1YTFA

Yeast tfiia/tbp/dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 38
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1996-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ytfA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ytfA02
1KY6A 1PZDA 1NH2A 1CDWA 1MP9A 3HS8A 1NGMA 1PCZA 1W80A 1QNCA 1QN5A 1QTPA 2D0CA 3H1ZA 1C9BB 1VTOA 1KYDA 2IV9A 2MJ7A 1VOKA 2G30A 3EIKA 1QN7A 1QN3A 1QNBA 1NVPA 1YTFA 5IYCP 5IYBP 4B0AA 1E42A 4ROCB 2D0AA 3VN5A 2VJ0A 4ROEB 4RODB 1TGHA 3OCIA 1KYUA 3HS9A 4PY5A 1QNEA 1QN8A 1R4XA 1QN4A 1VOLB 1RM1A 3ASMA 1QN6A 2IV8A 1KYFA 1JFIC 1QNAA 1TBPA 2D0BA 3OC3C 1AISA 1QN9A 1TBAB 1B9KA 5IYDP 1YTBA 2Z8UA 4WZSD 1QTSA 1D3UA 1KY7A 1VTLE
chains in the Genus database with same CATH superfamily
1PVSA 2Y8QA 3T4NA 1QN5A 3N89A 4D7QA 1KYDA 1UL7A 2IV9A 3F0ZA 1VOKA 1FN7A 5IYCP 1C4GA 1DIZA 3D7QA 3F10A 2JOIA 5F9CA 1EUVA 3RSMA 2ZFDB 4EALA 3OCIA 2FGTA 3CVTA 1KYUA 3OH6A 3OSEA 4EAGA 3D4VA 1QNEA 2LAEA 1YQKA 1VKLA 3PMGA 1QN4A 4WX8A 2NOFA 1Q9UA 2NVMA 3ENCA 1J3MA 2NWVA 1KYFA 2JHJA 4EAJA 1QNAA 1N39A 1EBMA 2DKCA 2HZMA 2NOHA 2NOEA 2FKMX 3OSTA 4Q11A 3UW2A 1YTBA 2F7LA 1YQMA 1M5Q1 4EJZA 1D3UA 1KY7A 2V92A 2DKDA 3RPJA 3HS8A 1WJWA 4I8OA 3KTUA 1PCZA 1QNCA 2HL9A 3H1ZA 4MRQA 1C9BB 1KFIA 3I0XA 1QN7A 2O3OA 4D7RA 3EIKA 2QRCA 3CW7A 1NVPA 1KO9A 4CFFA 2DKAA 5IYBP 4B0AA 3CWAA 1YQLA 3I3WA 3I0WA 4BJUA 1T6AA 3VN5A 4RODB 2HL8A 1UT7A 2QRDA 3CWTA 3CWSA 2QREA 3HS9A 1QN8A 1LWWA 1P5GX 3ASMA 2YH5A 2PWWA 1M3HA 2OOXA 4EJYA 2JPIA 2IV8A 1C47A 2D0BA 3TE5A 1AISA 1QN9A 5IYDP 1PCMX 2JHNA 2Z8UA 1YTFA 1VTLE 1PZDA 5BMPA 1CDWA 2Z0FA 5EPCA 5JN5A 3KRMA 2V8QA 1QTPA 3IH7A 2D0CA 2NOBA 2NOZA 3CVSA 1HU0A 2G30A 2Y8LA 3PDKA 1QNBA 1PCJX 1WQAA 3OSMA 1M3QA 4QG5A 3EAYA 1LXTA 4ROCB 3OH9A 4WXAA 2H5AX 2VJ0A 2H4LX 1KFQA 4PY5A 3SNSA 3CWUA 2V9JA 2MZ8A 3DPTA 1QN6A 5JMVD 4TPSA 1MPGA 3DPUA 4EAIA 4HJHA 3ENOC 3ULXA 1JFIC 1TBPA 2FUVA 3OC3C 5BMNA 2I5WA 1K35A 1TBAB 2EHBD 1B9KA 2NLVA 1JDYA 1YQRA 3NA5A 1QTSA 1N3CA 1K2YX 2FKFA 1KY6A 1NH2A 1MP9A 4C7PA 1N3AA 1W80A 1NGMA 1XSZA 2OOYA 1TUOA 2YA3A 1P5DX 2R5XA 1VTOA 1LWYA 3OLPA 2NOLA 3BKQX 2MJ7A 1QN3A 1UT4A 5AN4A 1E42A 4IL8A 4DULA 4EAKA 2D0AA 1TGHA 2XHIA 2NOIA 1V5SA 2HKPA 3C04A 1R4XA 1VOLB 3OGDA 1RM1A 5HSHA 5KL0A 2HZSA 1LWVA 2QR1A 2QLVA 3TDHA 4WZSD 4ROEB
chains in the Genus database with same CATH topology
1QN5A 3N89A 1KYDA 2IV9A 3F0ZA 1VOKA 1FN7A 5IYCP 3F10A 2JOIA 3OCIA 2FGTA 1KYUA 1QNEA 2NOFA 2LAEA 1YQKA 1QN4A 1KYFA 1QNAA 1N39A 1EBMA 2NOHA 2HZMA 2NOEA 3OSTA 4Q11A 1YTBA 1YQMA 4EJZA 1D3UA 1KY7A 3RPJA 3KTUA 3HS8A 4I8OA 1PCZA 1QNCA 3H1ZA 1C9BB 3I0XA 1QN7A 2O3OA 3EIKA 1NVPA 1KO9A 5IYBP 4B0AA 1YQLA 3I0WA 3VN5A 4RODB 1UT7A 3HS9A 1QN8A 1LWWA 3ASMA 2YH5A 1M3HA 4EJYA 2IV8A 2D0BA 1AISA 1QN9A 5IYDP 2Z8UA 1YTFA 1VTLE 1PZDA 1CDWA 3KRMA 3IH7A 1QTPA 2NOBA 2D0CA 2NOZA 1HU0A 2G30A 1QNBA 3OSMA 1M3QA 4ROCB 2VJ0A 4PY5A 3SNSA 2MZ8A 3DPTA 1QN6A 4TPSA 3DPUA 3ULXA 1JFIC 1TBPA 3OC3C 2I5WA 1TBAB 1B9KA 1YQRA 1N3CA 1QTSA 1KY6A 1NH2A 1MP9A 1N3AA 1NGMA 1W80A 1LWYA 1VTOA 2NOLA 2MJ7A 1QN3A 1UT4A 5AN4A 1E42A 4DULA 2D0AA 1TGHA 2XHIA 2NOIA 1R4XA 1VOLB 1RM1A 2HZSA 1LWVA 4WZSD 4ROEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KY6 A;  1PZD A;  1NH2 A;  1CDW A;  1MP9 A;  3HS8 A;  1NGM A;  1PCZ A;  1W80 A;  1QNC A;  1QN5 A;  1QTP A;  2D0C A;  3H1Z A;  1C9B B;  1VTO A;  1KYD A;  2IV9 A;  2MJ7 A;  1VOK A;  2G30 A;  3EIK A;  1QN7 A;  1QN3 A;  1QNB A;  1NVP A;  1YTF A;  5IYC P;  5IYB P;  4B0A A;  1E42 A;  4ROC B;  2D0A A;  3VN5 A;  2VJ0 A;  4ROE B;  4ROD B;  1TGH A;  3OCI A;  1KYU A;  3HS9 A;  4PY5 A;  1QNE A;  1QN8 A;  1R4X A;  1QN4 A;  1VOL B;  1RM1 A;  3ASM A;  1QN6 A;  2IV8 A;  1KYF A;  1JFI C;  1QNA A;  1TBP A;  2D0B A;  3OC3 C;  1AIS A;  1QN9 A;  1TBA B;  1B9K A;  5IYD P;  1YTB A;  2Z8U A;  4WZS D;  1QTS A;  1D3U A;  1KY7 A;  1VTL E; 
#chains in the Genus database with same CATH topology
 1PVS A;  2Y8Q A;  3T4N A;  1QN5 A;  3N89 A;  4D7Q A;  1KYD A;  1UL7 A;  2IV9 A;  3F0Z A;  1VOK A;  1FN7 A;  5IYC P;  1C4G A;  1DIZ A;  3D7Q A;  3F10 A;  2JOI A;  5F9C A;  1EUV A;  3RSM A;  2ZFD B;  4EAL A;  3OCI A;  2FGT A;  3CVT A;  1KYU A;  3OH6 A;  3OSE A;  4EAG A;  3D4V A;  1QNE A;  2LAE A;  1YQK A;  1VKL A;  3PMG A;  1QN4 A;  4WX8 A;  2NOF A;  1Q9U A;  2NVM A;  3ENC A;  1J3M A;  2NWV A;  1KYF A;  2JHJ A;  4EAJ A;  1QNA A;  1N39 A;  1EBM A;  2DKC A;  2HZM A;  2NOH A;  2NOE A;  2FKM X;  3OST A;  4Q11 A;  3UW2 A;  1YTB A;  2F7L A;  1YQM A;  1M5Q 1;  4EJZ A;  1D3U A;  1KY7 A;  2V92 A;  2DKD A;  3RPJ A;  3HS8 A;  1WJW A;  4I8O A;  3KTU A;  1PCZ A;  1QNC A;  2HL9 A;  3H1Z A;  4MRQ A;  1C9B B;  1KFI A;  3I0X A;  1QN7 A;  2O3O A;  4D7R A;  3EIK A;  2QRC A;  3CW7 A;  1NVP A;  1KO9 A;  4CFF A;  2DKA A;  5IYB P;  4B0A A;  3CWA A;  1YQL A;  3I3W A;  3I0W A;  4BJU A;  1T6A A;  3VN5 A;  4ROD B;  2HL8 A;  1UT7 A;  2QRD A;  3CWT A;  3CWS A;  2QRE A;  3HS9 A;  1QN8 A;  1LWW A;  1P5G X;  3ASM A;  2YH5 A;  2PWW A;  1M3H A;  2OOX A;  4EJY A;  2JPI A;  2IV8 A;  1C47 A;  2D0B A;  3TE5 A;  1AIS A;  1QN9 A;  5IYD P;  1PCM X;  2JHN A;  2Z8U A;  1YTF A;  1VTL E;  1PZD A;  5BMP A;  1CDW A;  2Z0F A;  5EPC A;  5JN5 A;  3KRM A;  2V8Q A;  1QTP A;  3IH7 A;  2D0C A;  2NOB A;  2NOZ A;  3CVS A;  1HU0 A;  2G30 A;  2Y8L A;  3PDK A;  1QNB A;  1PCJ X;  1WQA A;  3OSM A;  1M3Q A;  4QG5 A;  3EAY A;  1LXT A;  4ROC B;  3OH9 A;  4WXA A;  2H5A X;  2VJ0 A;  2H4L X;  1KFQ A;  4PY5 A;  3SNS A;  3CWU A;  2V9J A;  2MZ8 A;  3DPT A;  1QN6 A;  5JMV D;  4TPS A;  1MPG A;  3DPU A;  4EAI A;  4HJH A;  3ENO C;  3ULX A;  1JFI C;  1TBP A;  2FUV A;  3OC3 C;  5BMN A;  2I5W A;  1K35 A;  1TBA B;  2EHB D;  1B9K A;  2NLV A;  1JDY A;  1YQR A;  3NA5 A;  1QTS A;  1N3C A;  1K2Y X;  2FKF A;  1KY6 A;  1NH2 A;  1MP9 A;  4C7P A;  1N3A A;  1W80 A;  1NGM A;  1XSZ A;  2OOY A;  1TUO A;  2YA3 A;  1P5D X;  2R5X A;  1VTO A;  1LWY A;  3OLP A;  2NOL A;  3BKQ X;  2MJ7 A;  1QN3 A;  1UT4 A;  5AN4 A;  1E42 A;  4IL8 A;  4DUL A;  4EAK A;  2D0A A;  1TGH A;  2XHI A;  2NOI A;  1V5S A;  2HKP A;  3C04 A;  1R4X A;  1VOL B;  3OGD A;  1RM1 A;  5HSH A;  5KL0 A;  2HZS A;  1LWV A;  2QR1 A;  2QLV A;  3TDH A;  4WZS D;  4ROE B; 
#chains in the Genus database with same CATH homology
 1QN5 A;  3N89 A;  1KYD A;  2IV9 A;  3F0Z A;  1VOK A;  1FN7 A;  5IYC P;  3F10 A;  2JOI A;  3OCI A;  2FGT A;  1KYU A;  1QNE A;  2NOF A;  2LAE A;  1YQK A;  1QN4 A;  1KYF A;  1QNA A;  1N39 A;  1EBM A;  2NOH A;  2HZM A;  2NOE A;  3OST A;  4Q11 A;  1YTB A;  1YQM A;  4EJZ A;  1D3U A;  1KY7 A;  3RPJ A;  3KTU A;  3HS8 A;  4I8O A;  1PCZ A;  1QNC A;  3H1Z A;  1C9B B;  3I0X A;  1QN7 A;  2O3O A;  3EIK A;  1NVP A;  1KO9 A;  5IYB P;  4B0A A;  1YQL A;  3I0W A;  3VN5 A;  4ROD B;  1UT7 A;  3HS9 A;  1QN8 A;  1LWW A;  3ASM A;  2YH5 A;  1M3H A;  4EJY A;  2IV8 A;  2D0B A;  1AIS A;  1QN9 A;  5IYD P;  2Z8U A;  1YTF A;  1VTL E;  1PZD A;  1CDW A;  3KRM A;  3IH7 A;  1QTP A;  2NOB A;  2D0C A;  2NOZ A;  1HU0 A;  2G30 A;  1QNB A;  3OSM A;  1M3Q A;  4ROC B;  2VJ0 A;  4PY5 A;  3SNS A;  2MZ8 A;  3DPT A;  1QN6 A;  4TPS A;  3DPU A;  3ULX A;  1JFI C;  1TBP A;  3OC3 C;  2I5W A;  1TBA B;  1B9K A;  1YQR A;  1N3C A;  1QTS A;  1KY6 A;  1NH2 A;  1MP9 A;  1N3A A;  1NGM A;  1W80 A;  1LWY A;  1VTO A;  2NOL A;  2MJ7 A;  1QN3 A;  1UT4 A;  5AN4 A;  1E42 A;  4DUL A;  2D0A A;  1TGH A;  2XHI A;  2NOI A;  1R4X A;  1VOL B;  1RM1 A;  2HZS A;  1LWV A;  4WZS D;  4ROE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...