ A;  4CGG A;  4RW9 A;  1JLC A;  1RT4 A;  4RW6 A;  4CFB A;  3QEP A;  1FKO A;  1YQM A;  3AO3 A;  4CJ4 A;  1HQU A;  1UA1 A;  3WNH A;  2VG7 A;  1LWE A;  4CIG A;  1JL2 A;  1VSM A;  3KD5 E;  3HPG A;  3P1G A;  1EXQ A;  3RTV A;  4N5S A;  1C1A A;  4W5O A;  4Z4F A;  1LWC A;  4DS5 A;  5EU7 A;  3NBP A;  3SPY A;  1D9F A;  1KVC A;  4CF1 A;  3S3N A;  4M42 A;  2BE2 A;  1NK7 A;  4KRF A;  3F73 A;  3C95 A;  1LWF A;  2HMI A;  1IO2 A;  2YNG A;  3ISN C;  4YNQ A;  2HHQ A;  2PYJ A;  5E41 A;  1TKT A;  1L5U A;  3ULD A;  1J9A A;  2X74 A;  1U04 A;  1KSP A;  4CHQ A;  1R0A A;  1QTM A;  3ULX A;  4EZ6 A;  4KTW A;  2P5O A;  1WN7 A;  3ZT0 A;  3OCI A;  1NK9 A;  1DTT A;  4KHU A;  1TKZ A;  1UA0 A;  3I0S A;  3HS9 A;  1QE1 A;  1VTO A;  4HCB A;  4CJ3 A;  1QN5 A;  2HNY A;  4Z4I A;  3A2F A;  4F4K A;  1KO9 A;  4I2Q A;  2DFH A;  4NCB A;  3OYI A;  1B9F A;  4M3R A;  3O3G A;  3G0Z A;  2F8S A;  4AHV A;  4KAZ A;  5J2P A;  3V9S A;  3OYE A;  3NF8 A;  5SWM A;  5K14 A;  2HHV A;  4KV8 A;  4ELU A;  4J2D A;  3IH7 A;  3MED A;  3O4Q A;  1QN4 A;  4CED A;  1B92 A;  2W42 A;  3QNO A;  4I2P A;  4UQG A;  1TBA B;  4OGC A;  3C94 A;  1M3H A;  1TK5 A;  3PO5 A;  3OYN A;  4M3X A;  1TKX A;  1RTH A;  2D0C A;  1CXQ A;  4FJ9 A;  4ROD B;  3L3V A;  3AVL A;  1QN6 A;  4ZHR A;  3L2V A;  2HVH A;  2JOI A;  3SJJ A;  1L3S A;  1QNA A;  4E7I A;  3SQ0 A;  3NF6 A;  1TL1 A;  2KW4 A;  2VG5 A;  3F9K A;  4CHP A;  5SZT A;  1VSD A;  2MJ7 A;  1C1C A;  1VSF A;  1BCO A;  4CF8 A;  1XC9 A;  1NJW A;  4NCA A;  3THV A;  4PUO A;  3UIQ A;  3S3O A;  3LP3 A;  4W5N A;  3U3Y A;  1QN9 A;  4FW2 A;  5IYB P;  2BAN A;  3VQD A;  3CFR A;  2F8T A;  4LH4 A;  3SUQ A;  4Z4H A;  1WSH A;  5IYD P;  1J54 A;  4H4O A;  1EBM A;  3DM2 A;  4CJW A;  1HNI A;  3OSM A;  1C0M A;  2PZS A;  2HW3 A;  1BIS A;  4E1N A;  3KTU A;  2ZE2 A;  2KFN A;  1RIL A;  2HHT A;  3KKS A;  4FLU A;  1VSI A;  2X6N A;  4RW7 A;  3L2U A;  3LZI A;  2OPQ A;  1CDW A;  4CGF A;  4DTX A;  2XY5 A;  2HVI A;  1U47 A;  4ID5 A;  1NGM A;  3HO1 A;  2G8H A;  4ROE B;  2X78 A;  5J1E A;  3PX0 A;  5FRN A;  2XO7 A;  4BE2 A;  2O4I A;  1KYU A;  2EX3 A;  2ZQB A;  3NF7 A;  4FCY A;  2EHG A;  4NYN A;  2G8V A;  4CHZ A;  4Z4C A;  2XRI A;  1U48 A;  3ZCM A;  3ZSQ A;  3VQB A;  1NKC A;  2BDP A;  2OYQ A;  4FJJ A;  1SKS A;  3DMJ A;  1YQL A;  1Z26 A;  4F2S A;  1BI4 A;  1KVA A;  3DLE A;  3FFI A;  1VRT A;  4ELV A;  4KI4 A;  1YVU A;  5JS1 A;  4CFD A;  1LWY A;  4YFU A;  4IFV A;  1NKE A;  3HST B;  2O4G A;  4CEO A;  1T03 A;  3NDK A;  4FLX A;  3OYG A;  3NGY A;  3KLH A;  2G8U A;  4KPY A;  2NOE A;  4ICL A;  3VA0 A;  1QHT A;  3HPH A;  1LAW A;  4CFC A;  4E89 A;  3CYM A;  1KFS A;  1KRP A;  4CJK A;  3U6F A;  3L3U A;  4KB1 A;  1YTA A;  4KI6 A;  1J53 A;  3AVI A;  3OYH A;  2G8W A;  2NOI A;  4CJL A;  2YHA A;  1WLJ A;  4E1M A;  4FLW A;  4E7J A;  2XY7 A;  1TAQ A;  3OYA A;  3ITH A;  1TK0 A;  1NK6 A;  3CFO A;  4GMJ B;  2IV8 A;  3EYZ A;  3O3H A;  1A5W A;  2D5R A;  1Y97 A;  4OKK A;  3ZSW A;  4K8Z A;  2HZS A;  1S1U A;  4Y1D A;  1WSI A;  4B9S A;  4IG3 A;  1N39 A;  4MQ3 A;  1RBS A;  2G8I A;  2RKI A;  1SL1 A;  4BWM A;  4FK4 A;  3LPU A;  4KHY A;  1RDB A;  1VOL B;  1REV A;  1B9K A;  4DF4 A;  3MEC A;  3V1R A;  4Q5V A;  1ZYQ A;  1MP9 A;  2ATQ A;  3PX4 A;  1DTQ A;  4OLB A;  1JLB A;  1UT7 A;  1JLF A;  1ZBU A;  3HM9 A;  3OYC A;  5JS2 A;  3OYF A;  1TL3 A;  4O44 A;  1RCH A;  3QO9 A;  3BGR A;  3CFP A;  1Q8I A;  4F2R A;  1C9B B;  4HTU A;  4OKJ A;  1LWV A;  5KGX A;  3O3F A;  1QSY A;  4F3T A;  1BHL A;  4CIE A;  4AHC A;  1C1B A;  4KFB A;  5CZ2 A;  5HRP A;  2Q3S A;  1NK5 A;  3IRX A;  4M41 A;  1D8Y A;  1KCF A;  1QS4 A;  1KYD A;  3K5O A;  3SUP A;  1KTQ A;  4N47 A;  3RMD A;  1EKE A;  1HYS A;  3QLH A;  1SL2 A;  3NFA A;  3DLR A;  4F3O A;  4B8A B;  3WNG A;  4FM0 A;  1T05 A;  3HVT A;  3PY8 A;  3M8S A;  4B0A A;  1HNV A;  2HHX A;  1JLE A;  1I39 A;  4CK2 A;  4IG0 A;  3M8Q A;  3TR8 A;  1RT2 A;  1RBV A;  5DMR A;  3WNF A;  2FBT A;  3VQ8 A;  1ZBI A;  1W9H A;  1RBR A;  4ELT A;  5IYC P;  4HVJ A;  4I7F A;  3CM5 A;  4Q0B A;  4PWD A;  1BQM A;  3OYJ A;  5J2M A;  3RMB A;  3TWH A;  3HS8 A;  3EIK A;  4DFP A;  4N56 A;  3HJF A;  2HHS A;  3HYF A;  4FJN A;  2WON A;  1XI1 A;  4CHO A;  4I9Q A;  1L3U A;  1QNB A;  3RPJ A;  3OC3 C;  5CYM A;  1BQN A;  5HRO A;  4I8O A;  1D3U A;  4FZX C;  4F8R A;  2OZS A;  1BIZ A;  4CK3 A;  4QCL A;  4CJT A;  3ZSO A;  4CE9 A;  1C0U A;  3CM6 A;  2P1J A;  3QIN A;  3VN5 A;  4Y1C A;  1I3A A;  4CGD A;  4E3S A;  1NVP A;  3HXM A;  1PCZ A;  1RNH A;  2IGI A;  1XWL A;  3AA2 A;  3P5J A;  1RBT A;  5HRN A;  4DLG A;  1HJR A;  5T7B A;  4FJ5 A;  1F21 A;  1NJX A;  1JFI C;  3SQ4 A;  1HQE A;  3DLB A;  4KB0 A;  4FK2 A;  2P51 A;  4RG8 A;  3ZT4 A;  3V1Q A;  2YH5 A;  1WSE A;  4RW8 A;  4DSJ A;  1M3Q A;  3NH0 A;  1ASW A;  1JLG A;  4DQQ A;  3AA5 X;  4AIL C;  2HHU A;  4B8C A;  3NAE A;  4TPS A;  4H4M A;  4BDP A;  1SUQ A;  1Z25 A;  3L2R A;  4IKF A;  1YTF A;  4H8K A;  3MXI A;  1X9M A;  4FJI A;  4JLH A;  1DLO A;  1S5J A;  4CEA A;  2ITG A;  3OYL A;  5HLF A;  3QEW A;  4DQS A;  4DQI A;  1RTJ A;  4CF0 A;  1J5O A;  2Z1G A;  4CK1 A;  1HPZ A;  4W5Q A;  3AV9 A;  3KKR A;  2RF2 A;  3MXJ A;  3AO5 A;  4FW1 A;  3PUF A;  3CG7 A;  3NH2 A;  3EZ5 A;  2FBX A;  3C6T A;  3ZT1 A;  1FKP A;  4CGH A;  4JS4 A;  4XIU A;  3V9Z A;  1NK4 A;  4CCH A;  3DLG A;  4KHQ A;  4M3U A;  2FGT A;  2IOC A;  3V9W A;  3OJU A;  3SZ2 A;  4E7H A;  1ZBH A;  2ZD1 A;  1ZBF A;  4LD0 A;  4OGE A;  2D0B A;  1S1T A;  3V4I A;  5FRM A;  3AO4 A;  1X9W A;  3AVA A;  1LAV A;  3SNN A;  1IKX A;  4CF2 A;  4IDK A;  1IKY A;  5C24 A;  3KJV A;  3VA3 A;  1VOK A;  1RTI A;  5KRS A;  1TAU A;  1Q9Y A;  2Y1J A;  1TVR A;  1LV5 A;  3MEE A;  3QEV A;  4DSK A;  1FXX A;  1EX4 A;  2G8F A;  1KY6 A;  3V1O A;  3DRS A;  1LW2 A;  4AHR A;  5CYQ A;  4O0J A;  3AO1 A;  5HBM A;  4DTJ A;  3OVN A;  3LP2 A;  1R4X A;  2QXF A;  4OJR A;  3VQQ A;  4OVL A;  4DTR A;  4CJF A;  4CJU A;  1TK8 A;  1NK0 A;  4N76 A;  3KD1 E;  4LSN A;  4DMN A;  4OPK A;  1NK8 A;  4LY7 A;  3TI0 A;  3LPT A;  3VQ5 A;  1KLN A;  3RWU A;  4CES A;  1RDD A;  2RN2 A;  2P5G A;  4Z0U A;  1TV6 A;  2XHB A;  3T1A A;  2FC0 A;  2I5J A;  3HP6 A;  4CEF A;  4FLT A;  1S9E A;  4DUL A;  3E01 A;  3H08 A;  4JRP A;  3TAF A;  4AHS A;  4ZTF A;  1QTP A;  3VQC A;  3VQA A;  2FBY A;  4FLZ A;  1D9D A;  4B9V A;  3I0W A;  3N89 A;  1QSL A;  3L2W A;  4KHS A;  1YTB A;  3TAN A;  4DTO A;  1L3T A;  1RT3 A;  3K5M A;  4W5R A;  5FDL A;  3EY1 A;  5HP1 A;  4B9N A;  4KHW A;  2I5W A;  2KQ2 A;  3C6U A;  3I0R A;  4R5P A;  2QK9 A;  1WSF A;  3QEX A;  4DTM A;  3B6P A;  4CEE A;  1GOB A;  3DRR A;  3VQP A;  3QES A;  3K2P A;  3QNN A;  4KKO A;  1O1W A;  4IBN A;  2A1R A;  2IAJ A;  5HRS A;  4OPJ A;  3TAP A;  3SI6 A;  2OPS A;  2G8K A;  1BCM A;  1S6Q A;  1N3A A;  2F96 A;  2GUI A;  1HYZ A;  1WNS A;  3KLF A;  3JYT A;  4Z4E A;  5C42 A;  2AJQ A;  4DFK A;  4WE1 A;  3HPO A;  3TAB A;  1N3C A;  4GVM A;  4CEB A;  1BI4 B;  3H1Z A;  1S6P A;  5C25 A;  2KZM A;  1ASV A;  2B5J A;  1UT4 A;  1QN8 A;  1SKW A;  4M45 A;  1BIU A;  3NGZ A;  4K8X A;  1QN7 A;  4FVM A;  1JKH A;  1VSE A;  4C8O A;  3V81 A;  2DFF A;  1TGO A;  1L3V A;  1WSG A;  3QIO A;  4CHN A;  4PQU A;  3I8D A;  3JSM A;  4FXD A;  2HB5 A;  1TBP A;  1X1P A;  4HUF A;  1QTS A;  3QER A;  5DK5 A;  2QKB A;  4CJR A;  2LSN A;  3V6D A;  3F0Z A;  4G1Q A;  3IG1 A;  4CGJ A;  4KTQ A;  1QNE A;  4KTZ A;  3DOL A;  4M3Y A;  1RDA A;  1NJY A;  4E7K A;  4KHN A;  3AVJ A;  3DLK A;  3LWM A;  2Z1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...