1YTFA

Yeast tfiia/tbp/dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 38
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1996-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ytfA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ytfA02
1AISA 1B9KA 1QTPA 2D0AA 1QN3A 4ROCB 3ASMA 5IYBP 2G30A 1NH2A 4PY5A 1KYFA 1PCZA 1TGHA 5IYDP 3H1ZA 1JFIC 1QN8A 1QN6A 3OC3C 1W80A 1D3UA 1QN7A 1VTLE 1C9BB 1PZDA 2IV8A 1QN9A 2D0CA 1MP9A 1YTBA 1VOKA 1CDWA 1QNBA 4RODB 4WZSD 1QNCA 1KYUA 4B0AA 1KY6A 1QTSA 2D0BA 3VN5A 1QNEA 1VOLB 1QN5A 4ROEB 3EIKA 3OCIA 1YTFA 1KYDA 5IYCP 1QNAA 1E42A 2MJ7A 1KY7A 3HS9A 2IV9A 1TBAB 2VJ0A 1R4XA 1NVPA 1QN4A 1RM1A 1TBPA 2Z8UA 1NGMA 3HS8A 1VTOA
chains in the Genus database with same CATH superfamily
1B9KA 1C47A 3N89A 4DULA 2D0AA 1QN3A 3OH6A 3EAYA 1PCZA 1TGHA 3CW7A 5EPCA 1P5DX 2V92A 2LAEA 3OLPA 3PMGA 3OGDA 1DIZA 2NWVA 2NVMA 1PVSA 3SNSA 2V8QA 3KRMA 3I0XA 1YQLA 2O3OA 2FKFA 3NA5A 2NOIA 1Q9UA 3CWUA 1HU0A 4B0AA 1QNEA 3VN5A 1LXTA 2ZFDB 3BKQX 4EJZA 1YQMA 1J3MA 1PCMX 3PDKA 2QR1A 1LWVA 1E42A 1K35A 2QLVA 1C4GA 1WQAA 1KY7A 3HS9A 1NVPA 3DPUA 2Z8UA 3RSMA 1XSZA 5HSHA 1WJWA 3DPTA 3OSEA 1V5SA 1AISA 2NOLA 2EHBD 1JDYA 4EAGA 4PY5A 3ASMA 5AN4A 2G30A 1KYFA 3OSTA 4EAKA 2JOIA 1N3AA 3H1ZA 5JMVD 3UW2A 1YQKA 3TDHA 3F10A 1W80A 2NOFA 2V9JA 1PZDA 2IV8A 3RPJA 4TPSA 1QN9A 4WXAA 5F9CA 1YTBA 1K2YX 1VOKA 3CWAA 1CDWA 1QNBA 3CWSA 3CVTA 1QN5A 2MZ8A 2R5XA 2MJ7A 2OOXA 4EJYA 1MPGA 4D7QA 4Q11A 2JHNA 2QRDA 3F0ZA 2DKDA 4QG5A 3I3WA 4MRQA 3OSMA 3OH9A 3I0WA 2HL8A 1PCJX 3ENCA 1TUOA 5KL0A 1VTOA 4C7PA 5IYBP 1M3HA 3D4VA 5IYDP 1KFIA 2QRCA 1EUVA 2Y8LA 1UT7A 1QN8A 1QN6A 3IH7A 1P5GX 1D3UA 1QN7A 1C9BB 2NOZA 2D0CA 1MP9A 2H5AX 5BMPA 4EAIA 3T4NA 4CFFA 5BMNA 2FKMX 4WZSD 1QNCA 1KYUA 2D0BA 1QTSA 1KO9A 5JN5A 4EAJA 3EIKA 1UL7A 2HL9A 3OCIA 1YTFA 2NOBA 2JHJA 2XHIA 1EBMA 2YA3A 1TBAB 2H4LX 3ENOC 1QN4A 1RM1A 3HS8A 2I5WA 2HKPA 1LWWA 3C04A 2FUVA 1QTPA 3ULXA 3KTUA 2Z0FA 3D7QA 4ROCB 1NH2A 2DKAA 4D7RA 4I8OA 2NLVA 2F7LA 3TE5A 2QREA 1N39A 1JFIC 2NOHA 2FGTA 3OC3C 1VTLE 1M3QA 1T6AA 2Y8QA 2DKCA 1M5Q1 1YQRA 1UT4A 4RODB 4WX8A 4HJHA 3CVSA 1KY6A 1VOLB 2HZMA 2NOEA 4ROEB 1KYDA 5IYCP 4EALA 1QNAA 2YH5A 1VKLA 3CWTA 1N3CA 2IV9A 1FN7A 2VJ0A 1R4XA 4IL8A 1TBPA 2OOYA 2PWWA 2JPIA 1KFQA 1NGMA 1LWYA 2HZSA 4BJUA
chains in the Genus database with same CATH topology
1B9KA 3N89A 4DULA 2D0AA 1QN3A 1PCZA 1TGHA 2LAEA 3SNSA 3KRMA 3I0XA 1YQLA 2O3OA 2NOIA 1HU0A 4B0AA 1QNEA 3VN5A 4EJZA 1YQMA 1LWVA 1E42A 1KY7A 3HS9A 1NVPA 3DPUA 2Z8UA 2NOLA 3DPTA 1AISA 4PY5A 3ASMA 5AN4A 2G30A 1KYFA 3OSTA 1N3AA 2JOIA 3H1ZA 1YQKA 3F10A 1W80A 2NOFA 1PZDA 2IV8A 3RPJA 4TPSA 1QN9A 1YTBA 1VOKA 1CDWA 1QNBA 1QN5A 2MZ8A 2MJ7A 4EJYA 4Q11A 3I0WA 3F0ZA 3OSMA 1VTOA 5IYBP 1M3HA 5IYDP 1UT7A 1QN8A 1QN6A 3IH7A 1D3UA 1QN7A 1C9BB 2NOZA 2D0CA 1MP9A 4WZSD 1QNCA 1KYUA 2D0BA 1QTSA 1KO9A 3EIKA 3OCIA 1YTFA 2NOBA 2XHIA 1EBMA 1TBAB 1QN4A 1RM1A 3HS8A 2I5WA 1LWWA 3KTUA 1QTPA 3ULXA 4ROCB 1NH2A 4I8OA 1N39A 1JFIC 2NOHA 2FGTA 3OC3C 1VTLE 1M3QA 1YQRA 1UT4A 4RODB 1KY6A 1VOLB 2HZMA 4ROEB 1KYDA 5IYCP 1QNAA 2YH5A 1N3CA 2IV9A 1FN7A 2VJ0A 1R4XA 1TBPA 1NGMA 1LWYA 2NOEA 2HZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIS A;  1B9K A;  1QTP A;  2D0A A;  1QN3 A;  4ROC B;  3ASM A;  5IYB P;  2G30 A;  1NH2 A;  4PY5 A;  1KYF A;  1PCZ A;  1TGH A;  5IYD P;  3H1Z A;  1JFI C;  1QN8 A;  1QN6 A;  3OC3 C;  1W80 A;  1D3U A;  1QN7 A;  1VTL E;  1C9B B;  1PZD A;  2IV8 A;  1QN9 A;  2D0C A;  1MP9 A;  1YTB A;  1VOK A;  1CDW A;  1QNB A;  4ROD B;  4WZS D;  1QNC A;  1KYU A;  4B0A A;  1KY6 A;  1QTS A;  2D0B A;  3VN5 A;  1QNE A;  1VOL B;  1QN5 A;  4ROE B;  3EIK A;  3OCI A;  1YTF A;  1KYD A;  5IYC P;  1QNA A;  1E42 A;  2MJ7 A;  1KY7 A;  3HS9 A;  2IV9 A;  1TBA B;  2VJ0 A;  1R4X A;  1NVP A;  1QN4 A;  1RM1 A;  1TBP A;  2Z8U A;  1NGM A;  3HS8 A;  1VTO A; 
#chains in the Genus database with same CATH topology
 1B9K A;  1C47 A;  3N89 A;  4DUL A;  2D0A A;  1QN3 A;  3OH6 A;  3EAY A;  1PCZ A;  1TGH A;  3CW7 A;  5EPC A;  1P5D X;  2V92 A;  2LAE A;  3OLP A;  3PMG A;  3OGD A;  1DIZ A;  2NWV A;  2NVM A;  1PVS A;  3SNS A;  2V8Q A;  3KRM A;  3I0X A;  1YQL A;  2O3O A;  2FKF A;  3NA5 A;  2NOI A;  1Q9U A;  3CWU A;  1HU0 A;  4B0A A;  1QNE A;  3VN5 A;  1LXT A;  2ZFD B;  3BKQ X;  4EJZ A;  1YQM A;  1J3M A;  1PCM X;  3PDK A;  2QR1 A;  1LWV A;  1E42 A;  1K35 A;  2QLV A;  1C4G A;  1WQA A;  1KY7 A;  3HS9 A;  1NVP A;  3DPU A;  2Z8U A;  3RSM A;  1XSZ A;  5HSH A;  1WJW A;  3DPT A;  3OSE A;  1V5S A;  1AIS A;  2NOL A;  2EHB D;  1JDY A;  4EAG A;  4PY5 A;  3ASM A;  5AN4 A;  2G30 A;  1KYF A;  3OST A;  4EAK A;  2JOI A;  1N3A A;  3H1Z A;  5JMV D;  3UW2 A;  1YQK A;  3TDH A;  3F10 A;  1W80 A;  2NOF A;  2V9J A;  1PZD A;  2IV8 A;  3RPJ A;  4TPS A;  1QN9 A;  4WXA A;  5F9C A;  1YTB A;  1K2Y X;  1VOK A;  3CWA A;  1CDW A;  1QNB A;  3CWS A;  3CVT A;  1QN5 A;  2MZ8 A;  2R5X A;  2MJ7 A;  2OOX A;  4EJY A;  1MPG A;  4D7Q A;  4Q11 A;  2JHN A;  2QRD A;  3F0Z A;  2DKD A;  4QG5 A;  3I3W A;  4MRQ A;  3OSM A;  3OH9 A;  3I0W A;  2HL8 A;  1PCJ X;  3ENC A;  1TUO A;  5KL0 A;  1VTO A;  4C7P A;  5IYB P;  1M3H A;  3D4V A;  5IYD P;  1KFI A;  2QRC A;  1EUV A;  2Y8L A;  1UT7 A;  1QN8 A;  1QN6 A;  3IH7 A;  1P5G X;  1D3U A;  1QN7 A;  1C9B B;  2NOZ A;  2D0C A;  1MP9 A;  2H5A X;  5BMP A;  4EAI A;  3T4N A;  4CFF A;  5BMN A;  2FKM X;  4WZS D;  1QNC A;  1KYU A;  2D0B A;  1QTS A;  1KO9 A;  5JN5 A;  4EAJ A;  3EIK A;  1UL7 A;  2HL9 A;  3OCI A;  1YTF A;  2NOB A;  2JHJ A;  2XHI A;  1EBM A;  2YA3 A;  1TBA B;  2H4L X;  3ENO C;  1QN4 A;  1RM1 A;  3HS8 A;  2I5W A;  2HKP A;  1LWW A;  3C04 A;  2FUV A;  1QTP A;  3ULX A;  3KTU A;  2Z0F A;  3D7Q A;  4ROC B;  1NH2 A;  2DKA A;  4D7R A;  4I8O A;  2NLV A;  2F7L A;  3TE5 A;  2QRE A;  1N39 A;  1JFI C;  2NOH A;  2FGT A;  3OC3 C;  1VTL E;  1M3Q A;  1T6A A;  2Y8Q A;  2DKC A;  1M5Q 1;  1YQR A;  1UT4 A;  4ROD B;  4WX8 A;  4HJH A;  3CVS A;  1KY6 A;  1VOL B;  2HZM A;  2NOE A;  4ROE B;  1KYD A;  5IYC P;  4EAL A;  1QNA A;  2YH5 A;  1VKL A;  3CWT A;  1N3C A;  2IV9 A;  1FN7 A;  2VJ0 A;  1R4X A;  4IL8 A;  1TBP A;  2OOY A;  2PWW A;  2JPI A;  1KFQ A;  1NGM A;  1LWY A;  2HZS A;  4BJU A; 
#chains in the Genus database with same CATH homology
 1B9K A;  3N89 A;  4DUL A;  2D0A A;  1QN3 A;  1PCZ A;  1TGH A;  2LAE A;  3SNS A;  3KRM A;  3I0X A;  1YQL A;  2O3O A;  2NOI A;  1HU0 A;  4B0A A;  1QNE A;  3VN5 A;  4EJZ A;  1YQM A;  1LWV A;  1E42 A;  1KY7 A;  3HS9 A;  1NVP A;  3DPU A;  2Z8U A;  2NOL A;  3DPT A;  1AIS A;  4PY5 A;  3ASM A;  5AN4 A;  2G30 A;  1KYF A;  3OST A;  1N3A A;  2JOI A;  3H1Z A;  1YQK A;  3F10 A;  1W80 A;  2NOF A;  1PZD A;  2IV8 A;  3RPJ A;  4TPS A;  1QN9 A;  1YTB A;  1VOK A;  1CDW A;  1QNB A;  1QN5 A;  2MZ8 A;  2MJ7 A;  4EJY A;  4Q11 A;  3I0W A;  3F0Z A;  3OSM A;  1VTO A;  5IYB P;  1M3H A;  5IYD P;  1UT7 A;  1QN8 A;  1QN6 A;  3IH7 A;  1D3U A;  1QN7 A;  1C9B B;  2NOZ A;  2D0C A;  1MP9 A;  4WZS D;  1QNC A;  1KYU A;  2D0B A;  1QTS A;  1KO9 A;  3EIK A;  3OCI A;  1YTF A;  2NOB A;  2XHI A;  1EBM A;  1TBA B;  1QN4 A;  1RM1 A;  3HS8 A;  2I5W A;  1LWW A;  3KTU A;  1QTP A;  3ULX A;  4ROC B;  1NH2 A;  4I8O A;  1N39 A;  1JFI C;  2NOH A;  2FGT A;  3OC3 C;  1VTL E;  1M3Q A;  1YQR A;  1UT4 A;  4ROD B;  1KY6 A;  1VOL B;  2HZM A;  4ROE B;  1KYD A;  5IYC P;  1QNA A;  2YH5 A;  1N3C A;  2IV9 A;  1FN7 A;  2VJ0 A;  1R4X A;  1TBP A;  1NGM A;  1LWY A;  2NOE A;  2HZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...