2D0CA

Crystal structure of bst-rnase hiii in complex with mn2+
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HIII
publication title Crystal structure and structure-based mutational analyses of RNase HIII from Bacillus stearothermophilus: a new type 2 RNase H with TBP-like substrate-binding domain at the N terminus
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2d0cA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d0cA02
2BGGA 1QN3A 4FM1A 3MEDA 1GOAA 3RRHA 4CK3A 2XY7A 4OVLA 3AO1A 4E1NA 4DSLA 4PQUA 4CFBA 2VWKA 2RF2A 1NKCA 1HNIA 3VQPA 3DLRA 1RT2A 4KB1A 4I2QA 3B6PA 4EZ6A 3H1ZA 4Z4FA 1NH2A 3THVA 4KI6A 3O3GA 1EP4A 1KFSA 1U4BA 4CF0A 4CF9A 4DS5A 1QNCA 4CEDA 2JLEA 3AVNA 3AVCA 4FVMA 1J53A 4CJFA 3LPUA 3OJSA 2X6NA 3NE6A 3HK2A 2KFNA 1KYFA 1JL2A 4DFMA 2E6LA 4W5QA 1TK0A 3ZSQA 4F4KA 4CJVA 4DQRA 5HROA 1RILA 4DTRA 1S6PA 1LV5A 2YV0X 2NUBA 3AVIA 4FLWA 4KAZA 4CJ4A 2HHSA 1SKSA 2XO7A 1YT3A 3QEWA 4NYFA 1HPZA 2B6AA 2IS3A 1NK6A 4Z4EA 3V1QA 1AISA 1N5YA 3OYAA 2X6SA 4CEOA 3SUPA 4FJMA 3AO3A 2OA8A 3DOLA 5J2NA 1TBAB 1ZBLA 1GOBA 1VRUA 1Y97A 4H4MA 4MQ3A 1L5UA 4FK2A 2HHWA 2OPPA 1NK4A 2VG6A 1CZ9A 5FDLA 1HQUA 2ETJA 2GUIA 4BDYA 1HYZA 4FJGA 1XHZA 4FXDA 4CGDA 4HCCA 5T7BA 5IYBP 2R7YA 1QTPA 3KJVA 3O4QA 4OLAA 4EP4A 1VTLE 1S1UA 1ZBUA 4O55A 2DFEA 1WSGA 2FBVA 4IFVA 1TGOA 1VSMA 3AVAA 3NGIA 3KLGA 1NKBA 5SWMA 3OJUA 1K6YA 1VOKA 1VSEA 1BL3A 1IO2A 3P5JA 4F3TA 3V1RA 1E42A 3PX4A 1NKEA 1BIZA 3MECA 3O4NA 1L3SA 1HMVA 1QN5A 3DLHA 4BDPA 1YVUA 3TAGA 1BISA 2OZSA 4M3YA 1BQMA 3QIOA 2HHVA 1JLFA 4CGHA 1FK9A 1VSFA 4CJLA 3OYKA 1U48A 4F8RA 3TABA 3V4IA 1TVRA 4E3SA 4PWDA 3NHGA 1W0HA 3TR8A 4NCBA 4CF1A 1NJWA 4CJUA 3NBPA 5KTQA 3MAQA 3KLFA 3V81A 2OYQA 4CEQA 5HRSA 1L3TA 3RTVA 3HS9A 1VRTA 4OKJA 1CXUA 1X1PA 4CFDA 1EKEA 3V9UA 3HM9A 4E7HA 4QAGA 3U3GA 1W9HA 5J2MA 1D9FA 3OC3C 3TAQA 1RM1A 1EXQA 2YKNA 3ZSWA 4JS4A 3WNEA 4ZHRA 4FLTA 4KI4A 5IYCP 5JS1A 3OYIA 4FYDA 5CZ1A 2P1JA 4FJKA 3VQ4A 4W5TA 3OY9A 3T1AA 2B4JA 4CERA 4OKEA 3AVLA 1IH7A 4CEAA 4E89A 3K5LA 4HHTA 4FJHA 4CJKA 2WONA 3LZJA 3QESA 1NJYA 3AA3A 3M8PA 1RT4A 2GBZA 3AA2A 3OYBA 3SJJA 3ZT3A 3TAEA 3TAPA 4OKKA 2ATQA 2HHTA 4HUFA 4F3OA 1IKWA 4M3TA 1D9DA 2ZE2A 4HTUA 4CHZA 3QEPA 1NVPA 3HVRA 1C9BB 3T3FA 1RDBA 3OYNA 3LP3A 1RCHA 4FW2A 4E7JA 3QEIA 2HMIA 1SUQA 3CFOA 4HCBA 2RKIA 1LW2A 4AHUA 4E19A 1B9DA 1B9FA 1BI4A 4RW8A 1R4XA 4G1QA 4OPJA 1ASVA 1RBSA 2G8UA 3PO5A 1FKPA 3AA5X 1VSKA 3ISNC 5HBMA 3CG7A 3L2WA 3AVGA 5JS2A 2EX3A 2ZD1A 4DU4A 4CCHA 1O1WA 3AVHA 1SL1A 3KIOA 4NYNA 3VQAA 4E0DA 2DTUA 1ITGA 1SKRA 4DG1A 5C42A 1QTMA 1KFDA 3DLEA 5K14A 4IG0A 1NK5A 4FK0A 3HO1A 2HVHA 2G8KA 1CZBA 1VSJA 4O0IA 4CJ5A 1X9MA 4JS5A 1SL0A 4ELTA 4LH4A 3OYGA 4DTXA 3AV9A 3MXMA 3VQDA 4CJRA 2G8HA 1QNAA 2P51A 3AO4A 4B9LA 2KTQA 5HRNA 4C8MA 4DU3A 3HYFA 2Z1HA 3HPGA 3SV4A 3LAKA 3VQ7A 3D0PA 1BHLA 1NK0A 4N47A 2P5OA 5J1EA 4AHRA 4LY7A 2VWJA 4O0JA 2VJ0A 1SV5A 3PX6A 4B9MA 3DLBA 1TBPA 2PYLA 4LD0A 3VQBA 1LAWA 4AHCA 3CQ8A 3HT3A 4R5PA 1QSLA 3PY8A 4DLGA 1U45A 1UAXA 4O5BA 1KTQA 1TKTA 2DFFA 3A2FA 3CM6A 3NGYA 4CEEA 2DFHA 5CZ2A 4Z4HA 2Z1IA 3KK1A 1ZBHA 4F2RA 4K8ZA 2P5GA 3QEXA 4C8LA 1A5VA 3UIQA 4GMJB 1IKVA 3KLIA 5C24A 4CGGA 4AHTA 3RMDA 3RWUA 4KTQA 1MU2A 1TL1A 3ZT4A 3TANA 1ASWA 4KKOA 5DK5A 5I42A 1Z26A 3OYFA 3VQ5A 5IYDP 3DYAA 2IV9A 1TL3A 3EYZA 2YHAA 1J5OA 3OYJA 3SUOA 1QSSA 3VA3A 3SI6A 4FJNA 1KVBA 3SYZA 1YTUA 4DSJA 1PZDA 4B08A 1PCZA 1BCOA 2HHXA 2E6MA 2HB5A 2D5RA 3ZSOA 3KK3A 2VG5A 2YHBA 2OPQA 4DFPA 3LP0A 5SZTA 1JL1A 3T19A 3O3HA 1SKWA 2WOMA 4PUOA 3AVFA 4OPKA 1UWBA 1JLQA 1YTFA 3VN5A 2EHGA 4DTJA 2F96A 1A5XA 4LH5A 3QERA 3DLGA 3SNNA 4FJ8A 1HRHA 1CXQA 4DLEA 1LW0A 4I7FA 3ZSYA 3NCIA 4W5OA 4B9VA 1HYSA 1RDAA 4IBNA 1CDWA 1U04A 1JLCA 3C6TA 4FJIA 3PUFA 3D45A 2IAJA 1HYVA 1S1TA 4BWJA 1W80A 4B8AB 3SZ2A 4DTMA 4DWIA 4L8RB 1WN7A 1S9EA 1JLAA 1UA0A 3ZSRA 4B8CA 3RR7A 4KPYA 4M3XA 2BDPA 1QN7A 1ZYQA 4E7IA 1QN4A 1TV6A 3LAMA 2B5JA 2HNZA 3QEVA 3DM2A 3MXJA 4CF2A 1LWEA 3LALA 4DTUA 3QO9A 4IG3A 5J2QA 4KHSA 4DSFA 4I2PA 3CFRA 2YNGA 1S6QA 4CESA 4M42A 2BANA 1S5JA 1BGXT 1WSHA 3SUQA 3OVNA 3AA4A 3EY1A 4CGJA 3RRGA 3LDSA 4KB0A 2QKKA 1IKXA 3AO5A 2XY5A 3ITHA 3O3FA 3PX0A 2HW3A 4CJPA 2G8IA 4FLZA 4IDKA 4WE1A 4FK4A 3RMBA 3NF7A 1C0TA 4C8KA 4DMNA 4BE0A 4KHWA 2D0CA 1UA1A 2G8VA 4CJSA 3V9SA 3AVMA 3K57A 1RT7A 1KLNA 3ZSXA 4JRPA 3OYEA 3LWLA 3DLKA 3VQQA 2X78A 2XY8A 4DSIA 4H8KA 3EZ5A 1N6QA 4TSXA 1QQCA 2FBYA 1JXEA 2OPSA 3K5MA 1J54A 3AVBA 1Q8IA 3AVKA 4Y1DA 4GW6A 1A5WA 2AJQA 1TK5A 1RT6A 2ITGA 3OS0A 4CHPA 5CYMA 2FBXA 4CJQA 4E7LA 2E4LA 1REVA 4KTZA 3DRPA 1T05A 1RTIA 3VQEA 4YNQA 3AO2A 3L2VA 3HVTA 2HVIA 3S9HA 3LPTA 3SUNA 1ASUA 4CFCA 4B9SA 4M3ZA 3MEGA 1QN6A 4IKFA 2W42A 2I5JA 1RBUA 4CHQA 1JKHA 1WLJA 3NGZA 1J9AA 4FW1A 3NFAA 1SL2A 4RODB 3F73A 2FC0A 1NGMA 1JLGA 4CIFA 1WSFA 1YTAA 4CGIA 3ZT0A 5KRTA 3V1OA 2FBTA 4I9QA 2A1RA 4K8XA 2VG7A 3MEEA 1C1AA 3HL8A 1XWLA 2YNFA 1RT5A 3KTQA 5HRPA 4ZTFA 3OCIA 3BGRA 4I9LA 2Z1GA 3I0SA 3C6UA 4PA1A 4CJWA 1IKYA 3QINA 3BDPA 4M3WA 1XI1A 3K2PA 2YNHA 5CY4A 1S1WA 1KY7A 5KI6A 2PY5A 4DQPA 1D8YA 3KD1E 1YTBA 1XC9A 5FRNA 2Y1IA 1RTJA 3E01A 5E41A 1Q9XA 3C95A 2HNDA 4EZ9A 3NF9A 3WNGA 3DOKA 4CJEA 4E7KA 1RDDA 3WNFA 1JLEA 3TAMA 5KGWA 4UQGA 3TARA 2D0AA 3HS8A 1DTQA 1NK8A 2PZSA 1LAVA 4QOZB 4FJLA 1T03A 1MP9A 1BI4B 1QE1A 4ID5A 3I8DA 4DTNA 1NJXA 1S1VA 3QNNA 4F2SA 3ZT1A 4B9UA 4J2EA 1QTSA 1Q9YA 4CECA 1JXBA 4LSLA 4CHOA 4JRQA 2GV9A 4RW9A 3NH1A 5HLFA 1NOZA 1BCMA 1QHTA 5DMRA 4Q5VA 4N41A 3SQ2A 3SPYA 1TKDA 1L3UA 3HP6A 1HJRA 4DFJA 1KSPA 1KVAA 3NAEA 3EIKA 1R0AA 3LP1A 3OYDA 3AVJA 3PO4A 2JGUA 3S3MA 4DU1A 3M8RA 3FFIA 3NDKA 2ZQBA 3HXMA 3I0RA 3OYMA 1LWCA 4Y1CA 4W5RA 4GVMA 4ICLA 1TGHA 1B92A 1LWFA 2RPIA 3K5OA 3IG1A 4RW7A 3V6DA 2QK9A 3C94A 3NF8A 1XHXA 4FLXA 3HSTB 2OZMA 4OGCA 1VOLB 1B9KA 4FLUA 1QN8A 4MFBA 4EP5A 3P83D 4HUGA 3ZSVA 3RMCA 3NH0A 3VQCA 1TK8A 1T8EA 3VQ8A 3G10A 3LWMA 3U3YA 1S9GA 2D0BA 1JLBA 3JYTA 3V9XA 3TAFA 3MXIA 3M8SA 3RR8A 1EETA 3DI6A 4KHNA 4OGEA 4DF8A 3K5NA 4CHYA 1ZBIA 1C0UA 4KO0A 4N76A 2QKBA 4YFUA 2XY6A 1T7PA 4J2BA 4BE2A 4DQSA 2QXFA 2O4IA 1WSIA 4CEBA 3CFPA 3G0ZA 2G8WA 3SV3A 3RMAA 4FJ9A 4KRFA 4BWMA 4FZYA 4B9TA 4E1MA 1F21A 4B3OA 3OYHA 3L2UA 3V9WA 4KHUA 4BDZA 3SQ4A 4Z0UA 4DTSA 5CYQA 1C1BA 1IG9A 2F8SA 3DMJA 1RT1A 4H4OA 4B0AA 3L2RA 1C0MA 5I3UA 4OLBA 2IV8A 1EX4A 3JSMA 4FM2A 4RW4A 4ROEB 2MJ7A 1FKOA 1RTHA 2IGIA 4CJTA 4KHYA 4Q0BA 3KK2A 1QSYA 2G8FA 3LP2A 4LSNA 1RBRA 2IDOA 1WNSA 3CYMA 3IRXA 3QIPA 3QLHA 4M45A 3WNHA 5D3GA 3F9KA 4CK1A 3U6FA 2Y1JA 4FJ5A 5J2PA 4DS4A 3HPHA 4AHVA 4KTWA 4RW6A 1D5AA 1I3AA 4DTPA 1KRPA 2HHUA 4AH9A 3LZIA 2XRIA 3DRRA 3OS1A 2XHBA 2HNYA 1WAFA 1I39A 3OYLA 3L2QA 3K58A 1KY6A 1WSJA 4M41A 3ALYA 3SCXA 4KHQA 1TAQA 2Z8UA 1VK0A 2F8TA 4DQIA 2HHQA 5HRRA 1X9SA 4AHSA 4RG8A 4FLVA 1TKXA 4BE1A 5EU7A 4FZZA 1QS4A 3CM5A 1VSHA 3KKSA 2YNIA 4CEZA 1QNBA 4BACA 4ELUA 4CE9A 1CLQA 4CGFA 3LANA 4FJ7A 1HNVA 1QNEA 2IC3A 3HP9A 3NH2A 4DTOA 1U47A 2KW4A 3VA0A 3ZCMA 3IAYA 4KV8A 2BE2A 1G15A 3B6OA 4CK2A 3SQ0A 4C8OA 4NCAA 4ID1A 4KFBA 4FCYA 4ELVA 5C25A 4FJJA 4CEFA 5FROA 4DSEA 4DFKA 3ASMA 1HQEA 4CHNA 1C1CA 1WAJA 1UOCA 4O4GA 1FXXA 3SQ1A 1KLMA 3HPOA 2KZMA 4W5NA 1RBVA 1RBTA 4NCGA 1RDCA 2KFZA 3OS2A 4M3RA 1WSEA 3H08A 3SPZA 1Z25A 1NOYA 4FZXC 3KKRA 3L3UA 2A1SA 4Z4GA 3KLEA 4QCLA 1GOCA 4M3UA 3L8BA 4DSKA 1C6VA 3TI0A 1U49A 4ROCB 4O44A 3ZSZA 4CIEA 2PYJA 2KZZA 4CJ3A 1D3UA 3VQ6A 1S1XA 1JFIC 1QN9A 4DQQA 2IOCA 1KYDA 1KYUA 3S3OA 4J2AA 3S3NA 4Z4IA 3V9ZA 4B9NA 2G30A 4FLYA 3HJFA 3TWHA 4PY5A 3IS9A 4N5SA 4Z4CA 2KQ2A 2LSNA 1TKZA 4KREA 2OPRA 3VQ9A 4CF8A 1BQNA 2X74A 3K59A 4N56A 3P1GA 3ZT2A 2YKMA 1ZBFA 2O4GA 4ZTJA 4WZSD 3QETA 1X9WA 3KD5E 3M8QA 5KGXA 4HUEA 1RNHA 1BIUA 4OJRA 1NJZA 1NK7A 4XIUA 3KLHA 1RTDA 2DY4A 2RN2A 1KCFA 4IFYA 4AILC 3PV8A 1NK9A 1KVCA 1RT3A 3L3VA 4JLHA 3QNOA 1DTTA 4FM0A 5KRSA 4CIGA 1VSDA 1L3VA 5FRMA 4CFAA 4HVJA 1DLOA 4DF4A 5HP1A 1VSLA 1TAUA 4J2DA 3OYCA 1VTOA 1VSIA 3ULDA 2Q3SA 4FJXA 2Z1JA 3NF6A 4C8NA 3DRSA
chains in the Genus database with same CATH superfamily
4FM1A 4IL8A 3PLAA 3RRHA 1RGIA 4E1NA 4DSLA 1YQMA 2RF2A 3VQPA 4I2QA 1NH2A 5AQHA 1KFSA 2JLEA 3CD6N 2I7PA 4W5QA 1TK0A 3AGRA 5AZIB 3ZSQA 4WQ5A 5HROA 2ZGYA 1VQ9N 1S6PA 1LV5A 4FLWA 4KAZA 1YT3A 3QEWA 4NYFA 2XHIA 2B6AA 3V1QA 3O4WA 5JLFA 3NA5A 1AISA 3OYAA 4CEOA 1RDUA 5GADP 4FJMA 2OA8A 1GLEG 1GOBA 4JKAA 4MQ3A 2OPPA 4JK7A 4K25A 4JHDB 5FDLA 4DR3K 4BDYA 1QVGM 1QTPA 2HL9A 3KJVA 2IVOA 3BF3A 2DFEA 1HKGA 4IFVA 3KLGA 5SWMA 1W2BM 2YI1A 4BRPA 1WB9A 2F7LA 4BDPA 1YVUA 5EY4A 2FKMX 1FK9A 4H5WA 3P38A 1XSZA 2P9SB 1NBWA 1S22A 5CR4A 1VQ8N 3TTCA 3MAQA 2OYQA 3THYA 2HMPA 3RTVA 4DR4K 1CXUA 4JKCA 4CFDA 2P9UB 4QAGA 5M1OA 1W9HA 5J2MA 4K0KK 3H45C 4JS4A 3WNEA 4ZHRA 2GX9A 1T6AA 4CERA 4IDHA 3K5LA 4FJHA 2WONA 1XQSC 3LZJA 1Q81O 2Z0FA 2GBZA 3OYBA 2WFBA 4F3OA 4M3TA 1D9DA 3CCQN 4A62A 5EPCA 4JI5K 2FUVA 1C9BB 4FO0A 3T3FA 4KH5A 2HMIA 4E19A 4BGAA 4OPJA 3VESA 2G8UA 1RBSA 4HCCA 2QW9A 4JKFA 1OH6A 2FKFA 4E0DA 5C42A 1KFDA 4FK0A 3HO1A 4O0IA 1X9MA 4JD2A 4JS5A 4ELTA 3OYGA 4DTXA 3WEEB 5AQNA 3VQDA 4BVOA 4BC3A 1QNAA 2V51B 4BQLA 4C8MA 4FPBA 4DV0K 3EEQA 4YDUA 3ATUA 1SQKA 3A5MC 4O0JA 2ZJPL 3HM8A 3CJBA 1ZBSA 4R5PA 3PY8A 1KTQA 2YJFA 3TPQA 4B3SK 2DFHA 5CZ2A 2Z1IA 2NRTA 4F2RA 4Q11A 1DGKN 1ILYA 1T6CA 1A5VA 3HRGA 2P9NA 1TL1A 3HI0A 2CH6A 5I42A 1X3NA 3W3DA 2IV9A 1TL3A 2QWQA 1J5OA 3SUOA 2NLVA 2DPNA 1PZDA 4B1WB 5BR8K 4BRIA 3SJHA 5AFUA 2VG5A 3WXJA 2OPQA 5JLHA 3LP0A 4BRHA 3O3HA 3SAHA 4PUOA 4OPKA 1UWBA 1FW6A 4DTJA 2FLOA 3MMVA 2ITMA 4JI0K 1LW0A 3ZYYX 2QTDA 4B9VA 1PCMX 5AQSA 1JLCA 3C6TA 3PUFA 3D45A 2IAJA 1HYVA 3MN9A 4DWIA 1NGCA 3EKUA 1QN7A 3UKRA 1ZYQA 2HNZA 2JHNA 3LALA 1ATRA 4M42A 1S6QA 1NMDA 3C6AA 1TYQB 3RSMA 3OLPA 3VPZA 3H3OB 1DIZA 3ITHA 3O3FA 3PX0A 4CJPA 4FPAA 2G8IA 2I5WA 2NVMA 1FJGK 2P9PA 4KHWA 3BZCA 4A2AA 1UA1A 3VTIA 3V9SA 4PL8A 2O8CA 1KLNA 3CHWA 4JRPA 3LWLA 3DLKA 3SBTA 2XY8A 4TSXA 1JXEA 3K5MA 3SBGA 1Q8IA 2GUPA 4NXNK 3J80O 4H0XB 1T3VA 2AJQA 2ITGA 1OVQA 4EAJA 1T05A 4FOEA 3VQEA 2HVIA 3HVTA 3LM2A 3FZLA 3ZEUB 2E5LK 3LPTA 4WQ5C 4B9SA 4M3ZA 1VQNN 1QN6A 4CHQA 1JKHA 4U7BA 3NGZA 1MWMA 1J9AA 4IXCA 3VEOA 2JOIA 1SL2A 3TU5A 3ZETA 2W6LA 1WSFA 1YTAA 2Q31A 5KRTA 4K8XA 3H1QA 1XWLA 1PCJX 1U6ZA 5LMUK 4ZTFA 2ASMA 1GLJO 2P9LA 2QWNA 4PA1A 3T7ZA 5AQMA 3BDPA 3CCUN 1XI1A 4A5BA 3BUZB 1S1WA 3ULEB 5KI6A 4NXMK 4O8UA 3EO3A 4BR0A 4K43A 3WNGA 4CJEA 3OTOK 1JLEA 3TAMA 5KGWA 1TUOA 2PZSA 4FJLA 1NJIO 4ID5A 1OH7A 1VAZA 1S1VA 4J2EA 2E20A 2QRDA 2GV9A 5HLFA 5DMRA 4Q5VA 3MCAB 2QRCA 3RVCA 3SPYA 3DXKA 3CPEA 1L3UA 3C0BA 4BRFA 3EL2A 4CI6A 3LP1A 3WUHA 3OSEA 3J7YP 3NDKA 4MDBA 4W5RA 4GVMA 4ICLA 3CF5L 3MWTA 3IG1A 3V6DA 1J5EK 3ENCA 3NF8A 1K2YX 2HZMA 4WQ4A 2QREA 5ELZA 4D7RA 4FLUA 2W6KA 3FLCO 4LF5K 2Q97A 1ATNA 4I6MB 3LWMA 1S9GA 3O9SA 3L6QA 3TAFA 3IUCA 4PKGA 4DF8A 3K5NA 4DR7K 4BRCA 2NOIA 4Y0WA 3N89A 2UYTA 4YFUA 4J2BA 4BE2A 4DQSA 2O4IA 4CEBA 3G0ZA 5AQJA 3SV3A 3F10A 4BWMA 4E1MA 4B3OA 4PL7A 3L2UA 2D0PA 3SQ4A 1Q86O 4WCEL 1P90A 1C1BA 4JK9A 2F8SA 4B0AA 2NRHA 4FM2A 5AR0A 4I8OA 3ZX0A 3KK2A 2G8FA 4YDUC 5D3GA 3SAFA 3F9KA 4CK1A 4DV2K 2Y1JA 5J2PA 4DS4A 4EAIA 4FL9A 3DRRA 4O5FA 4JI4K 2XHBA 1SS6A 2HNYA 4BJUA 4XH4A 4FWQA 2F8TA 4DQIA 5HRRA 4AM6A 3DXMA 1X9SA 2NRXA 4RG8A 2R5XA 3VGMA 4BACA 3KRMA 3WXLA 5KPZA 1QNBA 4QS8A 4DV5K 1QNEA 3M5RA 4C8OA 3B6OA 3U8XA 2DKDA 5C25A 4FJJA 4H0OA 3ASMA 1HQEA 2UXDK 1U2VA 1KAXA 4BRKA 1KLMA 4W5NA 2F9TA 5AQKA 5JMVD 4F9OA 3SPZA 4FZXC 3L3UA 2A1SA 2P9KA 3KLEA 1C6VA 4ISEA 1Z05A 1S1XA 2WUSA 3I55N 1JFIC 4CFFA 4WXAA 1QN9A 5EX5A 4DQQA 1KYDA 4PKIA 1YJ9N 2HZSA 1BOTO 3G6EN 3ATVA 3TSUA 3IS9A 4ISGA 3VF4A 4Z4CA 2KQ2A 3VQ9A 2X74A 3F5TA 2UU9K 2O4GA 3QETA 4BRQA 3PDKA 4HUEA 2P9IA 4OJRA 5AQGA 1NJZA 1HNXK 1DEJA 3U9DA 1KCFA 4HWIA 1NK9A 3VOVA 1RT3A 3QNOA 4BR4A 5FRMA 5C0YA 5HP1A 3U4LA 3OYCA 4J2DA 1VTOA 3ULDA 4DV3K 1KFQA 3NF6A 2BGGA 3THXB 3CJCA 3B8AX 3LDPA 3MEDA 4CFBA 2VWKA 4Z4FA 5KPTA 1U4BA 4CF0A 4CF9A 1QNCA 4CEDA 5A2QO 3AVNA 4MLHA 3NE6A 3HK2A 4D7QA 5DM6L 2O8BB 4DFMA 3ZX3A 4CJVA 4DQRA 1I94K 4DTRA 1NMNA 3AVIA 2HHSA 4IEEA 4HJHA 5BMNA 2WC9A 3A0IX 1SKSA 3EE8A 3WXKA 2FF3B 3SUPA 3AO3A 1TBAB 4FK2A 2VG6A 1CZ9A 3HTVA 4CD3A 3UKUB 4OLAA 5IWAK 2J4RA 3FZHA 1VTLE 1ZBUA 2FBVA 1WSGA 3T1YK 1VQ5N 1NKBA 4H03B 4KBOA 1EUVA 1BL3A 1IO2A 3P5JA 3VERA 3V1RA 3PX4A 5C10A 2W40A 1HMVA 2OZSA 4B3TK 1ZC6A 1BISA 2KKZA 1JLFA 3P39A 4IFEA 5FPMA 3U9ZA 3VEXA 3RSEB 3OYKA 3MCPA 4E3SA 3TR8A 3ENBA 1P5GX 4BRNA 4CF1A 1NJWA 4CJUA 1R59O 3V81A 3W0LA 1X1PA 3KZBA 3V9UA 3HM9A 1D9FA 5AN4A 1RM1A 1EXQA 2F7TA 3ZSWA 3PIOL 3OYIA 5CZ1A 4W5TA 3OY9A 1MPGA 4EHTA 3AVLA 2NOZA 4E89A 2NOEA 4WQ4C 1NJYA 5FPDA 3SJJA 3AA2A 5AQYA 5FPNA 3TAPA 3TAEA 2D4WA 3MDQA 1NM1A 4CHZA 4EFHA 4EALA 1RDBA 3OYNA 4FW2A 4E7JA 1LW2A 1B9DA 4DV4K 1B9FA 2O8EB 4WFNL 1IBKK 1FKPA 3GE1A 5JS2A 2ZD1A 1O1WA 3C65A 1SL1A 3KIOA 3QBWA 1ITGA 3ULXA 2E2QA 3LDNA 4V19S 3VTHA 1NGFA 4IJAA 4CJ5A 4YOWA 4R79A 4X65K 3MXMA 2P51A 1N3AA 2KTQA 2YHYA 3GBTA 3M6GA 3MWPA 1NGHA 3D0PA 4N47A 5GAGP 4LY7A 2VJ0A 3MN6A 1TBPA 5JICA 2PYLA 4LF7K 1LAWA 2V52B 1P5DX 4DLGA 1V4SA 1U45A 1TKTA 3CM6A 3A2FA 4CEEA 2YJEA 5F2RA 3KK1A 4BG8A 1ZBHA 4K8ZA 2P5GA 3UIQA 3RWUA 4CGGA 4AHTA 4B1VA 3RMDA 1MU2A 3BF1A 1Z26A 3OYFA 3VQ5A 5IT9O 1HKBA 3DYAA 1VQLN 3OYJA 1KVBA 4B08A 4KH4A 2HB5A 5AQVA 2GTDA 2YHBA 4FWPA 4CD1A 3OH6A 3O5BA 1JL1A 3C6HA 4Z94A 4KHPK 5KQDA 2I7NA 2F96A 3O1WA 4JKHA 3DLGA 1HRHA 4JKGB 3KVGA 4DLEA 3NCIA 3CC2N 4K41A 3I0WA 4FJIA 1S1TA 4DTMA 4XH5A 2D0OA 3QMLA 4B1UB 1QN4A 5C2DA 4E7IA 3VENA 4BC4A 5GINA 4J8FA 3O8MA 3MXJA 4CF2A 1NNEA 4IG3A 1DT9A 2E1ZA 3CERA 4BR5A 2QR1A 4LC9B 4YOUA 1K35A 3WQTA 1BGXT 3SUQA 3OVNA 1LWWA 3RRGA 3EY1A 3LDSA 2Q36A 2QKKA 4RTFD 2HW3A 4B9QA 3CVTA 3NF7A 3EAYA 1C0TA 3CJ9A 3KHYA 4BE0A 1BWFO 4A59A 3AVMA 2AP1A 1W7AA 3OYEA 4JNEA 3SMPA 4DSIA 2Q0RA 4BR7A 4DQ8A 3GOIA 1J54A 2A3ZA 3AVKA 1J6ZA 4Y1DA 4GW6A 3CMAN 4ISFA 1RT6A 4CHPA 4E7LA 2YA3A 2E4LA 1GLCG 3DRPA 3GDQA 1RDWX 1KD1O 4CZIA 1Q82O 3CW7A 3VEVA 3THYB 3F9MA 1KQSM 2YHXA 3NFAA 4RODB 3L4QA 2FC0A 3WT0A 4CGIA 2VG7A 1M3QA 1C1AA 3UE5A 4BG9A 3C6UA 1IKYA 2QXLA 3K2PA 2RE2A 3LDOA 5CY4A 1KY7A 2FXUA 5BRDA 1D8YA 3KD1E 2CGLA 4L3QA 3AGKA 1Q9XA 3C95A 1C4GA 3VF2A 3NF9A 3DOKA 1WOQA 3C7NA 2NLXA 1HR0K 1T03A 3NVMA 1NGIA 3J7AP 4DTNA 3QBXA 1NGDA 2Q0UA 3O9RA 4B9UA 2KHOA 3QDKA 2ZWHA 1Q9YA 4LSLA 3NH1A 4RW9A 1N39A 4GV9A 1BCMA 3TDHA 4N41A 2DKCA 2QEXN 5AQZA 3HP6A 4H5VA 1HPMA 3CIPA 1D4XA 1KSPA 4JD2B 1KC8O 5H1SQ 4DV1K 3CCSN 2FGTA 3OYDA 3AVJA 2JGUA 3MN7A 1NGAA 3A8YA 3FFIA 2ZQBA 3HXMA 3I0RA 2E2OA 2EWSA 4IO8A 4DR6K 4JEPA 3HSCA 5AQTA 1TGHA 4B1ZA 2UUAK 2QK9A 1XHXA 4FLXA 2QI2A 2QM1A 1B9KA 2NRRA 4EP5A 4CVNE 2HHHK 2E2PA 1QZ5A 5CE3A 3VQCA 1TK8A 3VQ8A 3QB0A 1EBMA 4JKDA 2D0BA 3MXIA 3M8SA 1EETA 1H1VA 4CZHA 4N76A 2QKBA 2P9NB 2XY6A 2RHKA 2FSJA 4MRQA 1HKCA 1HX1A 3RMAA 3IMXA 4KRFA 4FZYA 4B9TA 1F21A 1IG8A 3OYHA 3V9WA 5CYQA 5LY3A 3DMJA 4GV3A 1RT1A 3FFKB 1VQ4N 1NGGA 3SNSA 4C7PA 2IV8A 3JSMA 4ROEB 2MJ7A 1FKOA 4DKWA 1BDGA 1BUPA 3LDQA 3LP2A 4LSNA 1RBRA 2IDOA 1WNSA 3CYMA 3WNHA 4A57A 3CXCM 3O9TA 4OO1J 1QQOA 4KTWA 4DTPA 1VQPN 1KRPA 2HHUA 4AH9A 2XRIA 1I39A 1VQKN 2V92A 3ALYA 2VQEK 3UW2A 5JVGL 3UKRB 3OSTA 2H5AX 4AHSA 1BA1A 1TKXA 1O13A 1P8ZA 3CM5A 2YNIA 4ELUA 5AQOA 2VCPA 4C23A 1XUPO 4H0PA 3CJ1A 5AZJA 2E2NA 3HP9A 5B8HA 2KW4A 3ZCMA 2BE2A 3SQ0A 5M1PA 4YORA 4NCAA 4FCYA 4KFBA 2Z1JA 4FWMA 4DSEA 1YUWA 3OBWA 1UOCA 4O4GA 2OCEA 3SQ1A 2P9PB 3O08A 1RBTA 2O8CB 4M3RA 1WSEA 5BR9A 1T6DA 3IFRA 1GOCA 3L8BA 2PYJA 4ROCB 2KZZA 1D3UA 3VQ6A 3T69A 4QG5A 2IOCA 4J2AA 3SK3A 2E8AA 3V9ZA 5KQ8A 4B9NA 4MLEA 3D2FA 1HUXA 3TWHA 1C0GA 3ZX2A 4N5SA 3K9KA 1TKZA 2UXBK 4KREA 2OPRA 2V8QA 3K59A 2QWRA 1E4GT 2ZM6K 2PWWA 2HBMA 4ZTJA 3KD5E 3M8QA 5KGXA 2VWBA 1NK7A 4XIUA 3KLHA 3JXUA 3ZETB 3PV8A 2NWVA 1IBLK 1JDYA 4CIGA 3D7EO 2VGMA 3TE5A 4CFAA 1VSLA 2H3GX 1N8RO 2JPIA 2P9LB 4BRLA 4YHHK 5C2FA 1QN3A 4B3RK 4PHTX 4CK3A 4PQUA 1WUAA 3VEYA 4FWNA 1HNIA 1NKCA 4LFBK 3DLRA 4KB1A 1BO5O 3CC4N 4EZ6A 3H1ZA 3THVA 4KI6A 3O3GA 1EP4A 1M5Q1 3VEZA 3QESA 4DS5A 3G4SN 4CJFA 1J53A 3OJSA 3LPUA 2KFNA 1K8AO 4F4KA 3O6WA 1RILA 1JCGA 4WFBL 3BY5A 2NUBA 3J7ZO 3DXKB 2XO7A 1NK6A 1JJ2M 1GLAG 2ZJRL 1ZBLA 4UY8O 1L5UA 2HHWA 2EHBD 5AQRA 1NK4A 3CJ7A 3CI5A 1HYZA 4FXDA 1XHZA 3FZKA 4CGDA 3CCMN 3O80A 3D2EA 3CCJN 1S1UA 3CWUA 1TGOA 1VSMA 3NGIA 2QWMA 3EKSA 1VSEA 2GEMA 1E42A 1NKEA 3CQXA 1VQ7N 3MECA 3DLHA 4M3YA 3TAGA 3QIOA 2HHVA 4CJLA 1VSFA 1T44A 2UUBK 3VETA 4NLBA 3V4IA 3NHGA 3OSMA 5BMPA 4NCBA 4IOAL 3NBPA 5KTQA 2H4LX 3KLFA 4CEQA 2IIRA 5AQUA 3HS9A 1X9JA 1VRTA 5CHIA 3SLCA 4E7HA 4EHUA 5M1QA 4IO9L 4DR5K 2UUCK 5MLCQ 4FYDA 2P1JA 4FJKA 3VQ4A 4OKEA 1IH7A 3Q7BA 4HHTA 3FGUA 1LWYA 4FWOA 5AQLA 3HJFA 3AA3A 3M8PA 1RT4A 3JS6A 3ZT3A 2ATQA 2HHTA 4HUFA 4BR9A 4HTUA 1NVPA 3DXMB 5GIOA 3HVRA 1RCHA 3OHRA 4HCBA 3CFOA 1NWKA 1BI4A 3PIPL 1R4XA 4G1QA 4KHUA 3ISNC 5HBMA 4C1NI 4AM7A 3L2WA 4CCHA 2EX3A 4DU4A 3AVHA 3VQAA 4DV6K 1YI2N 4DG1A 3FZFA 4OX9K 1U2VB 3GL1A 4JYAK 3LDLA 3ZLJA 5EVZA 2HBKA 3AV9A 3L4IA 4CJRA 3AO4A 4B9LA 2HF3A 5HRNA 4DU3A 2Z1HA 3CCRN 3LAKA 1MA9B 1BHLA 4H5NA 3FZMA 3IKMA 4AHRA 4H5TA 1NGEA 1LXTA 1SV5A 2P9KB 3PX6A 4B9MA 3VQBA 4AHCA 4O5BA 4GNIA 2DFFA 3NGYA 4CBWA 4Z4HA 3WXMB 2A5XA 5E84A 1GLDG 3QEXA 4C8LA 1XNRK 1IKVA 3KLIA 5C24A 3M3ZA 3ZT4A 4MO4A 3TANA 4KKOA 3BEXA 3EYZA 1QSSA 5GAHP 3VA3A 3SI6A 3HOTA 1YTUA 1PCZA 1WQAA 2P9IB 2E6MA 2HHXA 2QLVA 1HJOA 5SZTA 1YTFA 2ASPA 3VN5A 4GY2B 3LM9A 3QERA 1K8KA 3SNNA 1BG3A 2O8DA 1CXQA 2YH5A 3ZSYA 4IBNA 2NOHA 1U04A 5KPRA 5AQXA 1N3CA 1W80A 4L8RB 3VEWA 4M3XA 4KPYA 4A2BA 4QS7A 2BDPA 5ADXH 1YF5L 3DM2A 1LWVA 4FVUA 1LWEA 2WBNA 4JK8A 4M7YA 5BPNA 5AQWA 4I2PA 2YNGA 4WYBA 4CBXA 3THWA 2NOBA 3VGKA 1SZ2A 4CGJA 4MO5A 1IKXA 3MK6A 4FLZA 2NOFA 3NVKA 4FK4A 4C8KA 1NGJA 4EIAA 2ASOA 4AF1A 3K57A 1RT7A 4DHYA 2X78A 4H8KA 3EZ5A 4FWRA 1N6QA 3N4PA 2QWPA 5EXWA 2OPSA 1UT4A 3AVBA 4FSVA 1A5WA 3D4VA 3EE9A 3KK7A 3L0QA 1TK5A 2O8FA 3EN9A 1YQRA 2FBXA 4BRAA 4CJQA 3THWB 1Q9UA 4YNQA 3AO2A 3L2VA 3TTDA 3S9HA 1K9MO 1N33K 3DAWA 1ASUA 1NGBA 3MEGA 2ZFDB 2I5JA 5C15A 4FW1A 5BPLA 3F73A 1NGMA 4B1YB 4IJNA 4CIFA 2VYPA 3V1OA 2FBTA 4YY3K 2A1RA 2HBLA 3MEEA 2V9JA 2Y8QA 4GV6A 1RT5A 3KTQA 3OCIA 4I9LA 3I0SA 4DB3A 2QWLA 3QINA 2YNHA 4E1JA 2PY5A 3A5NC 5FRNA 3E01A 5FPEA 2V7YA 4EZ9A 4E7KA 2FF6A 1RDDA 4AQYK 3TARA 1NK8A 2D0AA 3HS8A 1LAVA 4QOZB 3I8DA 3QNNA 4F2SA 4WX8A 3QFPA 1QTSA 4CECA 1VKLA 1JXBA 3R6MA 5AZIA 4JRQA 1LCUA 1NOZA 1QHTA 1KXPA 4CZJA 1TKDA 1HJRA 1VQMN 3NAEA 2A42A 3EIKA 3PO4A 4DU1A 3M8RA 1KAYA 3E9OA 3DWLA 3OYMA 1LWCA 4Y1CA 4JHDA 3QFUA 1LWFA 3K5OA 2RPIA 4BY9C 4LF6K 3C94A 1BA0A 2OZMA 1VOLB 1UL7A 4MFBA 4HUGA 4B1XB 3P83D 3RMCA 3ZSVA 5LJWA 3ID8A 3CJAA 4BVPA 4WFAL 1T8EA 3U3YA 2ZJQL 1JLBA 3JYTA 1M1KO 4ILGB 3DI6A 4KHNA 4OGEA 1C47A 4CHYA 1C0UA 5M1FA 4OPAA 4IOXA 1YVNA 2LAEA 2P9SA 4M63C 2QXFA 3ENOA 2PAVA 4FJ9A 1CZAN 4BDZA 1HNWK 2PBDA 4X66K 2P9UA 4H4OA 1C0MA 5I3UA 4H5RA 3G25A 2IGIA 4CJTA 3MN5A 4KHYA 3HBTA 4M45A 4DCHA 3GG4A 1HLUA 4TPSA 3QIPA 3CWTA 4FJ5A 3HPHA 4AHVA 4LF9K 4RW6A 1I3AA 4U67L 2BTFA 3OS1A 4CZMA 3F0ZA 3L2QA 1NJXA 3K58A 1WSJA 4KHQA 1JCEA 1TAQA 2Z8UA 1VK0A 2HHQA 5BN8A 1TUYA 3DLLL 2HL8A 4BE1A 2E88A 1QS4A 3SMSA 1VSHA 1YITN 4Z4GA 4BRMA 1HNVA 4DTOA 1MWKA 3VA0A 3IAYA 1G15A 2GELA 1W97L 4ELVA 4CEFA 1J3MA 1E3MA 4CHNA 1WAJA 4JI8K 3WEEA 1FXXA 4NLCA 2VQFK 4NCGA 3N4QA 1KFIA 3H6EA 3MX5A 2BH1A 1NOYA 2NNWA 3KKRA 1EO1A 1Z6RA 4DSKA 1WBBA 4O44A 4CJ3A 2F9WA 1OH8A 1KYUA 1BU6O 3MX2A 3S3NA 4Z4IA 1SAZA 4MDAA 5F0XA 2G30A 1X3MA 4LFAK 3P4IA 1V5SA 4RWTA 4PY5A 3VGLA 1NG9A 4DV7K 1KAZA 1ESVA 1BQNA 4CF8A 1GLLO 3OGDA 4N56A 3P1GA 3ZT2A 4CBUA 2YKMA 1ZBFA 4WZSD 1X9WA 1RNHA 4DUZK 2RN2A 5AQQA 2A41A 4IFYA 3L3VA 1ZBIA 1DTTA 4YOTA 5KRSA 1VSDA 4BC2A 3JAMO 1DLOA 4DF4A 1TAUA 1S72N 3DRSA 2FSKA 2JWKA 2XY7A 1GOAA 4OVLA 3AO1A 1RT2A 3I3WA 4ILHA 2ZGZA 3B6PA 1S3XA 4GKKK 4H0TB 3C7NB 3O1BA 4EJYA 3AVCA 4FVMA 2X6NA 1KYFA 1JL2A 1N34K 2E6LA 2Y8LA 4PKHA 3M1FA 2E1YA 2YV0X 2YHWA 1TYQA 4CJ4A 4KH6A 1YHQN 4Z4EA 1HPZA 2IS3A 1G99A 1N5YA 4A5AA 2X6SA 3KTUA 3IDHA 3DOLA 5J2NA 1Y97A 1VRUA 2D1KA 3H1VX 4H4MA 4JV5K 1NLVA 1HQUA 2ETJA 1QZ6A 2GUIA 3PSIA 4FJGA 3J81O 2JWLA 5T7BA 5IYBP 2R7YA 3BZKA 3O4QA 4EP4A 2NZTA 2DKAA 4O55A 3EZWA 3AVAA 3E66A 3E1YA 3OJUA 1K6YA 1VOKA 4F3TA 1OKJA 2QWOA 1BIZA 3O4NA 3S41A 1L3SA 1QN5A 1BQMA 3CCLN 4BRGA 4CGHA 1U48A 4F8RA 4FWKA 3TABA 3R8EA 1TVRA 3ZEUA 4BR2A 4PWDA 1W0HA 1Y64A 1E4FT 4HTLA 4DR1K 1HU0A 5HRSA 1L3TA 4OKJA 3TSPA 3CMEN 1EKEA 1Q18A 3U3GA 3OC3C 3TAQA 2YKNA 2MZ8A 4FLTA 3OW2M 4KI4A 3T1HK 5IYCP 5AFUH 4JI7K 5JS1A 5JMVA 2CGJA 5BPMA 3T1AA 2B4JA 4OPHA 4NB4A 4CEAA 1VQON 4CJKA 1C0FA 1YQLA 4OKKA 3ULEA 3P31A 4B3MK 1IKWA 4H0YB 2ZE2A 4IWVA 3CC7N 3QEPA 2IVNA 4LF4K 3ENHA 2GWKA 3LP3A 3QEIA 1SUQA 3K0SA 2RKIA 4AHUA 3ENOC 4JKEA 4RW8A 4JI3K 1ASVA 3PO5A 4GVEA 3AA5X 1VSKA 5AZJB 3CG7A 3AVGA 1VHXA 5I9EB 1YXQA 4NYNA 1SKRA 3CPWM 3OA9A 1QTMA 3DLEA 4DULA 5K14A 5EOYA 4IG0A 1NK5A 2HVHA 2G8KA 1CZBA 1VSJA 1SL0A 4LH4A 2G8HA 3HYFA 3SV4A 3HPGA 3KWGA 3VQ7A 5LMNK 1NK0A 2VGNA 2A6AA 2P5OA 5AQIA 5J1EA 3IH7A 2QA4N 2VWJA 1YQKA 3DLBA 4LD0A 1M90O 1IV0A 3CQ8A 3HT3A 1QSLA 3E9LA 4I6MA 1UAXA 4BC5A 4CZEA 4JI2K 5M1NA 3PMGA 4IEIA 4GMJB 4KTQA 3D2FB 5GAEP 4NO7A 2OOYA 1ASWA 5DK5A 5IYDP 2YHAA 5HSHA 3CWAA 4JN4A 4FJNA 3SYZA 3AAPA 4DSJA 1LOTB 4EAKA 1BCOA 4M7XA 3DPTA 4CZKA 1OH5A 2D5RA 3ZSOA 3KK3A 3I33A 2V7ZA 1N36K 2Q1NA 1UT7A 4DFPA 1V4TA 3T19A 4CZLA 1SKWA 2WOMA 3A5OC 3AVFA 3R1XA 4JI6K 1JLQA 2DTUA 2EHGA 4CZGA 1A5XA 4LH5A 5LL6Z 5FLXO 5BRHA 4FJ8A 1YIJN 4I7FA 2GWJA 4W5OA 1HYSA 1RDAA 3TTFA 1CDWA 3OH9A 3HZ6A 4BWJA 4B8AB 3SZ2A 2OTJN 1WBDA 1WN7A 1S9EA 1JLAA 1UA0A 4ILJA 3ZSRA 3KWIA 4B8CA 3RR7A 5DM7L 1TV6A 3LAMA 2B5JA 4X64K 3TSQA 1OVYA 3QEVA 3BKQX 4DTUA 3QO9A 5J2QA 3R3LA 4CJ7A 4KHSA 4DSFA 3CFRA 4CESA 2BANA 1S5JA 2YCHA 3R9PA 5TKWA 1GLFO 1WSHA 3AA4A 4KB0A 3AO5A 2XY5A 5F9CA 2NRVA 4IDKA 4WE1A 4YOVA 3RMBA 4BROA 2F4VK 4DMNA 2D0CA 5F1XA 2G8VA 4CJSA 3NMUA 3D2EB 3ZSXA 3I0XA 5E26A 3VQQA 5HL7L 5TKYA 1QQCA 2FBYA 4LF8K 4K42A 2NRZA 1HNZK 3OS0A 4IOCL 4QS9A 5CYMA 4KTZA 1REVA 2HF4A 1QVFM 1QHAA 1RTIA 4DR2K 3J8AA 2O3OA 3BP8A 3SUNA 3CETA 4CFCA 2WTUA 4IKFA 3SAGA 4BREA 2W42A 1RBUA 1WLJA 3OBYA 3UB5A 3RPJA 1YJWN 3WXIA 4EAGA 1PVSA 1JLGA 4GKJK 1XNQK 3ZT0A 2W41A 4EJZA 2OANA 4I9QA 4CW7B 3HL8A 2YNFA 1ATSA 5HRPA 3BGRA 5AJ3K 2Z1GA 2PFUA 4CJWA 3THXA 4M3WA 3K9JA 5GIPA 3F2KA 4DQPA 1YTBA 5ADXA 1XC9A 2Y1IA 1RTJA 2IVPA 5E41A 2HNDA 3WNFA 3H3NO 4UQGA 1DTQA 1MP9A 1BI4B 1QE1A 4XEIA 2O8BA 4FWLA 3ZT1A 3DJCA 4CHOA 4JI1K 3SQ2A 1XMQK 3PSFA 4DFJA 1QQMA 1KVAA 1IBMK 1R0AA 2JHJA 1YAGA 3S3MA 1B92A 3ID6A 4RW7A 3UKUA 3VMFB 3E9PA 1ZXOA 2OOXA 3HSTB 4OGCA 2NRWA 2HSTA 1QN8A 1TUUA 2BUPA 3G71N 3AAQA 3NH0A 1GLBG 3A5LC 4JAXA 3G10A 3V9XA 3RR8A 1EWRA 3FR0A 5KL0A 2UXCK 4KO0A 1T7PA 3I8BA 4EAHD 3CCEN 2AA4A 3RSEA 2OTLN 1WSIA 1DKGD 3CFPA 2G8WA 3O9UA 1M3HA 4YOYA 3D6RA 4YOXA 4Z0UA 2KLAA 3H46O 4DTSA 5HOOA 1IG9A 4X62K 3L2RA 3C04A 4OLBA 1EX4A 5AQFA 4RW4A 1RTHA 1JCFA 4Q0BA 3DPUA 1QSYA 3QLHA 4BGBA 3IRXA 1K8KB 3U6FA 2O8DB 4DUYK 1XC3A 5BREA 4LFCK 1IJJA 1D5AA 3LZIA 3CVSA 1WAFA 3OYLA 1KY6A 4FWSA 4M41A 3SCXA 1WJWA 2HKPA 1EWQA 4FLVA 3CWSA 4XH1A 1KO9A 1MDUB 5EU7A 3WQUA 5BN9A 4FZZA 3QICA 3HOSA 3KKSA 2O8EA 4CEZA 1CLQA 4CE9A 4CGFA 3LANA 4FJ7A 5JN5A 2IC3A 2YX6A 3NH2A 1U47A 4KV8A 4RCHA 4CK2A 4O8KA 4ID1A 4JKBA 1RFQA 4DFKA 5FROA 1C1CA 1N32K 3AY9A 2NOLA 3HPOA 1VQ6N 4BRDA 1RBVA 3FE1A 1RDCA 2KFZA 3OS2A 4BQZA 3VF6A 3I56N 3H08A 1Z25A 4QCLA 4A61A 4M3UA 3TI0A 1U49A 3ZSZA 2CH5A 4CIEA 3Q7CA 2Q2RA 3D7QA 1EQYA 3S3OA 1NU0A 2O8FB 1FN7A 3T4NA 2FSNA 1YJNN 4FLYA 2HBJA 2A40A 2LSNA 4G9ZA 1K73O 4FOIA 3O9QA 4H0VB 3CCVN 2HOEA 5AQPA 5JVHL 3LL3A 1BIUA 1RTDA 5C12A 2DY4A 4C1NK 2ZF5O 4AILC 3CQYA 1XMOK 1KVCA 5BRFA 4JLHA 1QQNA 2KZMA 4FM0A 5M1KA 1L3VA 4CZFA 4HVJA 5LJVA 3AARA 4WF9L 1Q7YO 2CGKA 1VSIA 4FJXA 2Q3SA 4IZ9A 4JKGA 4C8NA
chains in the Genus database with same CATH topology
2BGGA 1QN3A 4FM1A 3MEDA 1GOAA 3RRHA 4CK3A 2XY7A 4OVLA 3AO1A 4E1NA 4DSLA 4PQUA 4CFBA 1YQMA 2VWKA 2RF2A 1NKCA 1HNIA 3VQPA 3DLRA 1RT2A 4KB1A 4I2QA 3B6PA 4EZ6A 3H1ZA 4Z4FA 1NH2A 3THVA 4KI6A 3O3GA 1EP4A 1KFSA 1U4BA 4CF0A 4CF9A 4DS5A 1QNCA 4EJYA 2JLEA 3AVNA 3AVCA 4FVMA 1J53A 4CEDA 3LPUA 4CJFA 2X6NA 3OJSA 3HK2A 2KFNA 1KYFA 1JL2A 4DFMA 2E6LA 4W5QA 1TK0A 3ZSQA 4F4KA 4CJVA 4DQRA 5HROA 1RILA 4DTRA 1S6PA 1LV5A 2YV0X 2NUBA 3AVIA 4FLWA 4KAZA 4CJ4A 2HHSA 1SKSA 2XO7A 1YT3A 3QEWA 4NYFA 1HPZA 2XHIA 2B6AA 2IS3A 1NK6A 3V1QA 4Z4EA 1AISA 1N5YA 3OYAA 2X6SA 3KTUA 4CEOA 3SUPA 3AO3A 2OA8A 4FJMA 3DOLA 5J2NA 1TBAB 1ZBLA 1GOBA 1VRUA 1Y97A 4H4MA 4MQ3A 1L5UA 4FK2A 2HHWA 2OPPA 1NK4A 2VG6A 1CZ9A 5FDLA 1HQUA 2ETJA 2GUIA 4BDYA 1HYZA 4FJGA 1XHZA 4FXDA 4CGDA 4HCCA 5T7BA 5IYBP 2R7YA 1QTPA 3KJVA 3O4QA 4OLAA 4EP4A 1VTLE 1S1UA 1ZBUA 4O55A 2DFEA 1WSGA 2FBVA 4IFVA 1TGOA 1VSMA 3AVAA 3NGIA 3KLGA 1NKBA 5SWMA 3OJUA 1K6YA 1VOKA 1VSEA 1BL3A 1IO2A 3P5JA 4F3TA 3V1RA 1E42A 3PX4A 1NKEA 1BIZA 3MECA 3O4NA 1L3SA 1HMVA 1QN5A 3DLHA 4BDPA 1YVUA 3TAGA 1BISA 2OZSA 4M3YA 1BQMA 3QIOA 2HHVA 1JLFA 4CGHA 1FK9A 1VSFA 4CJLA 3OYKA 1U48A 4F8RA 3TABA 3V4IA 1TVRA 4E3SA 4PWDA 3NHGA 1W0HA 3TR8A 3OSMA 4NCBA 4CF1A 1NJWA 4CJUA 3NBPA 5KTQA 3MAQA 3KLFA 3V81A 2OYQA 1HU0A 4CEQA 5HRSA 3RTVA 1L3TA 3HS9A 1VRTA 4OKJA 1CXUA 1X1PA 4CFDA 1EKEA 3V9UA 3HM9A 4E7HA 4QAGA 3U3GA 1W9HA 5J2MA 1D9FA 3OC3C 3TAQA 5AN4A 1RM1A 1EXQA 2YKNA 2MZ8A 3ZSWA 4JS4A 3WNEA 4ZHRA 4FLTA 4KI4A 5IYCP 5JS1A 3OYIA 4FYDA 5CZ1A 2P1JA 4FJKA 3VQ4A 4W5TA 3OY9A 3T1AA 2B4JA 4CERA 4OKEA 3AVLA 2NOZA 1IH7A 4CEAA 4E89A 3K5LA 4HHTA 4FJHA 2NOEA 1LWYA 4CJKA 2WONA 3LZJA 3QESA 1NJYA 3AA3A 3M8PA 1RT4A 2GBZA 1YQLA 3AA2A 3OYBA 3SJJA 3ZT3A 3TAEA 3TAPA 4OKKA 2ATQA 2HHTA 4HUFA 4F3OA 1IKWA 4M3TA 1D9DA 2ZE2A 4HTUA 4CHZA 3QEPA 1NVPA 3HVRA 1C9BB 3T3FA 1RDBA 3OYNA 3LP3A 1RCHA 4FW2A 4E7JA 3QEIA 2HMIA 1SUQA 3CFOA 4HCBA 2RKIA 1LW2A 4AHUA 4E19A 1B9DA 1B9FA 1BI4A 4RW8A 1R4XA 4G1QA 4OPJA 1ASVA 1RBSA 2G8UA 3PO5A 1FKPA 3AA5X 1VSKA 3ISNC 5HBMA 3CG7A 3L2WA 3AVGA 5JS2A 2EX3A 2ZD1A 4DU4A 4CCHA 1O1WA 3AVHA 1SL1A 3KIOA 4NYNA 3VQAA 4E0DA 2DTUA 1ITGA 3ULXA 1SKRA 4DG1A 5C42A 1QTMA 1KFDA 4DULA 3DLEA 5K14A 4IG0A 1NK5A 4FK0A 3HO1A 2HVHA 2G8KA 1CZBA 1VSJA 4O0IA 4CJ5A 1X9MA 4JS5A 1SL0A 4ELTA 4LH4A 3OYGA 4DTXA 3AV9A 3MXMA 3VQDA 4CJRA 2G8HA 1QNAA 2P51A 3AO4A 1N3AA 4B9LA 2KTQA 5HRNA 4C8MA 4DU3A 3HYFA 2Z1HA 3HPGA 3SV4A 3LAKA 3VQ7A 3D0PA 1BHLA 1NK0A 4N47A 2P5OA 5J1EA 3IH7A 4AHRA 4LY7A 2VWJA 1YQKA 4O0JA 2VJ0A 1SV5A 3PX6A 4B9MA 3DLBA 1TBPA 2PYLA 4LD0A 3VQBA 1LAWA 4AHCA 3CQ8A 3HT3A 4R5PA 1QSLA 3PY8A 4DLGA 1U45A 1UAXA 4O5BA 1KTQA 1TKTA 2DFFA 3A2FA 3CM6A 3NGYA 4CEEA 2DFHA 5CZ2A 4Z4HA 2Z1IA 3KK1A 1ZBHA 4F2RA 4Q11A 4K8ZA 2P5GA 3QEXA 4C8LA 1A5VA 3UIQA 4GMJB 1IKVA 3KLIA 5C24A 4CGGA 4AHTA 3RMDA 3RWUA 4KTQA 1MU2A 1TL1A 3ZT4A 3TANA 1ASWA 4KKOA 5DK5A 5I42A 1Z26A 3OYFA 3VQ5A 5IYDP 3DYAA 2IV9A 1TL3A 3EYZA 2YHAA 1J5OA 3OYJA 3SUOA 1QSSA 3VA3A 3SI6A 4FJNA 1KVBA 3SYZA 1YTUA 4DSJA 1PZDA 4B08A 1PCZA 1BCOA 3DPTA 2E6MA 2HHXA 2HB5A 2D5RA 3ZSOA 3KK3A 2VG5A 2YHBA 1UT7A 2OPQA 4DFPA 3LP0A 5SZTA 1JL1A 3T19A 3O3HA 1SKWA 2WOMA 4PUOA 3AVFA 4OPKA 1UWBA 1JLQA 1YTFA 3VN5A 2EHGA 4DTJA 2F96A 1A5XA 4LH5A 3QERA 3DLGA 3SNNA 4FJ8A 1HRHA 1CXQA 4DLEA 1LW0A 2YH5A 4I7FA 3ZSYA 3NCIA 4W5OA 4B9VA 1HYSA 1RDAA 4IBNA 2NOHA 1CDWA 1U04A 3I0WA 1JLCA 3C6TA 4FJIA 3PUFA 3D45A 2IAJA 1N3CA 1HYVA 1S1TA 4BWJA 1W80A 4B8AB 3SZ2A 4DTMA 4DWIA 4L8RB 1WN7A 1S9EA 1JLAA 1UA0A 3ZSRA 4B8CA 3RR7A 4KPYA 4M3XA 2BDPA 1QN7A 1ZYQA 4E7IA 1QN4A 1TV6A 3LAMA 2B5JA 2HNZA 3QEVA 3DM2A 1LWVA 3MXJA 1LWEA 3LALA 4CF2A 4DTUA 3QO9A 4IG3A 5J2QA 4KHSA 4DSFA 4I2PA 3CFRA 2YNGA 1S6QA 4CESA 4M42A 2BANA 1S5JA 1BGXT 1WSHA 3SUQA 2NOBA 3OVNA 1LWWA 3AA4A 3EY1A 4CGJA 3RRGA 3LDSA 4KB0A 2QKKA 1IKXA 3AO5A 2XY5A 3ITHA 3O3FA 3PX0A 2HW3A 4CJPA 2G8IA 4FLZA 2NOFA 4IDKA 2I5WA 4WE1A 4FK4A 3RMBA 3NF7A 1C0TA 4C8KA 4DMNA 4BE0A 4KHWA 2D0CA 1UA1A 2G8VA 4CJSA 3V9SA 3AVMA 3K57A 1RT7A 1KLNA 3ZSXA 3I0XA 4JRPA 3OYEA 3LWLA 3DLKA 3VQQA 2X78A 2XY8A 4DSIA 4H8KA 3EZ5A 1N6QA 4TSXA 1QQCA 2FBYA 1JXEA 1UT4A 2OPSA 3K5MA 1J54A 3AVBA 1Q8IA 3AVKA 4Y1DA 4GW6A 1A5WA 2AJQA 1TK5A 1RT6A 2ITGA 3OS0A 1YQRA 4CHPA 5CYMA 2FBXA 4CJQA 4E7LA 2E4LA 1REVA 4KTZA 3DRPA 1T05A 1RTIA 3VQEA 4YNQA 3AO2A 3L2VA 2O3OA 3HVTA 2HVIA 3S9HA 3LPTA 3SUNA 1ASUA 4CFCA 4B9SA 4M3ZA 3MEGA 1QN6A 4IKFA 3NE6A 2W42A 2I5JA 1RBUA 4CHQA 1JKHA 1WLJA 3NGZA 1J9AA 4FW1A 3RPJA 3NFAA 2JOIA 1SL2A 4RODB 3F73A 2FC0A 1NGMA 1JLGA 4CIFA 1WSFA 1YTAA 4CGIA 3ZT0A 5KRTA 3V1OA 4EJZA 2FBTA 4I9QA 2A1RA 4K8XA 2VG7A 3MEEA 1M3QA 1C1AA 3HL8A 1XWLA 2YNFA 1RT5A 3KTQA 5HRPA 4ZTFA 3OCIA 3BGRA 4I9LA 2Z1GA 3I0SA 3C6UA 4PA1A 4CJWA 1IKYA 3QINA 3BDPA 4M3WA 1XI1A 3K2PA 2YNHA 5CY4A 1S1WA 1KY7A 5KI6A 2PY5A 4DQPA 1D8YA 3KD1E 1YTBA 1XC9A 5FRNA 2Y1IA 1RTJA 3E01A 5E41A 1Q9XA 3C95A 2HNDA 4EZ9A 3NF9A 3WNGA 3DOKA 4CJEA 4E7KA 1RDDA 3WNFA 1JLEA 3TAMA 5KGWA 4UQGA 3TARA 2D0AA 3HS8A 1DTQA 1NK8A 2PZSA 1LAVA 4QOZB 4FJLA 1T03A 1MP9A 1BI4B 1QE1A 4ID5A 4M45A 3I8DA 4DTNA 1NJXA 1S1VA 3QNNA 4F2SA 3ZT1A 4B9UA 4J2EA 1QTSA 1Q9YA 4CECA 1JXBA 4LSLA 4CHOA 4JRQA 2GV9A 4RW9A 1N39A 3NH1A 5HLFA 1NOZA 1BCMA 1QHTA 5DMRA 4Q5VA 4N41A 3SQ2A 3SPYA 1TKDA 1L3UA 3HP6A 1HJRA 4DFJA 1KSPA 1KVAA 3NAEA 3EIKA 1R0AA 3LP1A 2FGTA 3OYDA 3AVJA 3PO4A 2JGUA 3S3MA 4DU1A 3M8RA 3FFIA 3NDKA 2ZQBA 3HXMA 3I0RA 3OYMA 1LWCA 4Y1CA 4W5RA 4GVMA 4ICLA 1TGHA 1B92A 1LWFA 2RPIA 3K5OA 3IG1A 4RW7A 3V6DA 2QK9A 3C94A 3NF8A 1XHXA 4FLXA 3HSTB 2HZMA 2OZMA 4OGCA 1VOLB 1B9KA 4FLUA 1QN8A 4MFBA 4EP5A 3P83D 4HUGA 3ZSVA 3RMCA 3NH0A 3VQCA 1TK8A 1T8EA 3VQ8A 3G10A 1EBMA 3LWMA 3U3YA 1S9GA 2D0BA 1JLBA 3JYTA 3V9XA 3TAFA 3MXIA 3M8SA 3RR8A 1EETA 3DI6A 4KHNA 4OGEA 4DF8A 3K5NA 4CHYA 1ZBIA 2NOIA 1C0UA 4KO0A 3N89A 4N76A 2QKBA 4YFUA 2XY6A 1T7PA 4J2BA 4BE2A 2LAEA 4DQSA 2QXFA 2O4IA 1WSIA 4CEBA 3CFPA 3G0ZA 2G8WA 3SV3A 3RMAA 3F10A 4FJ9A 4KRFA 4BWMA 4FZYA 4B9TA 4E1MA 1F21A 4B3OA 1M3HA 3OYHA 3L2UA 3V9WA 4KHUA 4BDZA 3SQ4A 4Z0UA 4DTSA 5CYQA 1C1BA 1IG9A 2F8SA 3DMJA 1RT1A 4H4OA 4B0AA 3L2RA 3SNSA 1C0MA 5I3UA 4OLBA 2IV8A 1EX4A 3JSMA 4FM2A 4RW4A 4ROEB 2MJ7A 1FKOA 1RTHA 2IGIA 4CJTA 4I8OA 4KHYA 4Q0BA 3KK2A 3DPUA 1QSYA 2G8FA 3LP2A 4LSNA 1RBRA 2IDOA 1WNSA 3CYMA 3IRXA 3QIPA 4TPSA 3QLHA 3WNHA 5D3GA 3F9KA 4CK1A 3U6FA 2Y1JA 4FJ5A 5J2PA 4DS4A 3HPHA 4AHVA 4KTWA 4RW6A 1D5AA 1I3AA 4DTPA 1KRPA 2HHUA 4AH9A 3LZIA 2XRIA 3DRRA 3OS1A 3F0ZA 2HNYA 2XHBA 1WAFA 1I39A 3OYLA 3L2QA 3K58A 1KY6A 1WSJA 4M41A 3ALYA 3SCXA 4KHQA 1TAQA 2Z8UA 1VK0A 2F8TA 4DQIA 2HHQA 5HRRA 1X9SA 3OSTA 4AHSA 4RG8A 4FLVA 1TKXA 1KO9A 4BE1A 5EU7A 4FZZA 1QS4A 3CM5A 1VSHA 3KRMA 2YNIA 3KKSA 1QNBA 4CEZA 4BACA 4CE9A 4ELUA 4CGFA 1CLQA 3LANA 4FJ7A 1HNVA 1QNEA 2IC3A 3HP9A 3NH2A 4DTOA 1U47A 2KW4A 3VA0A 3ZCMA 3IAYA 4KV8A 2BE2A 1G15A 3B6OA 4CK2A 3SQ0A 4C8OA 4NCAA 4ID1A 4KFBA 4FCYA 4ELVA 5C25A 4FJJA 4CEFA 5FROA 4DSEA 4DFKA 3ASMA 1HQEA 4CHNA 1C1CA 1WAJA 1UOCA 4O4GA 1FXXA 2NOLA 3SQ1A 1KLMA 3HPOA 2KZMA 4W5NA 1RBVA 1RBTA 4NCGA 1RDCA 2KFZA 3OS2A 4M3RA 1WSEA 3H08A 3SPZA 1Z25A 1NOYA 4FZXC 3KKRA 3L3UA 2A1SA 4Z4GA 3KLEA 4QCLA 1GOCA 4M3UA 3L8BA 4DSKA 1C6VA 3TI0A 1U49A 4ROCB 4O44A 3ZSZA 4CIEA 2PYJA 2KZZA 4CJ3A 1D3UA 3VQ6A 1S1XA 1JFIC 1QN9A 4DQQA 2IOCA 1KYDA 1KYUA 3S3OA 4J2AA 2HZSA 3S3NA 4Z4IA 3V9ZA 1FN7A 2G30A 4B9NA 4FLYA 3HJFA 3TWHA 4PY5A 3IS9A 4N5SA 4Z4CA 2KQ2A 2LSNA 1TKZA 4KREA 2OPRA 3VQ9A 4CF8A 1BQNA 2X74A 3K59A 4N56A 3P1GA 3ZT2A 2YKMA 1ZBFA 2O4GA 4ZTJA 4WZSD 3QETA 1X9WA 3KD5E 3M8QA 5KGXA 4HUEA 1RNHA 1BIUA 4OJRA 1NJZA 1NK7A 4XIUA 3KLHA 1RTDA 2DY4A 2RN2A 1KCFA 4IFYA 4AILC 3PV8A 1NK9A 1KVCA 1RT3A 3L3VA 4JLHA 3QNOA 1DTTA 4FM0A 5KRSA 4CIGA 1VSDA 1L3VA 5FRMA 4CFAA 4HVJA 1DLOA 4DF4A 5HP1A 1VSLA 1TAUA 4J2DA 3OYCA 1VTOA 1VSIA 3ULDA 2Q3SA 4FJXA 2Z1JA 3NF6A 4C8NA 3DRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGG A;  1QN3 A;  4FM1 A;  3MED A;  1GOA A;  3RRH A;  4CK3 A;  2XY7 A;  4OVL A;  3AO1 A;  4E1N A;  4DSL A;  4PQU A;  4CFB A;  2VWK A;  2RF2 A;  1NKC A;  1HNI A;  3VQP A;  3DLR A;  1RT2 A;  4KB1 A;  4I2Q A;  3B6P A;  4EZ6 A;  3H1Z A;  4Z4F A;  1NH2 A;  3THV A;  4KI6 A;  3O3G A;  1EP4 A;  1KFS A;  1U4B A;  4CF0 A;  4CF9 A;  4DS5 A;  1QNC A;  4CED A;  2JLE A;  3AVN A;  3AVC A;  4FVM A;  1J53 A;  4CJF A;  3LPU A;  3OJS A;  2X6N A;  3NE6 A;  3HK2 A;  2KFN A;  1KYF A;  1JL2 A;  4DFM A;  2E6L A;  4W5Q A;  1TK0 A;  3ZSQ A;  4F4K A;  4CJV A;  4DQR A;  5HRO A;  1RIL A;  4DTR A;  1S6P A;  1LV5 A;  2YV0 X;  2NUB A;  3AVI A;  4FLW A;  4KAZ A;  4CJ4 A;  2HHS A;  1SKS A;  2XO7 A;  1YT3 A;  3QEW A;  4NYF A;  1HPZ A;  2B6A A;  2IS3 A;  1NK6 A;  4Z4E A;  3V1Q A;  1AIS A;  1N5Y A;  3OYA A;  2X6S A;  4CEO A;  3SUP A;  4FJM A;  3AO3 A;  2OA8 A;  3DOL A;  5J2N A;  1TBA B;  1ZBL A;  1GOB A;  1VRU A;  1Y97 A;  4H4M A;  4MQ3 A;  1L5U A;  4FK2 A;  2HHW A;  2OPP A;  1NK4 A;  2VG6 A;  1CZ9 A;  5FDL A;  1HQU A;  2ETJ A;  2GUI A;  4BDY A;  1HYZ A;  4FJG A;  1XHZ A;  4FXD A;  4CGD A;  4HCC A;  5T7B A;  5IYB P;  2R7Y A;  1QTP A;  3KJV A;  3O4Q A;  4OLA A;  4EP4 A;  1VTL E;  1S1U A;  1ZBU A;  4O55 A;  2DFE A;  1WSG A;  2FBV A;  4IFV A;  1TGO A;  1VSM A;  3AVA A;  3NGI A;  3KLG A;  1NKB A;  5SWM A;  3OJU A;  1K6Y A;  1VOK A;  1VSE A;  1BL3 A;  1IO2 A;  3P5J A;  4F3T A;  3V1R A;  1E42 A;  3PX4 A;  1NKE A;  1BIZ A;  3MEC A;  3O4N A;  1L3S A;  1HMV A;  1QN5 A;  3DLH A;  4BDP A;  1YVU A;  3TAG A;  1BIS A;  2OZS A;  4M3Y A;  1BQM A;  3QIO A;  2HHV A;  1JLF A;  4CGH A;  1FK9 A;  1VSF A;  4CJL A;  3OYK A;  1U48 A;  4F8R A;  3TAB A;  3V4I A;  1TVR A;  4E3S A;  4PWD A;  3NHG A;  1W0H A;  3TR8 A;  4NCB A;  4CF1 A;  1NJW A;  4CJU A;  3NBP A;  5KTQ A;  3MAQ A;  3KLF A;  3V81 A;  2OYQ A;  4CEQ A;  5HRS A;  1L3T A;  3RTV A;  3HS9 A;  1VRT A;  4OKJ A;  1CXU A;  1X1P A;  4CFD A;  1EKE A;  3V9U A;  3HM9 A;  4E7H A;  4QAG A;  3U3G A;  1W9H A;  5J2M A;  1D9F A;  3OC3 C;  3TAQ A;  1RM1 A;  1EXQ A;  2YKN A;  3ZSW A;  4JS4 A;  3WNE A;  4ZHR A;  4FLT A;  4KI4 A;  5IYC P;  5JS1 A;  3OYI A;  4FYD A;  5CZ1 A;  2P1J A;  4FJK A;  3VQ4 A;  4W5T A;  3OY9 A;  3T1A A;  2B4J A;  4CER A;  4OKE A;  3AVL A;  1IH7 A;  4CEA A;  4E89 A;  3K5L A;  4HHT A;  4FJH A;  4CJK A;  2WON A;  3LZJ A;  3QES A;  1NJY A;  3AA3 A;  3M8P A;  1RT4 A;  2GBZ A;  3AA2 A;  3OYB A;  3SJJ A;  3ZT3 A;  3TAE A;  3TAP A;  4OKK A;  2ATQ A;  2HHT A;  4HUF A;  4F3O A;  1IKW A;  4M3T A;  1D9D A;  2ZE2 A;  4HTU A;  4CHZ A;  3QEP A;  1NVP A;  3HVR A;  1C9B B;  3T3F A;  1RDB A;  3OYN A;  3LP3 A;  1RCH A;  4FW2 A;  4E7J A;  3QEI A;  2HMI A;  1SUQ A;  3CFO A;  4HCB A;  2RKI A;  1LW2 A;  4AHU A;  4E19 A;  1B9D A;  1B9F A;  1BI4 A;  4RW8 A;  1R4X A;  4G1Q A;  4OPJ A;  1ASV A;  1RBS A;  2G8U A;  3PO5 A;  1FKP A;  3AA5 X;  1VSK A;  3ISN C;  5HBM A;  3CG7 A;  3L2W A;  3AVG A;  5JS2 A;  2EX3 A;  2ZD1 A;  4DU4 A;  4CCH A;  1O1W A;  3AVH A;  1SL1 A;  3KIO A;  4NYN A;  3VQA A;  4E0D A;  2DTU A;  1ITG A;  1SKR A;  4DG1 A;  5C42 A;  1QTM A;  1KFD A;  3DLE A;  5K14 A;  4IG0 A;  1NK5 A;  4FK0 A;  3HO1 A;  2HVH A;  2G8K A;  1CZB A;  1VSJ A;  4O0I A;  4CJ5 A;  1X9M A;  4JS5 A;  1SL0 A;  4ELT A;  4LH4 A;  3OYG A;  4DTX A;  3AV9 A;  3MXM A;  3VQD A;  4CJR A;  2G8H A;  1QNA A;  2P51 A;  3AO4 A;  4B9L A;  2KTQ A;  5HRN A;  4C8M A;  4DU3 A;  3HYF A;  2Z1H A;  3HPG A;  3SV4 A;  3LAK A;  3VQ7 A;  3D0P A;  1BHL A;  1NK0 A;  4N47 A;  2P5O A;  5J1E A;  4AHR A;  4LY7 A;  2VWJ A;  4O0J A;  2VJ0 A;  1SV5 A;  3PX6 A;  4B9M A;  3DLB A;  1TBP A;  2PYL A;  4LD0 A;  3VQB A;  1LAW A;  4AHC A;  3CQ8 A;  3HT3 A;  4R5P A;  1QSL A;  3PY8 A;  4DLG A;  1U45 A;  1UAX A;  4O5B A;  1KTQ A;  1TKT A;  2DFF A;  3A2F A;  3CM6 A;  3NGY A;  4CEE A;  2DFH A;  5CZ2 A;  4Z4H A;  2Z1I A;  3KK1 A;  1ZBH A;  4F2R A;  4K8Z A;  2P5G A;  3QEX A;  4C8L A;  1A5V A;  3UIQ A;  4GMJ B;  1IKV A;  3KLI A;  5C24 A;  4CGG A;  4AHT A;  3RMD A;  3RWU A;  4KTQ A;  1MU2 A;  1TL1 A;  3ZT4 A;  3TAN A;  1ASW A;  4KKO A;  5DK5 A;  5I42 A;  1Z26 A;  3OYF A;  3VQ5 A;  5IYD P;  3DYA A;  2IV9 A;  1TL3 A;  3EYZ A;  2YHA A;  1J5O A;  3OYJ A;  3SUO A;  1QSS A;  3VA3 A;  3SI6 A;  4FJN A;  1KVB A;  3SYZ A;  1YTU A;  4DSJ A;  1PZD A;  4B08 A;  1PCZ A;  1BCO A;  2HHX A;  2E6M A;  2HB5 A;  2D5R A;  3ZSO A;  3KK3 A;  2VG5 A;  2YHB A;  2OPQ A;  4DFP A;  3LP0 A;  5SZT A;  1JL1 A;  3T19 A;  3O3H A;  1SKW A;  2WOM A;  4PUO A;  3AVF A;  4OPK A;  1UWB A;  1JLQ A;  1YTF A;  3VN5 A;  2EHG A;  4DTJ A;  2F96 A;  1A5X A;  4LH5 A;  3QER A;  3DLG A;  3SNN A;  4FJ8 A;  1HRH A;  1CXQ A;  4DLE A;  1LW0 A;  4I7F A;  3ZSY A;  3NCI A;  4W5O A;  4B9V A;  1HYS A;  1RDA A;  4IBN A;  1CDW A;  1U04 A;  1JLC A;  3C6T A;  4FJI A;  3PUF A;  3D45 A;  2IAJ A;  1HYV A;  1S1T A;  4BWJ A;  1W80 A;  4B8A B;  3SZ2 A;  4DTM A;  4DWI A;  4L8R B;  1WN7 A;  1S9E A;  1JLA A;  1UA0 A;  3ZSR A;  4B8C A;  3RR7 A;  4KPY A;  4M3X A;  2BDP A;  1QN7 A;  1ZYQ A;  4E7I A;  1QN4 A;  1TV6 A;  3LAM A;  2B5J A;  2HNZ A;  3QEV A;  3DM2 A;  3MXJ A;  4CF2 A;  1LWE A;  3LAL A;  4DTU A;  3QO9 A;  4IG3 A;  5J2Q A;  4KHS A;  4DSF A;  4I2P A;  3CFR A;  2YNG A;  1S6Q A;  4CES A;  4M42 A;  2BAN A;  1S5J A;  1BGX T;  1WSH A;  3SUQ A;  3OVN A;  3AA4 A;  3EY1 A;  4CGJ A;  3RRG A;  3LDS A;  4KB0 A;  2QKK A;  1IKX A;  3AO5 A;  2XY5 A;  3ITH A;  3O3F A;  3PX0 A;  2HW3 A;  4CJP A;  2G8I A;  4FLZ A;  4IDK A;  4WE1 A;  4FK4 A;  3RMB A;  3NF7 A;  1C0T A;  4C8K A;  4DMN A;  4BE0 A;  4KHW A;  2D0C A;  1UA1 A;  2G8V A;  4CJS A;  3V9S A;  3AVM A;  3K57 A;  1RT7 A;  1KLN A;  3ZSX A;  4JRP A;  3OYE A;  3LWL A;  3DLK A;  3VQQ A;  2X78 A;  2XY8 A;  4DSI A;  4H8K A;  3EZ5 A;  1N6Q A;  4TSX A;  1QQC A;  2FBY A;  1JXE A;  2OPS A;  3K5M A;  1J54 A;  3AVB A;  1Q8I A;  3AVK A;  4Y1D A;  4GW6 A;  1A5W A;  2AJQ A;  1TK5 A;  1RT6 A;  2ITG A;  3OS0 A;  4CHP A;  5CYM A;  2FBX A;  4CJQ A;  4E7L A;  2E4L A;  1REV A;  4KTZ A;  3DRP A;  1T05 A;  1RTI A;  3VQE A;  4YNQ A;  3AO2 A;  3L2V A;  3HVT A;  2HVI A;  3S9H A;  3LPT A;  3SUN A;  1ASU A;  4CFC A;  4B9S A;  4M3Z A;  3MEG A;  1QN6 A;  4IKF A;  2W42 A;  2I5J A;  1RBU A;  4CHQ A;  1JKH A;  1WLJ A;  3NGZ A;  1J9A A;  4FW1 A;  3NFA A;  1SL2 A;  4ROD B;  3F73 A;  2FC0 A;  1NGM A;  1JLG A;  4CIF A;  1WSF A;  1YTA A;  4CGI A;  3ZT0 A;  5KRT A;  3V1O A;  2FBT A;  4I9Q A;  2A1R A;  4K8X A;  2VG7 A;  3MEE A;  1C1A A;  3HL8 A;  1XWL A;  2YNF A;  1RT5 A;  3KTQ A;  5HRP A;  4ZTF A;  3OCI A;  3BGR A;  4I9L A;  2Z1G A;  3I0S A;  3C6U A;  4PA1 A;  4CJW A;  1IKY A;  3QIN A;  3BDP A;  4M3W A;  1XI1 A;  3K2P A;  2YNH A;  5CY4 A;  1S1W A;  1KY7 A;  5KI6 A;  2PY5 A;  4DQP A;  1D8Y A;  3KD1 E;  1YTB A;  1XC9 A;  5FRN A;  2Y1I A;  1RTJ A;  3E01 A;  5E41 A;  1Q9X A;  3C95 A;  2HND A;  4EZ9 A;  3NF9 A;  3WNG A;  3DOK A;  4CJE A;  4E7K A;  1RDD A;  3WNF A;  1JLE A;  3TAM A;  5KGW A;  4UQG A;  3TAR A;  2D0A A;  3HS8 A;  1DTQ A;  1NK8 A;  2PZS A;  1LAV A;  4QOZ B;  4FJL A;  1T03 A;  1MP9 A;  1BI4 B;  1QE1 A;  4ID5 A;  3I8D A;  4DTN A;  1NJX A;  1S1V A;  3QNN A;  4F2S A;  3ZT1 A;  4B9U A;  4J2E A;  1QTS A;  1Q9Y A;  4CEC A;  1JXB A;  4LSL A;  4CHO A;  4JRQ A;  2GV9 A;  4RW9 A;  3NH1 A;  5HLF A;  1NOZ A;  1BCM A;  1QHT A;  5DMR A;  4Q5V A;  4N41 A;  3SQ2 A;  3SPY A;  1TKD A;  1L3U A;  3HP6 A;  1HJR A;  4DFJ A;  1KSP A;  1KVA A;  3NAE A;  3EIK A;  1R0A A;  3LP1 A;  3OYD A;  3AVJ A;  3PO4 A;  2JGU A;  3S3M A;  4DU1 A;  3M8R A;  3FFI A;  3NDK A;  2ZQB A;  3HXM A;  3I0R A;  3OYM A;  1LWC A;  4Y1C A;  4W5R A;  4GVM A;  4ICL A;  1TGH A;  1B92 A;  1LWF A;  2RPI A;  3K5O A;  3IG1 A;  4RW7 A;  3V6D A;  2QK9 A;  3C94 A;  3NF8 A;  1XHX A;  4FLX A;  3HST B;  2OZM A;  4OGC A;  1VOL B;  1B9K A;  4FLU A;  1QN8 A;  4MFB A;  4EP5 A;  3P83 D;  4HUG A;  3ZSV A;  3RMC A;  3NH0 A;  3VQC A;  1TK8 A;  1T8E A;  3VQ8 A;  3G10 A;  3LWM A;  3U3Y A;  1S9G A;  2D0B A;  1JLB A;  3JYT A;  3V9X A;  3TAF A;  3MXI A;  3M8S A;  3RR8 A;  1EET A;  3DI6 A;  4KHN A;  4OGE A;  4DF8 A;  3K5N A;  4CHY A;  1ZBI A;  1C0U A;  4KO0 A;  4N76 A;  2QKB A;  4YFU A;  2XY6 A;  1T7P A;  4J2B A;  4BE2 A;  4DQS A;  2QXF A;  2O4I A;  1WSI A;  4CEB A;  3CFP A;  3G0Z A;  2G8W A;  3SV3 A;  3RMA A;  4FJ9 A;  4KRF A;  4BWM A;  4FZY A;  4B9T A;  4E1M A;  1F21 A;  4B3O A;  3OYH A;  3L2U A;  3V9W A;  4KHU A;  4BDZ A;  3SQ4 A;  4Z0U A;  4DTS A;  5CYQ A;  1C1B A;  1IG9 A;  2F8S A;  3DMJ A;  1RT1 A;  4H4O A;  4B0A A;  3L2R A;  1C0M A;  5I3U A;  4OLB A;  2IV8 A;  1EX4 A;  3JSM A;  4FM2 A;  4RW4 A;  4ROE B;  2MJ7 A;  1FKO A;  1RTH A;  2IGI A;  4CJT A;  4KHY A;  4Q0B A;  3KK2 A;  1QSY A;  2G8F A;  3LP2 A;  4LSN A;  1RBR A;  2IDO A;  1WNS A;  3CYM A;  3IRX A;  3QIP A;  3QLH A;  4M45 A;  3WNH A;  5D3G A;  3F9K A;  4CK1 A;  3U6F A;  2Y1J A;  4FJ5 A;  5J2P A;  4DS4 A;  3HPH A;  4AHV A;  4KTW A;  4RW6 A;  1D5A A;  1I3A A;  4DTP A;  1KRP A;  2HHU A;  4AH9 A;  3LZI A;  2XRI A;  3DRR A;  3OS1 A;  2XHB A;  2HNY A;  1WAF A;  1I39 A;  3OYL A;  3L2Q A;  3K58 A;  1KY6 A;  1WSJ A;  4M41 A;  3ALY A;  3SCX A;  4KHQ A;  1TAQ A;  2Z8U A;  1VK0 A;  2F8T A;  4DQI A;  2HHQ A;  5HRR A;  1X9S A;  4AHS A;  4RG8 A;  4FLV A;  1TKX A;  4BE1 A;  5EU7 A;  4FZZ A;  1QS4 A;  3CM5 A;  1VSH A;  3KKS A;  2YNI A;  4CEZ A;  1QNB A;  4BAC A;  4ELU A;  4CE9 A;  1CLQ A;  4CGF A;  3LAN A;  4FJ7 A;  1HNV A;  1QNE A;  2IC3 A;  3HP9 A;  3NH2 A;  4DTO A;  1U47 A;  2KW4 A;  3VA0 A;  3ZCM A;  3IAY A;  4KV8 A;  2BE2 A;  1G15 A;  3B6O A;  4CK2 A;  3SQ0 A;  4C8O A;  4NCA A;  4ID1 A;  4KFB A;  4FCY A;  4ELV A;  5C25 A;  4FJJ A;  4CEF A;  5FRO A;  4DSE A;  4DFK A;  3ASM A;  1HQE A;  4CHN A;  1C1C A;  1WAJ A;  1UOC A;  4O4G A;  1FXX A;  3SQ1 A;  1KLM A;  3HPO A;  2KZM A;  4W5N A;  1RBV A;  1RBT A;  4NCG A;  1RDC A;  2KFZ A;  3OS2 A;  4M3R A;  1WSE A;  3H08 A;  3SPZ A;  1Z25 A;  1NOY A;  4FZX C;  3KKR A;  3L3U A;  2A1S A;  4Z4G A;  3KLE A;  4QCL A;  1GOC A;  4M3U A;  3L8B A;  4DSK A;  1C6V A;  3TI0 A;  1U49 A;  4ROC B;  4O44 A;  3ZSZ A;  4CIE A;  2PYJ A;  2KZZ A;  4CJ3 A;  1D3U A;  3VQ6 A;  1S1X A;  1JFI C;  1QN9 A;  4DQQ A;  2IOC A;  1KYD A;  1KYU A;  3S3O A;  4J2A A;  3S3N A;  4Z4I A;  3V9Z A;  4B9N A;  2G30 A;  4FLY A;  3HJF A;  3TWH A;  4PY5 A;  3IS9 A;  4N5S A;  4Z4C A;  2KQ2 A;  2LSN A;  1TKZ A;  4KRE A;  2OPR A;  3VQ9 A;  4CF8 A;  1BQN A;  2X74 A;  3K59 A;  4N56 A;  3P1G A;  3ZT2 A;  2YKM A;  1ZBF A;  2O4G A;  4ZTJ A;  4WZS D;  3QET A;  1X9W A;  3KD5 E;  3M8Q A;  5KGX A;  4HUE A;  1RNH A;  1BIU A;  4OJR A;  1NJZ A;  1NK7 A;  4XIU A;  3KLH A;  1RTD A;  2DY4 A;  2RN2 A;  1KCF A;  4IFY A;  4AIL C;  3PV8 A;  1NK9 A;  1KVC A;  1RT3 A;  3L3V A;  4JLH A;  3QNO A;  1DTT A;  4FM0 A;  5KRS A;  4CIG A;  1VSD A;  1L3V A;  5FRM A;  4CFA A;  4HVJ A;  1DLO A;  4DF4 A;  5HP1 A;  1VSL A;  1TAU A;  4J2D A;  3OYC A;  1VTO A;  1VSI A;  3ULD A;  2Q3S A;  4FJX A;  2Z1J A;  3NF6 A;  4C8N A;  3DRS A; 
#chains in the Genus database with same CATH topology
 4FM1 A;  4IL8 A;  3PLA A;  3RRH A;  1RGI A;  4E1N A;  4DSL A;  1YQM A;  2RF2 A;  3VQP A;  4I2Q A;  1NH2 A;  5AQH A;  1KFS A;  2JLE A;  3CD6 N;  2I7P A;  4W5Q A;  1TK0 A;  3AGR A;  5AZI B;  3ZSQ A;  4WQ5 A;  5HRO A;  2ZGY A;  1VQ9 N;  1S6P A;  1LV5 A;  4FLW A;  4KAZ A;  1YT3 A;  3QEW A;  4NYF A;  2XHI A;  2B6A A;  3V1Q A;  3O4W A;  5JLF A;  3NA5 A;  1AIS A;  3OYA A;  4CEO A;  1RDU A;  5GAD P;  4FJM A;  2OA8 A;  1GLE G;  1GOB A;  4JKA A;  4MQ3 A;  2OPP A;  4JK7 A;  4K25 A;  4JHD B;  5FDL A;  4DR3 K;  4BDY A;  1QVG M;  1QTP A;  2HL9 A;  3KJV A;  2IVO A;  3BF3 A;  2DFE A;  1HKG A;  4IFV A;  3KLG A;  5SWM A;  1W2B M;  2YI1 A;  4BRP A;  1WB9 A;  2F7L A;  4BDP A;  1YVU A;  5EY4 A;  2FKM X;  1FK9 A;  4H5W A;  3P38 A;  1XSZ A;  2P9S B;  1NBW A;  1S22 A;  5CR4 A;  1VQ8 N;  3TTC A;  3MAQ A;  2OYQ A;  3THY A;  2HMP A;  3RTV A;  4DR4 K;  1CXU A;  4JKC A;  4CFD A;  2P9U B;  4QAG A;  5M1O A;  1W9H A;  5J2M A;  4K0K K;  3H45 C;  4JS4 A;  3WNE A;  4ZHR A;  2GX9 A;  1T6A A;  4CER A;  4IDH A;  3K5L A;  4FJH A;  2WON A;  1XQS C;  3LZJ A;  1Q81 O;  2Z0F A;  2GBZ A;  3OYB A;  2WFB A;  4F3O A;  4M3T A;  1D9D A;  3CCQ N;  4A62 A;  5EPC A;  4JI5 K;  2FUV A;  1C9B B;  4FO0 A;  3T3F A;  4KH5 A;  2HMI A;  4E19 A;  4BGA A;  4OPJ A;  3VES A;  2G8U A;  1RBS A;  4HCC A;  2QW9 A;  4JKF A;  1OH6 A;  2FKF A;  4E0D A;  5C42 A;  1KFD A;  4FK0 A;  3HO1 A;  4O0I A;  1X9M A;  4JD2 A;  4JS5 A;  4ELT A;  3OYG A;  4DTX A;  3WEE B;  5AQN A;  3VQD A;  4BVO A;  4BC3 A;  1QNA A;  2V51 B;  4BQL A;  4C8M A;  4FPB A;  4DV0 K;  3EEQ A;  4YDU A;  3ATU A;  1SQK A;  3A5M C;  4O0J A;  2ZJP L;  3HM8 A;  3CJB A;  1ZBS A;  4R5P A;  3PY8 A;  1KTQ A;  2YJF A;  3TPQ A;  4B3S K;  2DFH A;  5CZ2 A;  2Z1I A;  2NRT A;  4F2R A;  4Q11 A;  1DGK N;  1ILY A;  1T6C A;  1A5V A;  3HRG A;  2P9N A;  1TL1 A;  3HI0 A;  2CH6 A;  5I42 A;  1X3N A;  3W3D A;  2IV9 A;  1TL3 A;  2QWQ A;  1J5O A;  3SUO A;  2NLV A;  2DPN A;  1PZD A;  4B1W B;  5BR8 K;  4BRI A;  3SJH A;  5AFU A;  2VG5 A;  3WXJ A;  2OPQ A;  5JLH A;  3LP0 A;  4BRH A;  3O3H A;  3SAH A;  4PUO A;  4OPK A;  1UWB A;  1FW6 A;  4DTJ A;  2FLO A;  3MMV A;  2ITM A;  4JI0 K;  1LW0 A;  3ZYY X;  2QTD A;  4B9V A;  1PCM X;  5AQS A;  1JLC A;  3C6T A;  3PUF A;  3D45 A;  2IAJ A;  1HYV A;  3MN9 A;  4DWI A;  1NGC A;  3EKU A;  1QN7 A;  3UKR A;  1ZYQ A;  2HNZ A;  2JHN A;  3LAL A;  1ATR A;  4M42 A;  1S6Q A;  1NMD A;  3C6A A;  1TYQ B;  3RSM A;  3OLP A;  3VPZ A;  3H3O B;  1DIZ A;  3ITH A;  3O3F A;  3PX0 A;  4CJP A;  4FPA A;  2G8I A;  2I5W A;  2NVM A;  1FJG K;  2P9P A;  4KHW A;  3BZC A;  4A2A A;  1UA1 A;  3VTI A;  3V9S A;  4PL8 A;  2O8C A;  1KLN A;  3CHW A;  4JRP A;  3LWL A;  3DLK A;  3SBT A;  2XY8 A;  4TSX A;  1JXE A;  3K5M A;  3SBG A;  1Q8I A;  2GUP A;  4NXN K;  3J80 O;  4H0X B;  1T3V A;  2AJQ A;  2ITG A;  1OVQ A;  4EAJ A;  1T05 A;  4FOE A;  3VQE A;  2HVI A;  3HVT A;  3LM2 A;  3FZL A;  3ZEU B;  2E5L K;  3LPT A;  4WQ5 C;  4B9S A;  4M3Z A;  1VQN N;  1QN6 A;  4CHQ A;  1JKH A;  4U7B A;  3NGZ A;  1MWM A;  1J9A A;  4IXC A;  3VEO A;  2JOI A;  1SL2 A;  3TU5 A;  3ZET A;  2W6L A;  1WSF A;  1YTA A;  2Q31 A;  5KRT A;  4K8X A;  3H1Q A;  1XWL A;  1PCJ X;  1U6Z A;  5LMU K;  4ZTF A;  2ASM A;  1GLJ O;  2P9L A;  2QWN A;  4PA1 A;  3T7Z A;  5AQM A;  3BDP A;  3CCU N;  1XI1 A;  4A5B A;  3BUZ B;  1S1W A;  3ULE B;  5KI6 A;  4NXM K;  4O8U A;  3EO3 A;  4BR0 A;  4K43 A;  3WNG A;  4CJE A;  3OTO K;  1JLE A;  3TAM A;  5KGW A;  1TUO A;  2PZS A;  4FJL A;  1NJI O;  4ID5 A;  1OH7 A;  1VAZ A;  1S1V A;  4J2E A;  2E20 A;  2QRD A;  2GV9 A;  5HLF A;  5DMR A;  4Q5V A;  3MCA B;  2QRC A;  3RVC A;  3SPY A;  3DXK A;  3CPE A;  1L3U A;  3C0B A;  4BRF A;  3EL2 A;  4CI6 A;  3LP1 A;  3WUH A;  3OSE A;  3J7Y P;  3NDK A;  4MDB A;  4W5R A;  4GVM A;  4ICL A;  3CF5 L;  3MWT A;  3IG1 A;  3V6D A;  1J5E K;  3ENC A;  3NF8 A;  1K2Y X;  2HZM A;  4WQ4 A;  2QRE A;  5ELZ A;  4D7R A;  4FLU A;  2W6K A;  3FLC O;  4LF5 K;  2Q97 A;  1ATN A;  4I6M B;  3LWM A;  1S9G A;  3O9S A;  3L6Q A;  3TAF A;  3IUC A;  4PKG A;  4DF8 A;  3K5N A;  4DR7 K;  4BRC A;  2NOI A;  4Y0W A;  3N89 A;  2UYT A;  4YFU A;  4J2B A;  4BE2 A;  4DQS A;  2O4I A;  4CEB A;  3G0Z A;  5AQJ A;  3SV3 A;  3F10 A;  4BWM A;  4E1M A;  4B3O A;  4PL7 A;  3L2U A;  2D0P A;  3SQ4 A;  1Q86 O;  4WCE L;  1P90 A;  1C1B A;  4JK9 A;  2F8S A;  4B0A A;  2NRH A;  4FM2 A;  5AR0 A;  4I8O A;  3ZX0 A;  3KK2 A;  2G8F A;  4YDU C;  5D3G A;  3SAF A;  3F9K A;  4CK1 A;  4DV2 K;  2Y1J A;  5J2P A;  4DS4 A;  4EAI A;  4FL9 A;  3DRR A;  4O5F A;  4JI4 K;  2XHB A;  1SS6 A;  2HNY A;  4BJU A;  4XH4 A;  4FWQ A;  2F8T A;  4DQI A;  5HRR A;  4AM6 A;  3DXM A;  1X9S A;  2NRX A;  4RG8 A;  2R5X A;  3VGM A;  4BAC A;  3KRM A;  3WXL A;  5KPZ A;  1QNB A;  4QS8 A;  4DV5 K;  1QNE A;  3M5R A;  4C8O A;  3B6O A;  3U8X A;  2DKD A;  5C25 A;  4FJJ A;  4H0O A;  3ASM A;  1HQE A;  2UXD K;  1U2V A;  1KAX A;  4BRK A;  1KLM A;  4W5N A;  2F9T A;  5AQK A;  5JMV D;  4F9O A;  3SPZ A;  4FZX C;  3L3U A;  2A1S A;  2P9K A;  3KLE A;  1C6V A;  4ISE A;  1Z05 A;  1S1X A;  2WUS A;  3I55 N;  1JFI C;  4CFF A;  4WXA A;  1QN9 A;  5EX5 A;  4DQQ A;  1KYD A;  4PKI A;  1YJ9 N;  2HZS A;  1BOT O;  3G6E N;  3ATV A;  3TSU A;  3IS9 A;  4ISG A;  3VF4 A;  4Z4C A;  2KQ2 A;  3VQ9 A;  2X74 A;  3F5T A;  2UU9 K;  2O4G A;  3QET A;  4BRQ A;  3PDK A;  4HUE A;  2P9I A;  4OJR A;  5AQG A;  1NJZ A;  1HNX K;  1DEJ A;  3U9D A;  1KCF A;  4HWI A;  1NK9 A;  3VOV A;  1RT3 A;  3QNO A;  4BR4 A;  5FRM A;  5C0Y A;  5HP1 A;  3U4L A;  3OYC A;  4J2D A;  1VTO A;  3ULD A;  4DV3 K;  1KFQ A;  3NF6 A;  2BGG A;  3THX B;  3CJC A;  3B8A X;  3LDP A;  3MED A;  4CFB A;  2VWK A;  4Z4F A;  5KPT A;  1U4B A;  4CF0 A;  4CF9 A;  1QNC A;  4CED A;  5A2Q O;  3AVN A;  4MLH A;  3NE6 A;  3HK2 A;  4D7Q A;  5DM6 L;  2O8B B;  4DFM A;  3ZX3 A;  4CJV A;  4DQR A;  1I94 K;  4DTR A;  1NMN A;  3AVI A;  2HHS A;  4IEE A;  4HJH A;  5BMN A;  2WC9 A;  3A0I X;  1SKS A;  3EE8 A;  3WXK A;  2FF3 B;  3SUP A;  3AO3 A;  1TBA B;  4FK2 A;  2VG6 A;  1CZ9 A;  3HTV A;  4CD3 A;  3UKU B;  4OLA A;  5IWA K;  2J4R A;  3FZH A;  1VTL E;  1ZBU A;  2FBV A;  1WSG A;  3T1Y K;  1VQ5 N;  1NKB A;  4H03 B;  4KBO A;  1EUV A;  1BL3 A;  1IO2 A;  3P5J A;  3VER A;  3V1R A;  3PX4 A;  5C10 A;  2W40 A;  1HMV A;  2OZS A;  4B3T K;  1ZC6 A;  1BIS A;  2KKZ A;  1JLF A;  3P39 A;  4IFE A;  5FPM A;  3U9Z A;  3VEX A;  3RSE B;  3OYK A;  3MCP A;  4E3S A;  3TR8 A;  3ENB A;  1P5G X;  4BRN A;  4CF1 A;  1NJW A;  4CJU A;  1R59 O;  3V81 A;  3W0L A;  1X1P A;  3KZB A;  3V9U A;  3HM9 A;  1D9F A;  5AN4 A;  1RM1 A;  1EXQ A;  2F7T A;  3ZSW A;  3PIO L;  3OYI A;  5CZ1 A;  4W5T A;  3OY9 A;  1MPG A;  4EHT A;  3AVL A;  2NOZ A;  4E89 A;  2NOE A;  4WQ4 C;  1NJY A;  5FPD A;  3SJJ A;  3AA2 A;  5AQY A;  5FPN A;  3TAP A;  3TAE A;  2D4W A;  3MDQ A;  1NM1 A;  4CHZ A;  4EFH A;  4EAL A;  1RDB A;  3OYN A;  4FW2 A;  4E7J A;  1LW2 A;  1B9D A;  4DV4 K;  1B9F A;  2O8E B;  4WFN L;  1IBK K;  1FKP A;  3GE1 A;  5JS2 A;  2ZD1 A;  1O1W A;  3C65 A;  1SL1 A;  3KIO A;  3QBW A;  1ITG A;  3ULX A;  2E2Q A;  3LDN A;  4V19 S;  3VTH A;  1NGF A;  4IJA A;  4CJ5 A;  4YOW A;  4R79 A;  4X65 K;  3MXM A;  2P51 A;  1N3A A;  2KTQ A;  2YHY A;  3GBT A;  3M6G A;  3MWP A;  1NGH A;  3D0P A;  4N47 A;  5GAG P;  4LY7 A;  2VJ0 A;  3MN6 A;  1TBP A;  5JIC A;  2PYL A;  4LF7 K;  1LAW A;  2V52 B;  1P5D X;  4DLG A;  1V4S A;  1U45 A;  1TKT A;  3CM6 A;  3A2F A;  4CEE A;  2YJE A;  5F2R A;  3KK1 A;  4BG8 A;  1ZBH A;  4K8Z A;  2P5G A;  3UIQ A;  3RWU A;  4CGG A;  4AHT A;  4B1V A;  3RMD A;  1MU2 A;  3BF1 A;  1Z26 A;  3OYF A;  3VQ5 A;  5IT9 O;  1HKB A;  3DYA A;  1VQL N;  3OYJ A;  1KVB A;  4B08 A;  4KH4 A;  2HB5 A;  5AQV A;  2GTD A;  2YHB A;  4FWP A;  4CD1 A;  3OH6 A;  3O5B A;  1JL1 A;  3C6H A;  4Z94 A;  4KHP K;  5KQD A;  2I7N A;  2F96 A;  3O1W A;  4JKH A;  3DLG A;  1HRH A;  4JKG B;  3KVG A;  4DLE A;  3NCI A;  3CC2 N;  4K41 A;  3I0W A;  4FJI A;  1S1T A;  4DTM A;  4XH5 A;  2D0O A;  3QML A;  4B1U B;  1QN4 A;  5C2D A;  4E7I A;  3VEN A;  4BC4 A;  5GIN A;  4J8F A;  3O8M A;  3MXJ A;  4CF2 A;  1NNE A;  4IG3 A;  1DT9 A;  2E1Z A;  3CER A;  4BR5 A;  2QR1 A;  4LC9 B;  4YOU A;  1K35 A;  3WQT A;  1BGX T;  3SUQ A;  3OVN A;  1LWW A;  3RRG A;  3EY1 A;  3LDS A;  2Q36 A;  2QKK A;  4RTF D;  2HW3 A;  4B9Q A;  3CVT A;  3NF7 A;  3EAY A;  1C0T A;  3CJ9 A;  3KHY A;  4BE0 A;  1BWF O;  4A59 A;  3AVM A;  2AP1 A;  1W7A A;  3OYE A;  4JNE A;  3SMP A;  4DSI A;  2Q0R A;  4BR7 A;  4DQ8 A;  3GOI A;  1J54 A;  2A3Z A;  3AVK A;  1J6Z A;  4Y1D A;  4GW6 A;  3CMA N;  4ISF A;  1RT6 A;  4CHP A;  4E7L A;  2YA3 A;  2E4L A;  1GLC G;  3DRP A;  3GDQ A;  1RDW X;  1KD1 O;  4CZI A;  1Q82 O;  3CW7 A;  3VEV A;  3THY B;  3F9M A;  1KQS M;  2YHX A;  3NFA A;  4ROD B;  3L4Q A;  2FC0 A;  3WT0 A;  4CGI A;  2VG7 A;  1M3Q A;  1C1A A;  3UE5 A;  4BG9 A;  3C6U A;  1IKY A;  2QXL A;  3K2P A;  2RE2 A;  3LDO A;  5CY4 A;  1KY7 A;  2FXU A;  5BRD A;  1D8Y A;  3KD1 E;  2CGL A;  4L3Q A;  3AGK A;  1Q9X A;  3C95 A;  1C4G A;  3VF2 A;  3NF9 A;  3DOK A;  1WOQ A;  3C7N A;  2NLX A;  1HR0 K;  1T03 A;  3NVM A;  1NGI A;  3J7A P;  4DTN A;  3QBX A;  1NGD A;  2Q0U A;  3O9R A;  4B9U A;  2KHO A;  3QDK A;  2ZWH A;  1Q9Y A;  4LSL A;  3NH1 A;  4RW9 A;  1N39 A;  4GV9 A;  1BCM A;  3TDH A;  4N41 A;  2DKC A;  2QEX N;  5AQZ A;  3HP6 A;  4H5V A;  1HPM A;  3CIP A;  1D4X A;  1KSP A;  4JD2 B;  1KC8 O;  5H1S Q;  4DV1 K;  3CCS N;  2FGT A;  3OYD A;  3AVJ A;  2JGU A;  3MN7 A;  1NGA A;  3A8Y A;  3FFI A;  2ZQB A;  3HXM A;  3I0R A;  2E2O A;  2EWS A;  4IO8 A;  4DR6 K;  4JEP A;  3HSC A;  5AQT A;  1TGH A;  4B1Z A;  2UUA K;  2QK9 A;  1XHX A;  4FLX A;  2QI2 A;  2QM1 A;  1B9K A;  2NRR A;  4EP5 A;  4CVN E;  2HHH K;  2E2P A;  1QZ5 A;  5CE3 A;  3VQC A;  1TK8 A;  3VQ8 A;  3QB0 A;  1EBM A;  4JKD A;  2D0B A;  3MXI A;  3M8S A;  1EET A;  1H1V A;  4CZH A;  4N76 A;  2QKB A;  2P9N B;  2XY6 A;  2RHK A;  2FSJ A;  4MRQ A;  1HKC A;  1HX1 A;  3RMA A;  3IMX A;  4KRF A;  4FZY A;  4B9T A;  1F21 A;  1IG8 A;  3OYH A;  3V9W A;  5CYQ A;  5LY3 A;  3DMJ A;  4GV3 A;  1RT1 A;  3FFK B;  1VQ4 N;  1NGG A;  3SNS A;  4C7P A;  2IV8 A;  3JSM A;  4ROE B;  2MJ7 A;  1FKO A;  4DKW A;  1BDG A;  1BUP A;  3LDQ A;  3LP2 A;  4LSN A;  1RBR A;  2IDO A;  1WNS A;  3CYM A;  3WNH A;  4A57 A;  3CXC M;  3O9T A;  4OO1 J;  1QQO A;  4KTW A;  4DTP A;  1VQP N;  1KRP A;  2HHU A;  4AH9 A;  2XRI A;  1I39 A;  1VQK N;  2V92 A;  3ALY A;  2VQE K;  3UW2 A;  5JVG L;  3UKR B;  3OST A;  2H5A X;  4AHS A;  1BA1 A;  1TKX A;  1O13 A;  1P8Z A;  3CM5 A;  2YNI A;  4ELU A;  5AQO A;  2VCP A;  4C23 A;  1XUP O;  4H0P A;  3CJ1 A;  5AZJ A;  2E2N A;  3HP9 A;  5B8H A;  2KW4 A;  3ZCM A;  2BE2 A;  3SQ0 A;  5M1P A;  4YOR A;  4NCA A;  4FCY A;  4KFB A;  2Z1J A;  4FWM A;  4DSE A;  1YUW A;  3OBW A;  1UOC A;  4O4G A;  2OCE A;  3SQ1 A;  2P9P B;  3O08 A;  1RBT A;  2O8C B;  4M3R A;  1WSE A;  5BR9 A;  1T6D A;  3IFR A;  1GOC A;  3L8B A;  2PYJ A;  4ROC B;  2KZZ A;  1D3U A;  3VQ6 A;  3T69 A;  4QG5 A;  2IOC A;  4J2A A;  3SK3 A;  2E8A A;  3V9Z A;  5KQ8 A;  4B9N A;  4MLE A;  3D2F A;  1HUX A;  3TWH A;  1C0G A;  3ZX2 A;  4N5S A;  3K9K A;  1TKZ A;  2UXB K;  4KRE A;  2OPR A;  2V8Q A;  3K59 A;  2QWR A;  1E4G T;  2ZM6 K;  2PWW A;  2HBM A;  4ZTJ A;  3KD5 E;  3M8Q A;  5KGX A;  2VWB A;  1NK7 A;  4XIU A;  3KLH A;  3JXU A;  3ZET B;  3PV8 A;  2NWV A;  1IBL K;  1JDY A;  4CIG A;  3D7E O;  2VGM A;  3TE5 A;  4CFA A;  1VSL A;  2H3G X;  1N8R O;  2JPI A;  2P9L B;  4BRL A;  4YHH K;  5C2F A;  1QN3 A;  4B3R K;  4PHT X;  4CK3 A;  4PQU A;  1WUA A;  3VEY A;  4FWN A;  1HNI A;  1NKC A;  4LFB K;  3DLR A;  4KB1 A;  1BO5 O;  3CC4 N;  4EZ6 A;  3H1Z A;  3THV A;  4KI6 A;  3O3G A;  1EP4 A;  1M5Q 1;  3VEZ A;  3QES A;  4DS5 A;  3G4S N;  4CJF A;  1J53 A;  3OJS A;  3LPU A;  2KFN A;  1K8A O;  4F4K A;  3O6W A;  1RIL A;  1JCG A;  4WFB L;  3BY5 A;  2NUB A;  3J7Z O;  3DXK B;  2XO7 A;  1NK6 A;  1JJ2 M;  1GLA G;  2ZJR L;  1ZBL A;  4UY8 O;  1L5U A;  2HHW A;  2EHB D;  5AQR A;  1NK4 A;  3CJ7 A;  3CI5 A;  1HYZ A;  4FXD A;  1XHZ A;  3FZK A;  4CGD A;  3CCM N;  3O80 A;  3D2E A;  3CCJ N;  1S1U A;  3CWU A;  1TGO A;  1VSM A;  3NGI A;  2QWM A;  3EKS A;  1VSE A;  2GEM A;  1E42 A;  1NKE A;  3CQX A;  1VQ7 N;  3MEC A;  3DLH A;  4M3Y A;  3TAG A;  3QIO A;  2HHV A;  4CJL A;  1VSF A;  1T44 A;  2UUB K;  3VET A;  4NLB A;  3V4I A;  3NHG A;  3OSM A;  5BMP A;  4NCB A;  4IOA L;  3NBP A;  5KTQ A;  2H4L X;  3KLF A;  4CEQ A;  2IIR A;  5AQU A;  3HS9 A;  1X9J A;  1VRT A;  5CHI A;  3SLC A;  4E7H A;  4EHU A;  5M1Q A;  4IO9 L;  4DR5 K;  2UUC K;  5MLC Q;  4FYD A;  2P1J A;  4FJK A;  3VQ4 A;  4OKE A;  1IH7 A;  3Q7B A;  4HHT A;  3FGU A;  1LWY A;  4FWO A;  5AQL A;  3HJF A;  3AA3 A;  3M8P A;  1RT4 A;  3JS6 A;  3ZT3 A;  2ATQ A;  2HHT A;  4HUF A;  4BR9 A;  4HTU A;  1NVP A;  3DXM B;  5GIO A;  3HVR A;  1RCH A;  3OHR A;  4HCB A;  3CFO A;  1NWK A;  1BI4 A;  3PIP L;  1R4X A;  4G1Q A;  4KHU A;  3ISN C;  5HBM A;  4C1N I;  4AM7 A;  3L2W A;  4CCH A;  2EX3 A;  4DU4 A;  3AVH A;  3VQA A;  4DV6 K;  1YI2 N;  4DG1 A;  3FZF A;  4OX9 K;  1U2V B;  3GL1 A;  4JYA K;  3LDL A;  3ZLJ A;  5EVZ A;  2HBK A;  3AV9 A;  3L4I A;  4CJR A;  3AO4 A;  4B9L A;  2HF3 A;  5HRN A;  4DU3 A;  2Z1H A;  3CCR N;  3LAK A;  1MA9 B;  1BHL A;  4H5N A;  3FZM A;  3IKM A;  4AHR A;  4H5T A;  1NGE A;  1LXT A;  1SV5 A;  2P9K B;  3PX6 A;  4B9M A;  3VQB A;  4AHC A;  4O5B A;  4GNI A;  2DFF A;  3NGY A;  4CBW A;  4Z4H A;  3WXM B;  2A5X A;  5E84 A;  1GLD G;  3QEX A;  4C8L A;  1XNR K;  1IKV A;  3KLI A;  5C24 A;  3M3Z A;  3ZT4 A;  4MO4 A;  3TAN A;  4KKO A;  3BEX A;  3EYZ A;  1QSS A;  5GAH P;  3VA3 A;  3SI6 A;  3HOT A;  1YTU A;  1PCZ A;  1WQA A;  2P9I B;  2E6M A;  2HHX A;  2QLV A;  1HJO A;  5SZT A;  1YTF A;  2ASP A;  3VN5 A;  4GY2 B;  3LM9 A;  3QER A;  1K8K A;  3SNN A;  1BG3 A;  2O8D A;  1CXQ A;  2YH5 A;  3ZSY A;  4IBN A;  2NOH A;  1U04 A;  5KPR A;  5AQX A;  1N3C A;  1W80 A;  4L8R B;  3VEW A;  4M3X A;  4KPY A;  4A2B A;  4QS7 A;  2BDP A;  5ADX H;  1YF5 L;  3DM2 A;  1LWV A;  4FVU A;  1LWE A;  2WBN A;  4JK8 A;  4M7Y A;  5BPN A;  5AQW A;  4I2P A;  2YNG A;  4WYB A;  4CBX A;  3THW A;  2NOB A;  3VGK A;  1SZ2 A;  4CGJ A;  4MO5 A;  1IKX A;  3MK6 A;  4FLZ A;  2NOF A;  3NVK A;  4FK4 A;  4C8K A;  1NGJ A;  4EIA A;  2ASO A;  4AF1 A;  3K57 A;  1RT7 A;  4DHY A;  2X78 A;  4H8K A;  3EZ5 A;  4FWR A;  1N6Q A;  3N4P A;  2QWP A;  5EXW A;  2OPS A;  1UT4 A;  3AVB A;  4FSV A;  1A5W A;  3D4V A;  3EE9 A;  3KK7 A;  3L0Q A;  1TK5 A;  2O8F A;  3EN9 A;  1YQR A;  2FBX A;  4BRA A;  4CJQ A;  3THW B;  1Q9U A;  4YNQ A;  3AO2 A;  3L2V A;  3TTD A;  3S9H A;  1K9M O;  1N33 K;  3DAW A;  1ASU A;  1NGB A;  3MEG A;  2ZFD B;  2I5J A;  5C15 A;  4FW1 A;  5BPL A;  3F73 A;  1NGM A;  4B1Y B;  4IJN A;  4CIF A;  2VYP A;  3V1O A;  2FBT A;  4YY3 K;  2A1R A;  2HBL A;  3MEE A;  2V9J A;  2Y8Q A;  4GV6 A;  1RT5 A;  3KTQ A;  3OCI A;  4I9L A;  3I0S A;  4DB3 A;  2QWL A;  3QIN A;  2YNH A;  4E1J A;  2PY5 A;  3A5N C;  5FRN A;  3E01 A;  5FPE A;  2V7Y A;  4EZ9 A;  4E7K A;  2FF6 A;  1RDD A;  4AQY K;  3TAR A;  1NK8 A;  2D0A A;  3HS8 A;  1LAV A;  4QOZ B;  3I8D A;  3QNN A;  4F2S A;  4WX8 A;  3QFP A;  1QTS A;  4CEC A;  1VKL A;  1JXB A;  3R6M A;  5AZI A;  4JRQ A;  1LCU A;  1NOZ A;  1QHT A;  1KXP A;  4CZJ A;  1TKD A;  1HJR A;  1VQM N;  3NAE A;  2A42 A;  3EIK A;  3PO4 A;  4DU1 A;  3M8R A;  1KAY A;  3E9O A;  3DWL A;  3OYM A;  1LWC A;  4Y1C A;  4JHD A;  3QFU A;  1LWF A;  3K5O A;  2RPI A;  4BY9 C;  4LF6 K;  3C94 A;  1BA0 A;  2OZM A;  1VOL B;  1UL7 A;  4MFB A;  4HUG A;  4B1X B;  3P83 D;  3RMC A;  3ZSV A;  5LJW A;  3ID8 A;  3CJA A;  4BVP A;  4WFA L;  1T8E A;  3U3Y A;  2ZJQ L;  1JLB A;  3JYT A;  1M1K O;  4ILG B;  3DI6 A;  4KHN A;  4OGE A;  1C47 A;  4CHY A;  1C0U A;  5M1F A;  4OPA A;  4IOX A;  1YVN A;  2LAE A;  2P9S A;  4M63 C;  2QXF A;  3ENO A;  2PAV A;  4FJ9 A;  1CZA N;  4BDZ A;  1HNW K;  2PBD A;  4X66 K;  2P9U A;  4H4O A;  1C0M A;  5I3U A;  4H5R A;  3G25 A;  2IGI A;  4CJT A;  3MN5 A;  4KHY A;  3HBT A;  4M45 A;  4DCH A;  3GG4 A;  1HLU A;  4TPS A;  3QIP A;  3CWT A;  4FJ5 A;  3HPH A;  4AHV A;  4LF9 K;  4RW6 A;  1I3A A;  4U67 L;  2BTF A;  3OS1 A;  4CZM A;  3F0Z A;  3L2Q A;  1NJX A;  3K58 A;  1WSJ A;  4KHQ A;  1JCE A;  1TAQ A;  2Z8U A;  1VK0 A;  2HHQ A;  5BN8 A;  1TUY A;  3DLL L;  2HL8 A;  4BE1 A;  2E88 A;  1QS4 A;  3SMS A;  1VSH A;  1YIT N;  4Z4G A;  4BRM A;  1HNV A;  4DTO A;  1MWK A;  3VA0 A;  3IAY A;  1G15 A;  2GEL A;  1W97 L;  4ELV A;  4CEF A;  1J3M A;  1E3M A;  4CHN A;  1WAJ A;  4JI8 K;  3WEE A;  1FXX A;  4NLC A;  2VQF K;  4NCG A;  3N4Q A;  1KFI A;  3H6E A;  3MX5 A;  2BH1 A;  1NOY A;  2NNW A;  3KKR A;  1EO1 A;  1Z6R A;  4DSK A;  1WBB A;  4O44 A;  4CJ3 A;  2F9W A;  1OH8 A;  1KYU A;  1BU6 O;  3MX2 A;  3S3N A;  4Z4I A;  1SAZ A;  4MDA A;  5F0X A;  2G30 A;  1X3M A;  4LFA K;  3P4I A;  1V5S A;  4RWT A;  4PY5 A;  3VGL A;  1NG9 A;  4DV7 K;  1KAZ A;  1ESV A;  1BQN A;  4CF8 A;  1GLL O;  3OGD A;  4N56 A;  3P1G A;  3ZT2 A;  4CBU A;  2YKM A;  1ZBF A;  4WZS D;  1X9W A;  1RNH A;  4DUZ K;  2RN2 A;  5AQQ A;  2A41 A;  4IFY A;  3L3V A;  1ZBI A;  1DTT A;  4YOT A;  5KRS A;  1VSD A;  4BC2 A;  3JAM O;  1DLO A;  4DF4 A;  1TAU A;  1S72 N;  3DRS A;  2FSK A;  2JWK A;  2XY7 A;  1GOA A;  4OVL A;  3AO1 A;  1RT2 A;  3I3W A;  4ILH A;  2ZGZ A;  3B6P A;  1S3X A;  4GKK K;  4H0T B;  3C7N B;  3O1B A;  4EJY A;  3AVC A;  4FVM A;  2X6N A;  1KYF A;  1JL2 A;  1N34 K;  2E6L A;  2Y8L A;  4PKH A;  3M1F A;  2E1Y A;  2YV0 X;  2YHW A;  1TYQ A;  4CJ4 A;  4KH6 A;  1YHQ N;  4Z4E A;  1HPZ A;  2IS3 A;  1G99 A;  1N5Y A;  4A5A A;  2X6S A;  3KTU A;  3IDH A;  3DOL A;  5J2N A;  1Y97 A;  1VRU A;  2D1K A;  3H1V X;  4H4M A;  4JV5 K;  1NLV A;  1HQU A;  2ETJ A;  1QZ6 A;  2GUI A;  3PSI A;  4FJG A;  3J81 O;  2JWL A;  5T7B A;  5IYB P;  2R7Y A;  3BZK A;  3O4Q A;  4EP4 A;  2NZT A;  2DKA A;  4O55 A;  3EZW A;  3AVA A;  3E66 A;  3E1Y A;  3OJU A;  1K6Y A;  1VOK A;  4F3T A;  1OKJ A;  2QWO A;  1BIZ A;  3O4N A;  3S41 A;  1L3S A;  1QN5 A;  1BQM A;  3CCL N;  4BRG A;  4CGH A;  1U48 A;  4F8R A;  4FWK A;  3TAB A;  3R8E A;  1TVR A;  3ZEU A;  4BR2 A;  4PWD A;  1W0H A;  1Y64 A;  1E4F T;  4HTL A;  4DR1 K;  1HU0 A;  5HRS A;  1L3T A;  4OKJ A;  3TSP A;  3CME N;  1EKE A;  1Q18 A;  3U3G A;  3OC3 C;  3TAQ A;  2YKN A;  2MZ8 A;  4FLT A;  3OW2 M;  4KI4 A;  3T1H K;  5IYC P;  5AFU H;  4JI7 K;  5JS1 A;  5JMV A;  2CGJ A;  5BPM A;  3T1A A;  2B4J A;  4OPH A;  4NB4 A;  4CEA A;  1VQO N;  4CJK A;  1C0F A;  1YQL A;  4OKK A;  3ULE A;  3P31 A;  4B3M K;  1IKW A;  4H0Y B;  2ZE2 A;  4IWV A;  3CC7 N;  3QEP A;  2IVN A;  4LF4 K;  3ENH A;  2GWK A;  3LP3 A;  3QEI A;  1SUQ A;  3K0S A;  2RKI A;  4AHU A;  3ENO C;  4JKE A;  4RW8 A;  4JI3 K;  1ASV A;  3PO5 A;  4GVE A;  3AA5 X;  1VSK A;  5AZJ B;  3CG7 A;  3AVG A;  1VHX A;  5I9E B;  1YXQ A;  4NYN A;  1SKR A;  3CPW M;  3OA9 A;  1QTM A;  3DLE A;  4DUL A;  5K14 A;  5EOY A;  4IG0 A;  1NK5 A;  2HVH A;  2G8K A;  1CZB A;  1VSJ A;  1SL0 A;  4LH4 A;  2G8H A;  3HYF A;  3SV4 A;  3HPG A;  3KWG A;  3VQ7 A;  5LMN K;  1NK0 A;  2VGN A;  2A6A A;  2P5O A;  5AQI A;  5J1E A;  3IH7 A;  2QA4 N;  2VWJ A;  1YQK A;  3DLB A;  4LD0 A;  1M90 O;  1IV0 A;  3CQ8 A;  3HT3 A;  1QSL A;  3E9L A;  4I6M A;  1UAX A;  4BC5 A;  4CZE A;  4JI2 K;  5M1N A;  3PMG A;  4IEI A;  4GMJ B;  4KTQ A;  3D2F B;  5GAE P;  4NO7 A;  2OOY A;  1ASW A;  5DK5 A;  5IYD P;  2YHA A;  5HSH A;  3CWA A;  4JN4 A;  4FJN A;  3SYZ A;  3AAP A;  4DSJ A;  1LOT B;  4EAK A;  1BCO A;  4M7X A;  3DPT A;  4CZK A;  1OH5 A;  2D5R A;  3ZSO A;  3KK3 A;  3I33 A;  2V7Z A;  1N36 K;  2Q1N A;  1UT7 A;  4DFP A;  1V4T A;  3T19 A;  4CZL A;  1SKW A;  2WOM A;  3A5O C;  3AVF A;  3R1X A;  4JI6 K;  1JLQ A;  2DTU A;  2EHG A;  4CZG A;  1A5X A;  4LH5 A;  5LL6 Z;  5FLX O;  5BRH A;  4FJ8 A;  1YIJ N;  4I7F A;  2GWJ A;  4W5O A;  1HYS A;  1RDA A;  3TTF A;  1CDW A;  3OH9 A;  3HZ6 A;  4BWJ A;  4B8A B;  3SZ2 A;  2OTJ N;  1WBD A;  1WN7 A;  1S9E A;  1JLA A;  1UA0 A;  4ILJ A;  3ZSR A;  3KWI A;  4B8C A;  3RR7 A;  5DM7 L;  1TV6 A;  3LAM A;  2B5J A;  4X64 K;  3TSQ A;  1OVY A;  3QEV A;  3BKQ X;  4DTU A;  3QO9 A;  5J2Q A;  3R3L A;  4CJ7 A;  4KHS A;  4DSF A;  3CFR A;  4CES A;  2BAN A;  1S5J A;  2YCH A;  3R9P A;  5TKW A;  1GLF O;  1WSH A;  3AA4 A;  4KB0 A;  3AO5 A;  2XY5 A;  5F9C A;  2NRV A;  4IDK A;  4WE1 A;  4YOV A;  3RMB A;  4BRO A;  2F4V K;  4DMN A;  2D0C A;  5F1X A;  2G8V A;  4CJS A;  3NMU A;  3D2E B;  3ZSX A;  3I0X A;  5E26 A;  3VQQ A;  5HL7 L;  5TKY A;  1QQC A;  2FBY A;  4LF8 K;  4K42 A;  2NRZ A;  1HNZ K;  3OS0 A;  4IOC L;  4QS9 A;  5CYM A;  4KTZ A;  1REV A;  2HF4 A;  1QVF M;  1QHA A;  1RTI A;  4DR2 K;  3J8A A;  2O3O A;  3BP8 A;  3SUN A;  3CET A;  4CFC A;  2WTU A;  4IKF A;  3SAG A;  4BRE A;  2W42 A;  1RBU A;  1WLJ A;  3OBY A;  3UB5 A;  3RPJ A;  1YJW N;  3WXI A;  4EAG A;  1PVS A;  1JLG A;  4GKJ K;  1XNQ K;  3ZT0 A;  2W41 A;  4EJZ A;  2OAN A;  4I9Q A;  4CW7 B;  3HL8 A;  2YNF A;  1ATS A;  5HRP A;  3BGR A;  5AJ3 K;  2Z1G A;  2PFU A;  4CJW A;  3THX A;  4M3W A;  3K9J A;  5GIP A;  3F2K A;  4DQP A;  1YTB A;  5ADX A;  1XC9 A;  2Y1I A;  1RTJ A;  2IVP A;  5E41 A;  2HND A;  3WNF A;  3H3N O;  4UQG A;  1DTQ A;  1MP9 A;  1BI4 B;  1QE1 A;  4XEI A;  2O8B A;  4FWL A;  3ZT1 A;  3DJC A;  4CHO A;  4JI1 K;  3SQ2 A;  1XMQ K;  3PSF A;  4DFJ A;  1QQM A;  1KVA A;  1IBM K;  1R0A A;  2JHJ A;  1YAG A;  3S3M A;  1B92 A;  3ID6 A;  4RW7 A;  3UKU A;  3VMF B;  3E9P A;  1ZXO A;  2OOX A;  3HST B;  4OGC A;  2NRW A;  2HST A;  1QN8 A;  1TUU A;  2BUP A;  3G71 N;  3AAQ A;  3NH0 A;  1GLB G;  3A5L C;  4JAX A;  3G10 A;  3V9X A;  3RR8 A;  1EWR A;  3FR0 A;  5KL0 A;  2UXC K;  4KO0 A;  1T7P A;  3I8B A;  4EAH D;  3CCE N;  2AA4 A;  3RSE A;  2OTL N;  1WSI A;  1DKG D;  3CFP A;  2G8W A;  3O9U A;  1M3H A;  4YOY A;  3D6R A;  4YOX A;  4Z0U A;  2KLA A;  3H46 O;  4DTS A;  5HOO A;  1IG9 A;  4X62 K;  3L2R A;  3C04 A;  4OLB A;  1EX4 A;  5AQF A;  4RW4 A;  1RTH A;  1JCF A;  4Q0B A;  3DPU A;  1QSY A;  3QLH A;  4BGB A;  3IRX A;  1K8K B;  3U6F A;  2O8D B;  4DUY K;  1XC3 A;  5BRE A;  4LFC K;  1IJJ A;  1D5A A;  3LZI A;  3CVS A;  1WAF A;  3OYL A;  1KY6 A;  4FWS A;  4M41 A;  3SCX A;  1WJW A;  2HKP A;  1EWQ A;  4FLV A;  3CWS A;  4XH1 A;  1KO9 A;  1MDU B;  5EU7 A;  3WQU A;  5BN9 A;  4FZZ A;  3QIC A;  3HOS A;  3KKS A;  2O8E A;  4CEZ A;  1CLQ A;  4CE9 A;  4CGF A;  3LAN A;  4FJ7 A;  5JN5 A;  2IC3 A;  2YX6 A;  3NH2 A;  1U47 A;  4KV8 A;  4RCH A;  4CK2 A;  4O8K A;  4ID1 A;  4JKB A;  1RFQ A;  4DFK A;  5FRO A;  1C1C A;  1N32 K;  3AY9 A;  2NOL A;  3HPO A;  1VQ6 N;  4BRD A;  1RBV A;  3FE1 A;  1RDC A;  2KFZ A;  3OS2 A;  4BQZ A;  3VF6 A;  3I56 N;  3H08 A;  1Z25 A;  4QCL A;  4A61 A;  4M3U A;  3TI0 A;  1U49 A;  3ZSZ A;  2CH5 A;  4CIE A;  3Q7C A;  2Q2R A;  3D7Q A;  1EQY A;  3S3O A;  1NU0 A;  2O8F B;  1FN7 A;  3T4N A;  2FSN A;  1YJN N;  4FLY A;  2HBJ A;  2A40 A;  2LSN A;  4G9Z A;  1K73 O;  4FOI A;  3O9Q A;  4H0V B;  3CCV N;  2HOE A;  5AQP A;  5JVH L;  3LL3 A;  1BIU A;  1RTD A;  5C12 A;  2DY4 A;  4C1N K;  2ZF5 O;  4AIL C;  3CQY A;  1XMO K;  1KVC A;  5BRF A;  4JLH A;  1QQN A;  2KZM A;  4FM0 A;  5M1K A;  1L3V A;  4CZF A;  4HVJ A;  5LJV A;  3AAR A;  4WF9 L;  1Q7Y O;  2CGK A;  1VSI A;  4FJX A;  2Q3S A;  4IZ9 A;  4JKG A;  4C8N A; 
#chains in the Genus database with same CATH homology
 2BGG A;  1QN3 A;  4FM1 A;  3MED A;  1GOA A;  3RRH A;  4CK3 A;  2XY7 A;  4OVL A;  3AO1 A;  4E1N A;  4DSL A;  4PQU A;  4CFB A;  1YQM A;  2VWK A;  2RF2 A;  1NKC A;  1HNI A;  3VQP A;  3DLR A;  1RT2 A;  4KB1 A;  4I2Q A;  3B6P A;  4EZ6 A;  3H1Z A;  4Z4F A;  1NH2 A;  3THV A;  4KI6 A;  3O3G A;  1EP4 A;  1KFS A;  1U4B A;  4CF0 A;  4CF9 A;  4DS5 A;  1QNC A;  4EJY A;  2JLE A;  3AVN A;  3AVC A;  4FVM A;  1J53 A;  4CED A;  3LPU A;  4CJF A;  2X6N A;  3OJS A;  3HK2 A;  2KFN A;  1KYF A;  1JL2 A;  4DFM A;  2E6L A;  4W5Q A;  1TK0 A;  3ZSQ A;  4F4K A;  4CJV A;  4DQR A;  5HRO A;  1RIL A;  4DTR A;  1S6P A;  1LV5 A;  2YV0 X;  2NUB A;  3AVI A;  4FLW A;  4KAZ A;  4CJ4 A;  2HHS A;  1SKS A;  2XO7 A;  1YT3 A;  3QEW A;  4NYF A;  1HPZ A;  2XHI A;  2B6A A;  2IS3 A;  1NK6 A;  3V1Q A;  4Z4E A;  1AIS A;  1N5Y A;  3OYA A;  2X6S A;  3KTU A;  4CEO A;  3SUP A;  3AO3 A;  2OA8 A;  4FJM A;  3DOL A;  5J2N A;  1TBA B;  1ZBL A;  1GOB A;  1VRU A;  1Y97 A;  4H4M A;  4MQ3 A;  1L5U A;  4FK2 A;  2HHW A;  2OPP A;  1NK4 A;  2VG6 A;  1CZ9 A;  5FDL A;  1HQU A;  2ETJ A;  2GUI A;  4BDY A;  1HYZ A;  4FJG A;  1XHZ A;  4FXD A;  4CGD A;  4HCC A;  5T7B A;  5IYB P;  2R7Y A;  1QTP A;  3KJV A;  3O4Q A;  4OLA A;  4EP4 A;  1VTL E;  1S1U A;  1ZBU A;  4O55 A;  2DFE A;  1WSG A;  2FBV A;  4IFV A;  1TGO A;  1VSM A;  3AVA A;  3NGI A;  3KLG A;  1NKB A;  5SWM A;  3OJU A;  1K6Y A;  1VOK A;  1VSE A;  1BL3 A;  1IO2 A;  3P5J A;  4F3T A;  3V1R A;  1E42 A;  3PX4 A;  1NKE A;  1BIZ A;  3MEC A;  3O4N A;  1L3S A;  1HMV A;  1QN5 A;  3DLH A;  4BDP A;  1YVU A;  3TAG A;  1BIS A;  2OZS A;  4M3Y A;  1BQM A;  3QIO A;  2HHV A;  1JLF A;  4CGH A;  1FK9 A;  1VSF A;  4CJL A;  3OYK A;  1U48 A;  4F8R A;  3TAB A;  3V4I A;  1TVR A;  4E3S A;  4PWD A;  3NHG A;  1W0H A;  3TR8 A;  3OSM A;  4NCB A;  4CF1 A;  1NJW A;  4CJU A;  3NBP A;  5KTQ A;  3MAQ A;  3KLF A;  3V81 A;  2OYQ A;  1HU0 A;  4CEQ A;  5HRS A;  3RTV A;  1L3T A;  3HS9 A;  1VRT A;  4OKJ A;  1CXU A;  1X1P A;  4CFD A;  1EKE A;  3V9U A;  3HM9 A;  4E7H A;  4QAG A;  3U3G A;  1W9H A;  5J2M A;  1D9F A;  3OC3 C;  3TAQ A;  5AN4 A;  1RM1 A;  1EXQ A;  2YKN A;  2MZ8 A;  3ZSW A;  4JS4 A;  3WNE A;  4ZHR A;  4FLT A;  4KI4 A;  5IYC P;  5JS1 A;  3OYI A;  4FYD A;  5CZ1 A;  2P1J A;  4FJK A;  3VQ4 A;  4W5T A;  3OY9 A;  3T1A A;  2B4J A;  4CER A;  4OKE A;  3AVL A;  2NOZ A;  1IH7 A;  4CEA A;  4E89 A;  3K5L A;  4HHT A;  4FJH A;  2NOE A;  1LWY A;  4CJK A;  2WON A;  3LZJ A;  3QES A;  1NJY A;  3AA3 A;  3M8P A;  1RT4 A;  2GBZ A;  1YQL A;  3AA2 A;  3OYB A;  3SJJ A;  3ZT3 A;  3TAE A;  3TAP A;  4OKK A;  2ATQ A;  2HHT A;  4HUF A;  4F3O A;  1IKW A;  4M3T A;  1D9D A;  2ZE2 A;  4HTU A;  4CHZ A;  3QEP A;  1NVP A;  3HVR A;  1C9B B;  3T3F A;  1RDB A;  3OYN A;  3LP3 A;  1RCH A;  4FW2 A;  4E7J A;  3QEI A;  2HMI A;  1SUQ A;  3CFO A;  4HCB A;  2RKI A;  1LW2 A;  4AHU A;  4E19 A;  1B9D A;  1B9F A;  1BI4 A;  4RW8 A;  1R4X A;  4G1Q A;  4OPJ A;  1ASV A;  1RBS A;  2G8U A;  3PO5 A;  1FKP A;  3AA5 X;  1VSK A;  3ISN C;  5HBM A;  3CG7 A;  3L2W A;  3AVG A;  5JS2 A;  2EX3 A;  2ZD1 A;  4DU4 A;  4CCH A;  1O1W A;  3AVH A;  1SL1 A;  3KIO A;  4NYN A;  3VQA A;  4E0D A;  2DTU A;  1ITG A;  3ULX A;  1SKR A;  4DG1 A;  5C42 A;  1QTM A;  1KFD A;  4DUL A;  3DLE A;  5K14 A;  4IG0 A;  1NK5 A;  4FK0 A;  3HO1 A;  2HVH A;  2G8K A;  1CZB A;  1VSJ A;  4O0I A;  4CJ5 A;  1X9M A;  4JS5 A;  1SL0 A;  4ELT A;  4LH4 A;  3OYG A;  4DTX A;  3AV9 A;  3MXM A;  3VQD A;  4CJR A;  2G8H A;  1QNA A;  2P51 A;  3AO4 A;  1N3A A;  4B9L A;  2KTQ A;  5HRN A;  4C8M A;  4DU3 A;  3HYF A;  2Z1H A;  3HPG A;  3SV4 A;  3LAK A;  3VQ7 A;  3D0P A;  1BHL A;  1NK0 A;  4N47 A;  2P5O A;  5J1E A;  3IH7 A;  4AHR A;  4LY7 A;  2VWJ A;  1YQK A;  4O0J A;  2VJ0 A;  1SV5 A;  3PX6 A;  4B9M A;  3DLB A;  1TBP A;  2PYL A;  4LD0 A;  3VQB A;  1LAW A;  4AHC A;  3CQ8 A;  3HT3 A;  4R5P A;  1QSL A;  3PY8 A;  4DLG A;  1U45 A;  1UAX A;  4O5B A;  1KTQ A;  1TKT A;  2DFF A;  3A2F A;  3CM6 A;  3NGY A;  4CEE A;  2DFH A;  5CZ2 A;  4Z4H A;  2Z1I A;  3KK1 A;  1ZBH A;  4F2R A;  4Q11 A;  4K8Z A;  2P5G A;  3QEX A;  4C8L A;  1A5V A;  3UIQ A;  4GMJ B;  1IKV A;  3KLI A;  5C24 A;  4CGG A;  4AHT A;  3RMD A;  3RWU A;  4KTQ A;  1MU2 A;  1TL1 A;  3ZT4 A;  3TAN A;  1ASW A;  4KKO A;  5DK5 A;  5I42 A;  1Z26 A;  3OYF A;  3VQ5 A;  5IYD P;  3DYA A;  2IV9 A;  1TL3 A;  3EYZ A;  2YHA A;  1J5O A;  3OYJ A;  3SUO A;  1QSS A;  3VA3 A;  3SI6 A;  4FJN A;  1KVB A;  3SYZ A;  1YTU A;  4DSJ A;  1PZD A;  4B08 A;  1PCZ A;  1BCO A;  3DPT A;  2E6M A;  2HHX A;  2HB5 A;  2D5R A;  3ZSO A;  3KK3 A;  2VG5 A;  2YHB A;  1UT7 A;  2OPQ A;  4DFP A;  3LP0 A;  5SZT A;  1JL1 A;  3T19 A;  3O3H A;  1SKW A;  2WOM A;  4PUO A;  3AVF A;  4OPK A;  1UWB A;  1JLQ A;  1YTF A;  3VN5 A;  2EHG A;  4DTJ A;  2F96 A;  1A5X A;  4LH5 A;  3QER A;  3DLG A;  3SNN A;  4FJ8 A;  1HRH A;  1CXQ A;  4DLE A;  1LW0 A;  2YH5 A;  4I7F A;  3ZSY A;  3NCI A;  4W5O A;  4B9V A;  1HYS A;  1RDA A;  4IBN A;  2NOH A;  1CDW A;  1U04 A;  3I0W A;  1JLC A;  3C6T A;  4FJI A;  3PUF A;  3D45 A;  2IAJ A;  1N3C A;  1HYV A;  1S1T A;  4BWJ A;  1W80 A;  4B8A B;  3SZ2 A;  4DTM A;  4DWI A;  4L8R B;  1WN7 A;  1S9E A;  1JLA A;  1UA0 A;  3ZSR A;  4B8C A;  3RR7 A;  4KPY A;  4M3X A;  2BDP A;  1QN7 A;  1ZYQ A;  4E7I A;  1QN4 A;  1TV6 A;  3LAM A;  2B5J A;  2HNZ A;  3QEV A;  3DM2 A;  1LWV A;  3MXJ A;  1LWE A;  3LAL A;  4CF2 A;  4DTU A;  3QO9 A;  4IG3 A;  5J2Q A;  4KHS A;  4DSF A;  4I2P A;  3CFR A;  2YNG A;  1S6Q A;  4CES A;  4M42 A;  2BAN A;  1S5J A;  1BGX T;  1WSH A;  3SUQ A;  2NOB A;  3OVN A;  1LWW A;  3AA4 A;  3EY1 A;  4CGJ A;  3RRG A;  3LDS A;  4KB0 A;  2QKK A;  1IKX A;  3AO5 A;  2XY5 A;  3ITH A;  3O3F A;  3PX0 A;  2HW3 A;  4CJP A;  2G8I A;  4FLZ A;  2NOF A;  4IDK A;  2I5W A;  4WE1 A;  4FK4 A;  3RMB A;  3NF7 A;  1C0T A;  4C8K A;  4DMN A;  4BE0 A;  4KHW A;  2D0C A;  1UA1 A;  2G8V A;  4CJS A;  3V9S A;  3AVM A;  3K57 A;  1RT7 A;  1KLN A;  3ZSX A;  3I0X A;  4JRP A;  3OYE A;  3LWL A;  3DLK A;  3VQQ A;  2X78 A;  2XY8 A;  4DSI A;  4H8K A;  3EZ5 A;  1N6Q A;  4TSX A;  1QQC A;  2FBY A;  1JXE A;  1UT4 A;  2OPS A;  3K5M A;  1J54 A;  3AVB A;  1Q8I A;  3AVK A;  4Y1D A;  4GW6 A;  1A5W A;  2AJQ A;  1TK5 A;  1RT6 A;  2ITG A;  3OS0 A;  1YQR A;  4CHP A;  5CYM A;  2FBX A;  4CJQ A;  4E7L A;  2E4L A;  1REV A;  4KTZ A;  3DRP A;  1T05 A;  1RTI A;  3VQE A;  4YNQ A;  3AO2 A;  3L2V A;  2O3O A;  3HVT A;  2HVI A;  3S9H A;  3LPT A;  3SUN A;  1ASU A;  4CFC A;  4B9S A;  4M3Z A;  3MEG A;  1QN6 A;  4IKF A;  3NE6 A;  2W42 A;  2I5J A;  1RBU A;  4CHQ A;  1JKH A;  1WLJ A;  3NGZ A;  1J9A A;  4FW1 A;  3RPJ A;  3NFA A;  2JOI A;  1SL2 A;  4ROD B;  3F73 A;  2FC0 A;  1NGM A;  1JLG A;  4CIF A;  1WSF A;  1YTA A;  4CGI A;  3ZT0 A;  5KRT A;  3V1O A;  4EJZ A;  2FBT A;  4I9Q A;  2A1R A;  4K8X A;  2VG7 A;  3MEE A;  1M3Q A;  1C1A A;  3HL8 A;  1XWL A;  2YNF A;  1RT5 A;  3KTQ A;  5HRP A;  4ZTF A;  3OCI A;  3BGR A;  4I9L A;  2Z1G A;  3I0S A;  3C6U A;  4PA1 A;  4CJW A;  1IKY A;  3QIN A;  3BDP A;  4M3W A;  1XI1 A;  3K2P A;  2YNH A;  5CY4 A;  1S1W A;  1KY7 A;  5KI6 A;  2PY5 A;  4DQP A;  1D8Y A;  3KD1 E;  1YTB A;  1XC9 A;  5FRN A;  2Y1I A;  1RTJ A;  3E01 A;  5E41 A;  1Q9X A;  3C95 A;  2HND A;  4EZ9 A;  3NF9 A;  3WNG A;  3DOK A;  4CJE A;  4E7K A;  1RDD A;  3WNF A;  1JLE A;  3TAM A;  5KGW A;  4UQG A;  3TAR A;  2D0A A;  3HS8 A;  1DTQ A;  1NK8 A;  2PZS A;  1LAV A;  4QOZ B;  4FJL A;  1T03 A;  1MP9 A;  1BI4 B;  1QE1 A;  4ID5 A;  4M45 A;  3I8D A;  4DTN A;  1NJX A;  1S1V A;  3QNN A;  4F2S A;  3ZT1 A;  4B9U A;  4J2E A;  1QTS A;  1Q9Y A;  4CEC A;  1JXB A;  4LSL A;  4CHO A;  4JRQ A;  2GV9 A;  4RW9 A;  1N39 A;  3NH1 A;  5HLF A;  1NOZ A;  1BCM A;  1QHT A;  5DMR A;  4Q5V A;  4N41 A;  3SQ2 A;  3SPY A;  1TKD A;  1L3U A;  3HP6 A;  1HJR A;  4DFJ A;  1KSP A;  1KVA A;  3NAE A;  3EIK A;  1R0A A;  3LP1 A;  2FGT A;  3OYD A;  3AVJ A;  3PO4 A;  2JGU A;  3S3M A;  4DU1 A;  3M8R A;  3FFI A;  3NDK A;  2ZQB A;  3HXM A;  3I0R A;  3OYM A;  1LWC A;  4Y1C A;  4W5R A;  4GVM A;  4ICL A;  1TGH A;  1B92 A;  1LWF A;  2RPI A;  3K5O A;  3IG1 A;  4RW7 A;  3V6D A;  2QK9 A;  3C94 A;  3NF8 A;  1XHX A;  4FLX A;  3HST B;  2HZM A;  2OZM A;  4OGC A;  1VOL B;  1B9K A;  4FLU A;  1QN8 A;  4MFB A;  4EP5 A;  3P83 D;  4HUG A;  3ZSV A;  3RMC A;  3NH0 A;  3VQC A;  1TK8 A;  1T8E A;  3VQ8 A;  3G10 A;  1EBM A;  3LWM A;  3U3Y A;  1S9G A;  2D0B A;  1JLB A;  3JYT A;  3V9X A;  3TAF A;  3MXI A;  3M8S A;  3RR8 A;  1EET A;  3DI6 A;  4KHN A;  4OGE A;  4DF8 A;  3K5N A;  4CHY A;  1ZBI A;  2NOI A;  1C0U A;  4KO0 A;  3N89 A;  4N76 A;  2QKB A;  4YFU A;  2XY6 A;  1T7P A;  4J2B A;  4BE2 A;  2LAE A;  4DQS A;  2QXF A;  2O4I A;  1WSI A;  4CEB A;  3CFP A;  3G0Z A;  2G8W A;  3SV3 A;  3RMA A;  3F10 A;  4FJ9 A;  4KRF A;  4BWM A;  4FZY A;  4B9T A;  4E1M A;  1F21 A;  4B3O A;  1M3H A;  3OYH A;  3L2U A;  3V9W A;  4KHU A;  4BDZ A;  3SQ4 A;  4Z0U A;  4DTS A;  5CYQ A;  1C1B A;  1IG9 A;  2F8S A;  3DMJ A;  1RT1 A;  4H4O A;  4B0A A;  3L2R A;  3SNS A;  1C0M A;  5I3U A;  4OLB A;  2IV8 A;  1EX4 A;  3JSM A;  4FM2 A;  4RW4 A;  4ROE B;  2MJ7 A;  1FKO A;  1RTH A;  2IGI A;  4CJT A;  4I8O A;  4KHY A;  4Q0B A;  3KK2 A;  3DPU A;  1QSY A;  2G8F A;  3LP2 A;  4LSN A;  1RBR A;  2IDO A;  1WNS A;  3CYM A;  3IRX A;  3QIP A;  4TPS A;  3QLH A;  3WNH A;  5D3G A;  3F9K A;  4CK1 A;  3U6F A;  2Y1J A;  4FJ5 A;  5J2P A;  4DS4 A;  3HPH A;  4AHV A;  4KTW A;  4RW6 A;  1D5A A;  1I3A A;  4DTP A;  1KRP A;  2HHU A;  4AH9 A;  3LZI A;  2XRI A;  3DRR A;  3OS1 A;  3F0Z A;  2HNY A;  2XHB A;  1WAF A;  1I39 A;  3OYL A;  3L2Q A;  3K58 A;  1KY6 A;  1WSJ A;  4M41 A;  3ALY A;  3SCX A;  4KHQ A;  1TAQ A;  2Z8U A;  1VK0 A;  2F8T A;  4DQI A;  2HHQ A;  5HRR A;  1X9S A;  3OST A;  4AHS A;  4RG8 A;  4FLV A;  1TKX A;  1KO9 A;  4BE1 A;  5EU7 A;  4FZZ A;  1QS4 A;  3CM5 A;  1VSH A;  3KRM A;  2YNI A;  3KKS A;  1QNB A;  4CEZ A;  4BAC A;  4CE9 A;  4ELU A;  4CGF A;  1CLQ A;  3LAN A;  4FJ7 A;  1HNV A;  1QNE A;  2IC3 A;  3HP9 A;  3NH2 A;  4DTO A;  1U47 A;  2KW4 A;  3VA0 A;  3ZCM A;  3IAY A;  4KV8 A;  2BE2 A;  1G15 A;  3B6O A;  4CK2 A;  3SQ0 A;  4C8O A;  4NCA A;  4ID1 A;  4KFB A;  4FCY A;  4ELV A;  5C25 A;  4FJJ A;  4CEF A;  5FRO A;  4DSE A;  4DFK A;  3ASM A;  1HQE A;  4CHN A;  1C1C A;  1WAJ A;  1UOC A;  4O4G A;  1FXX A;  2NOL A;  3SQ1 A;  1KLM A;  3HPO A;  2KZM A;  4W5N A;  1RBV A;  1RBT A;  4NCG A;  1RDC A;  2KFZ A;  3OS2 A;  4M3R A;  1WSE A;  3H08 A;  3SPZ A;  1Z25 A;  1NOY A;  4FZX C;  3KKR A;  3L3U A;  2A1S A;  4Z4G A;  3KLE A;  4QCL A;  1GOC A;  4M3U A;  3L8B A;  4DSK A;  1C6V A;  3TI0 A;  1U49 A;  4ROC B;  4O44 A;  3ZSZ A;  4CIE A;  2PYJ A;  2KZZ A;  4CJ3 A;  1D3U A;  3VQ6 A;  1S1X A;  1JFI C;  1QN9 A;  4DQQ A;  2IOC A;  1KYD A;  1KYU A;  3S3O A;  4J2A A;  2HZS A;  3S3N A;  4Z4I A;  3V9Z A;  1FN7 A;  2G30 A;  4B9N A;  4FLY A;  3HJF A;  3TWH A;  4PY5 A;  3IS9 A;  4N5S A;  4Z4C A;  2KQ2 A;  2LSN A;  1TKZ A;  4KRE A;  2OPR A;  3VQ9 A;  4CF8 A;  1BQN A;  2X74 A;  3K59 A;  4N56 A;  3P1G A;  3ZT2 A;  2YKM A;  1ZBF A;  2O4G A;  4ZTJ A;  4WZS D;  3QET A;  1X9W A;  3KD5 E;  3M8Q A;  5KGX A;  4HUE A;  1RNH A;  1BIU A;  4OJR A;  1NJZ A;  1NK7 A;  4XIU A;  3KLH A;  1RTD A;  2DY4 A;  2RN2 A;  1KCF A;  4IFY A;  4AIL C;  3PV8 A;  1NK9 A;  1KVC A;  1RT3 A;  3L3V A;  4JLH A;  3QNO A;  1DTT A;  4FM0 A;  5KRS A;  4CIG A;  1VSD A;  1L3V A;  5FRM A;  4CFA A;  4HVJ A;  1DLO A;  4DF4 A;  5HP1 A;  1VSL A;  1TAU A;  4J2D A;  3OYC A;  1VTO A;  1VSI A;  3ULD A;  2Q3S A;  4FJX A;  2Z1J A;  3NF6 A;  4C8N A;  3DRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...