1YTBA

Crystal structure of a yeast tbp/tata-box complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (29MER)
publication title Crystal structure of a yeast TBP/TATA-box complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 42
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ytbA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ytbA02
4WZSD 1PCZA 1KYUA 1RM1A 1VOKA 1QN7A 1AISA 4ROEB 1C9BB 1KYFA 1PZDA 3HS8A 1NGMA 1NVPA 3OC3C 1KYDA 4ROCB 1QTPA 3HS9A 1TBPA 1QN5A 2IV8A 3VN5A 3H1ZA 1QNAA 1W80A 3EIKA 1E42A 1KY7A 1QN4A 1QNEA 1YTBA 1QNBA 1MP9A 1CDWA 1D3UA 4PY5A 1YTFA 1R4XA 2MJ7A 4B0AA 1NH2A 2D0CA 1JFIC 5IYBP 1KY6A 1VTLE 1TBAB 2IV9A 2G30A 2Z8UA 3ASMA 1TGHA 1QTSA 5IYCP 1QNCA 1QN9A 3OCIA 2D0BA 2D0AA 4RODB 2VJ0A 5IYDP 1QN8A 1VTOA 1B9KA 1QN3A 1QN6A 1VOLB
chains in the Genus database with same CATH superfamily
1J3MA 3DPUA 1RM1A 1VOKA 1LWWA 5HSHA 4EAKA 3N89A 4EAJA 1KYDA 4EAGA 3D4VA 1QTPA 2O3OA 3RSMA 3HS9A 3EAYA 4EAIA 4D7RA 2IV8A 1W80A 3I0XA 1E42A 1MP9A 1CDWA 1UL7A 2V8QA 3ENCA 1D3UA 2JPIA 4PY5A 2JOIA 3OH9A 1N3CA 1NH2A 2D0CA 3OSEA 1P5GX 3F0ZA 3BKQX 3CWAA 3TE5A 5AN4A 1N39A 1EUVA 1M3HA 3CWUA 2D0AA 1EBMA 3CWTA 3KRMA 5JMVD 2NWVA 2Z0FA 1QN6A 1VOLB 4C7PA 2HL9A 1KFIA 4DULA 5JN5A 4EJYA 3CW7A 3HS8A 1NVPA 2NOFA 2JHJA 4WXAA 4ROCB 1TBPA 1MPGA 4I8OA 1QNAA 2LAEA 5KL0A 1KY7A 1YTBA 4BJUA 1LXTA 3CWSA 2HZMA 2Y8LA 1JFIC 1K2YX 3DPTA 1TBAB 2XHIA 2IV9A 3I3WA 3RPJA 1YQLA 2NVMA 1KFQA 4RODB 1N3AA 2FGTA 4QG5A 1C4GA 1TUOA 2VJ0A 3ULXA 5IYDP 1T6AA 3C04A 1LWVA 3KTUA 1PCMX 3ENOC 4WZSD 1PCZA 2FKFA 1LWYA 1QN7A 1AISA 4ROEB 1KYFA 2R5XA 3OC3C 3D7QA 3OSMA 1DIZA 4EALA 3T4NA 3PDKA 1QNEA 2H5AX 2YH5A 1KO9A 2HZSA 5BMNA 1YTFA 1R4XA 2NOBA 1JDYA 4B0AA 4EJZA 3OGDA 5BMPA 1HU0A 1KY6A 1VTLE 4TPSA 2QR1A 2G30A 1YQKA 3OH6A 1YQMA 2FUVA 2NOLA 2FKMX 5IYCP 2NOIA 2D0BA 1P5DX 1UT4A 2PWWA 2YA3A 4MRQA 1VKLA 3I0WA 1B9KA 1PVSA 1Q9UA 2QREA 1VTOA 1QN3A 2JHNA 3CVSA 1WJWA 1KYUA 1WQAA 2QLVA 4IL8A 2EHBD 4WX8A 2HL8A 1PZDA 1YQRA 2V9JA 1NGMA 1C9BB 3TDHA 2NLVA 3SNSA 1UT7A 4CFFA 1QN5A 1M5Q1 2HKPA 3H1ZA 3OLPA 3EIKA 5EPCA 3F10A 3VN5A 1QN4A 2NOEA 3OSTA 2QRCA 1QNBA 1V5SA 2QRDA 2V92A 1FN7A 2MJ7A 1K35A 2Y8QA 2OOXA 1M3QA 2DKDA 4HJHA 3CVTA 1XSZA 5IYBP 5F9CA 2H4LX 4D7QA 3PMGA 2Z8UA 3ASMA 2F7LA 3IH7A 1TGHA 1QTSA 1QNCA 2DKCA 1QN9A 2ZFDB 1C47A 3OCIA 3NA5A 3UW2A 1PCJX 2OOYA 1QN8A 2I5WA 4Q11A 2NOHA 2NOZA 2DKAA 2MZ8A
chains in the Genus database with same CATH topology
3DPUA 1RM1A 1VOKA 1LWWA 3N89A 1KYDA 1QTPA 2O3OA 3HS9A 2IV8A 1W80A 3I0XA 1E42A 1MP9A 1CDWA 1D3UA 4PY5A 2JOIA 1N3CA 1NH2A 2D0CA 3F0ZA 5AN4A 1N39A 1M3HA 2D0AA 1EBMA 3KRMA 1QN6A 1VOLB 4DULA 4EJYA 3HS8A 1NVPA 4ROCB 1TBPA 4I8OA 1QNAA 2LAEA 1KY7A 1YTBA 2HZMA 1JFIC 3DPTA 1TBAB 2XHIA 2IV9A 3RPJA 1YQLA 4RODB 1N3AA 2FGTA 5IYDP 2VJ0A 3ULXA 1LWVA 3KTUA 4WZSD 1PCZA 1LWYA 1QN7A 1AISA 4ROEB 1KYFA 3OC3C 3OSMA 1QNEA 2YH5A 1KO9A 2HZSA 1YTFA 1R4XA 2NOBA 4B0AA 4EJZA 1HU0A 1KY6A 1VTLE 4TPSA 2G30A 1YQKA 1YQMA 2NOLA 2NOIA 5IYCP 2D0BA 1UT4A 1VTOA 3I0WA 1B9KA 2NOFA 1QN3A 1KYUA 1C9BB 1PZDA 1YQRA 1NGMA 3SNSA 1UT7A 1QN5A 3VN5A 3H1ZA 2NOEA 3EIKA 3F10A 1QN4A 3OSTA 1QNBA 1FN7A 2MJ7A 1M3QA 5IYBP 2Z8UA 3ASMA 3IH7A 1TGHA 1QTSA 1QNCA 1QN9A 3OCIA 2I5WA 1QN8A 2NOHA 4Q11A 2NOZA 2MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZS D;  1PCZ A;  1KYU A;  1RM1 A;  1VOK A;  1QN7 A;  1AIS A;  4ROE B;  1C9B B;  1KYF A;  1PZD A;  3HS8 A;  1NGM A;  1NVP A;  3OC3 C;  1KYD A;  4ROC B;  1QTP A;  3HS9 A;  1TBP A;  1QN5 A;  2IV8 A;  3VN5 A;  3H1Z A;  1QNA A;  1W80 A;  3EIK A;  1E42 A;  1KY7 A;  1QN4 A;  1QNE A;  1YTB A;  1QNB A;  1MP9 A;  1CDW A;  1D3U A;  4PY5 A;  1YTF A;  1R4X A;  2MJ7 A;  4B0A A;  1NH2 A;  2D0C A;  1JFI C;  5IYB P;  1KY6 A;  1VTL E;  1TBA B;  2IV9 A;  2G30 A;  2Z8U A;  3ASM A;  1TGH A;  1QTS A;  5IYC P;  1QNC A;  1QN9 A;  3OCI A;  2D0B A;  2D0A A;  4ROD B;  2VJ0 A;  5IYD P;  1QN8 A;  1VTO A;  1B9K A;  1QN3 A;  1QN6 A;  1VOL B; 
#chains in the Genus database with same CATH topology
 1J3M A;  3DPU A;  1RM1 A;  1VOK A;  1LWW A;  5HSH A;  4EAK A;  3N89 A;  4EAJ A;  1KYD A;  4EAG A;  3D4V A;  1QTP A;  2O3O A;  3RSM A;  3HS9 A;  3EAY A;  4EAI A;  4D7R A;  2IV8 A;  1W80 A;  3I0X A;  1E42 A;  1MP9 A;  1CDW A;  1UL7 A;  2V8Q A;  3ENC A;  1D3U A;  2JPI A;  4PY5 A;  2JOI A;  3OH9 A;  1N3C A;  1NH2 A;  2D0C A;  3OSE A;  1P5G X;  3F0Z A;  3BKQ X;  3CWA A;  3TE5 A;  5AN4 A;  1N39 A;  1EUV A;  1M3H A;  3CWU A;  2D0A A;  1EBM A;  3CWT A;  3KRM A;  5JMV D;  2NWV A;  2Z0F A;  1QN6 A;  1VOL B;  4C7P A;  2HL9 A;  1KFI A;  4DUL A;  5JN5 A;  4EJY A;  3CW7 A;  3HS8 A;  1NVP A;  2NOF A;  2JHJ A;  4WXA A;  4ROC B;  1TBP A;  1MPG A;  4I8O A;  1QNA A;  2LAE A;  5KL0 A;  1KY7 A;  1YTB A;  4BJU A;  1LXT A;  3CWS A;  2HZM A;  2Y8L A;  1JFI C;  1K2Y X;  3DPT A;  1TBA B;  2XHI A;  2IV9 A;  3I3W A;  3RPJ A;  1YQL A;  2NVM A;  1KFQ A;  4ROD B;  1N3A A;  2FGT A;  4QG5 A;  1C4G A;  1TUO A;  2VJ0 A;  3ULX A;  5IYD P;  1T6A A;  3C04 A;  1LWV A;  3KTU A;  1PCM X;  3ENO C;  4WZS D;  1PCZ A;  2FKF A;  1LWY A;  1QN7 A;  1AIS A;  4ROE B;  1KYF A;  2R5X A;  3OC3 C;  3D7Q A;  3OSM A;  1DIZ A;  4EAL A;  3T4N A;  3PDK A;  1QNE A;  2H5A X;  2YH5 A;  1KO9 A;  2HZS A;  5BMN A;  1YTF A;  1R4X A;  2NOB A;  1JDY A;  4B0A A;  4EJZ A;  3OGD A;  5BMP A;  1HU0 A;  1KY6 A;  1VTL E;  4TPS A;  2QR1 A;  2G30 A;  1YQK A;  3OH6 A;  1YQM A;  2FUV A;  2NOL A;  2FKM X;  5IYC P;  2NOI A;  2D0B A;  1P5D X;  1UT4 A;  2PWW A;  2YA3 A;  4MRQ A;  1VKL A;  3I0W A;  1B9K A;  1PVS A;  1Q9U A;  2QRE A;  1VTO A;  1QN3 A;  2JHN A;  3CVS A;  1WJW A;  1KYU A;  1WQA A;  2QLV A;  4IL8 A;  2EHB D;  4WX8 A;  2HL8 A;  1PZD A;  1YQR A;  2V9J A;  1NGM A;  1C9B B;  3TDH A;  2NLV A;  3SNS A;  1UT7 A;  4CFF A;  1QN5 A;  1M5Q 1;  2HKP A;  3H1Z A;  3OLP A;  3EIK A;  5EPC A;  3F10 A;  3VN5 A;  1QN4 A;  2NOE A;  3OST A;  2QRC A;  1QNB A;  1V5S A;  2QRD A;  2V92 A;  1FN7 A;  2MJ7 A;  1K35 A;  2Y8Q A;  2OOX A;  1M3Q A;  2DKD A;  4HJH A;  3CVT A;  1XSZ A;  5IYB P;  5F9C A;  2H4L X;  4D7Q A;  3PMG A;  2Z8U A;  3ASM A;  2F7L A;  3IH7 A;  1TGH A;  1QTS A;  1QNC A;  2DKC A;  1QN9 A;  2ZFD B;  1C47 A;  3OCI A;  3NA5 A;  3UW2 A;  1PCJ X;  2OOY A;  1QN8 A;  2I5W A;  4Q11 A;  2NOH A;  2NOZ A;  2DKA A;  2MZ8 A; 
#chains in the Genus database with same CATH homology
 3DPU A;  1RM1 A;  1VOK A;  1LWW A;  3N89 A;  1KYD A;  1QTP A;  2O3O A;  3HS9 A;  2IV8 A;  1W80 A;  3I0X A;  1E42 A;  1MP9 A;  1CDW A;  1D3U A;  4PY5 A;  2JOI A;  1N3C A;  1NH2 A;  2D0C A;  3F0Z A;  5AN4 A;  1N39 A;  1M3H A;  2D0A A;  1EBM A;  3KRM A;  1QN6 A;  1VOL B;  4DUL A;  4EJY A;  3HS8 A;  1NVP A;  4ROC B;  1TBP A;  4I8O A;  1QNA A;  2LAE A;  1KY7 A;  1YTB A;  2HZM A;  1JFI C;  3DPT A;  1TBA B;  2XHI A;  2IV9 A;  3RPJ A;  1YQL A;  4ROD B;  1N3A A;  2FGT A;  5IYD P;  2VJ0 A;  3ULX A;  1LWV A;  3KTU A;  4WZS D;  1PCZ A;  1LWY A;  1QN7 A;  1AIS A;  4ROE B;  1KYF A;  3OC3 C;  3OSM A;  1QNE A;  2YH5 A;  1KO9 A;  2HZS A;  1YTF A;  1R4X A;  2NOB A;  4B0A A;  4EJZ A;  1HU0 A;  1KY6 A;  1VTL E;  4TPS A;  2G30 A;  1YQK A;  1YQM A;  2NOL A;  2NOI A;  5IYC P;  2D0B A;  1UT4 A;  1VTO A;  3I0W A;  1B9K A;  2NOF A;  1QN3 A;  1KYU A;  1C9B B;  1PZD A;  1YQR A;  1NGM A;  3SNS A;  1UT7 A;  1QN5 A;  3VN5 A;  3H1Z A;  2NOE A;  3EIK A;  3F10 A;  1QN4 A;  3OST A;  1QNB A;  1FN7 A;  2MJ7 A;  1M3Q A;  5IYB P;  2Z8U A;  3ASM A;  3IH7 A;  1TGH A;  1QTS A;  1QNC A;  1QN9 A;  3OCI A;  2I5W A;  1QN8 A;  2NOH A;  4Q11 A;  2NOZ A;  2MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...