2YA3A

Structure of the regulatory fragment of mammalian ampk in complex with coumarin adp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
156
structure length
102
Chain Sequence
MAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKNSCTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structure of Mammalian Ampk and its Regulation by Adp
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 21
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2ya3A01
2V8QA 2ZFDB 2QRDA 2YA3A 4EAGA 2OOYA 2EHBD 4EAJA 3T4NA 3OSEA 1V5SA 2QRCA 1UL7A 2QREA 2V92A 2OOXA 2Y8LA 4EAKA 4EAIA 4EALA 2QLVA 2Y8QA 4CFFA 2QR1A 3TDHA 2V9JA 3TE5A
chains in the Genus database with same CATH superfamily
1Q9UA 2YA3A 2FKFA 5HSHA 5F9CA 3RPJA 1EUVA 4RODB 1VOKA 5JN5A 3OH9A 1TUOA 2D0BA 1NVPA 1P5GX 2IV9A 1VKLA 2NOFA 2EHBD 2O3OA 3HS8A 1T6AA 1VTOA 1QN6A 3OSEA 2FKMX 2QRCA 1PZDA 3OSTA 3D7QA 4C7PA 1XSZA 4WZSD 2NOZA 2DKDA 4D7RA 1MPGA 1QNEA 2HL9A 2OOXA 3DPUA 3I3WA 3EIKA 3CW7A 2NOBA 2JPIA 1KYDA 3F10A 2YH5A 2FGTA 3IH7A 2QLVA 4DULA 1TGHA 4CFFA 2NOEA 4WX8A 5KL0A 2F7LA 2D0AA 1WJWA 3CWTA 2NLVA 1KO9A 3OC3C 3CVSA 1JFIC 3PDKA 1WQAA 1VTLE 4EJYA 2D0CA 3KRMA 1QTPA 1D3UA 1QNBA 4ROCB 2NVMA 1N3AA 1M3HA 1CDWA 4PY5A 1KYFA 1E42A 4WXAA 2JHNA 1KFIA 2IV8A 3HS9A 1RM1A 5IYCP 4EAJA 1LXTA 5JMVD 1PVSA 3I0XA 1QN7A 2NOLA 1YQRA 1QNAA 1LWVA 1KFQA 2JHJA 1N3CA 1TBPA 3OLPA 1VOLB 2NWVA 3CVTA 1YQMA 2MJ7A 4EAIA 2XHIA 5BMPA 1W80A 2Y8QA 5IYDP 4BJUA 3OCIA 1LWWA 1YQLA 3I0WA 3ENOC 3TE5A 1M5Q1 1C47A 3NA5A 1QN9A 2NOIA 2JOIA 2V8QA 1NH2A 2QRDA 1KY7A 1FN7A 1QN4A 1C4GA 1B9KA 4I8OA 1PCZA 2HZMA 4ROEB 4QG5A 4EJZA 5AN4A 2G30A 2H5AX 3OSMA 2LAEA 1QN8A 2QREA 1K2YX 1P5DX 2V92A 1NGMA 1DIZA 1N39A 1MP9A 1PCMX 2Y8LA 1LWYA 1HU0A 4IL8A 3C04A 3D4VA 1KY6A 1TBAB 1YQKA 5IYBP 1PCJX 3ASMA 3ULXA 3N89A 1QN5A 2QR1A 3TDHA 3CWAA 3CWUA 1UT4A 3VN5A 2Z0FA 2NOHA 2ZFDB 1UT7A 4MRQA 3PMGA 2DKAA 1C9BB 2R5XA 2DKCA 3F0ZA 4HJHA 5EPCA 2H4LX 3UW2A 4TPSA 4D7QA 1AISA 3CWSA 2PWWA 4EAGA 1QN3A 2OOYA 3EAYA 2Z8UA 1M3QA 3T4NA 2FUVA 1EBMA 1QNCA 1V5SA 1YTBA 1UL7A 3RSMA 5BMNA 1JDYA 4Q11A 2VJ0A 3H1ZA 3BKQX 1QTSA 1R4XA 2MZ8A 3OH6A 1KYUA 2HL8A 4B0AA 4EAKA 4EALA 3OGDA 3ENCA 3KTUA 1J3MA 3SNSA 2HKPA 2HZSA 1YTFA 3DPTA 1K35A 2V9JA 2I5WA
chains in the Genus database with same CATH topology
2V8QA 2ZFDB 2QRDA 2YA3A 4EAGA 2OOYA 2EHBD 4EAJA 3T4NA 3OSEA 1V5SA 2QRCA 1UL7A 2QREA 2V92A 2OOXA 2Y8LA 4EAKA 4EAIA 4EALA 2QLVA 2Y8QA 4CFFA 2QR1A 3TDHA 2V9JA 3TE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8Q A;  2ZFD B;  2QRD A;  2YA3 A;  4EAG A;  2OOY A;  2EHB D;  4EAJ A;  3T4N A;  3OSE A;  1V5S A;  2QRC A;  1UL7 A;  2QRE A;  2V92 A;  2OOX A;  2Y8L A;  4EAK A;  4EAI A;  4EAL A;  2QLV A;  2Y8Q A;  4CFF A;  2QR1 A;  3TDH A;  2V9J A;  3TE5 A; 
#chains in the Genus database with same CATH topology
 1Q9U A;  2YA3 A;  2FKF A;  5HSH A;  5F9C A;  3RPJ A;  1EUV A;  4ROD B;  1VOK A;  5JN5 A;  3OH9 A;  1TUO A;  2D0B A;  1NVP A;  1P5G X;  2IV9 A;  1VKL A;  2NOF A;  2EHB D;  2O3O A;  3HS8 A;  1T6A A;  1VTO A;  1QN6 A;  3OSE A;  2FKM X;  2QRC A;  1PZD A;  3OST A;  3D7Q A;  4C7P A;  1XSZ A;  4WZS D;  2NOZ A;  2DKD A;  4D7R A;  1MPG A;  1QNE A;  2HL9 A;  2OOX A;  3DPU A;  3I3W A;  3EIK A;  3CW7 A;  2NOB A;  2JPI A;  1KYD A;  3F10 A;  2YH5 A;  2FGT A;  3IH7 A;  2QLV A;  4DUL A;  1TGH A;  4CFF A;  2NOE A;  4WX8 A;  5KL0 A;  2F7L A;  2D0A A;  1WJW A;  3CWT A;  2NLV A;  1KO9 A;  3OC3 C;  3CVS A;  1JFI C;  3PDK A;  1WQA A;  1VTL E;  4EJY A;  2D0C A;  3KRM A;  1QTP A;  1D3U A;  1QNB A;  4ROC B;  2NVM A;  1N3A A;  1M3H A;  1CDW A;  4PY5 A;  1KYF A;  1E42 A;  4WXA A;  2JHN A;  1KFI A;  2IV8 A;  3HS9 A;  1RM1 A;  5IYC P;  4EAJ A;  1LXT A;  5JMV D;  1PVS A;  3I0X A;  1QN7 A;  2NOL A;  1YQR A;  1QNA A;  1LWV A;  1KFQ A;  2JHJ A;  1N3C A;  1TBP A;  3OLP A;  1VOL B;  2NWV A;  3CVT A;  1YQM A;  2MJ7 A;  4EAI A;  2XHI A;  5BMP A;  1W80 A;  2Y8Q A;  5IYD P;  4BJU A;  3OCI A;  1LWW A;  1YQL A;  3I0W A;  3ENO C;  3TE5 A;  1M5Q 1;  1C47 A;  3NA5 A;  1QN9 A;  2NOI A;  2JOI A;  2V8Q A;  1NH2 A;  2QRD A;  1KY7 A;  1FN7 A;  1QN4 A;  1C4G A;  1B9K A;  4I8O A;  1PCZ A;  2HZM A;  4ROE B;  4QG5 A;  4EJZ A;  5AN4 A;  2G30 A;  2H5A X;  3OSM A;  2LAE A;  1QN8 A;  2QRE A;  1K2Y X;  1P5D X;  2V92 A;  1NGM A;  1DIZ A;  1N39 A;  1MP9 A;  1PCM X;  2Y8L A;  1LWY A;  1HU0 A;  4IL8 A;  3C04 A;  3D4V A;  1KY6 A;  1TBA B;  1YQK A;  5IYB P;  1PCJ X;  3ASM A;  3ULX A;  3N89 A;  1QN5 A;  2QR1 A;  3TDH A;  3CWA A;  3CWU A;  1UT4 A;  3VN5 A;  2Z0F A;  2NOH A;  2ZFD B;  1UT7 A;  4MRQ A;  3PMG A;  2DKA A;  1C9B B;  2R5X A;  2DKC A;  3F0Z A;  4HJH A;  5EPC A;  2H4L X;  3UW2 A;  4TPS A;  4D7Q A;  1AIS A;  3CWS A;  2PWW A;  4EAG A;  1QN3 A;  2OOY A;  3EAY A;  2Z8U A;  1M3Q A;  3T4N A;  2FUV A;  1EBM A;  1QNC A;  1V5S A;  1YTB A;  1UL7 A;  3RSM A;  5BMN A;  1JDY A;  4Q11 A;  2VJ0 A;  3H1Z A;  3BKQ X;  1QTS A;  1R4X A;  2MZ8 A;  3OH6 A;  1KYU A;  2HL8 A;  4B0A A;  4EAK A;  4EAL A;  3OGD A;  3ENC A;  3KTU A;  1J3M A;  3SNS A;  2HKP A;  2HZS A;  1YTF A;  3DPT A;  1K35 A;  2V9J A;  2I5W A; 
#chains in the Genus database with same CATH homology
 2V8Q A;  2ZFD B;  2QRD A;  2YA3 A;  4EAG A;  2OOY A;  2EHB D;  4EAJ A;  3T4N A;  3OSE A;  1V5S A;  2QRC A;  1UL7 A;  2QRE A;  2V92 A;  2OOX A;  2Y8L A;  4EAK A;  4EAI A;  4EAL A;  2QLV A;  2Y8Q A;  4CFF A;  2QR1 A;  3TDH A;  2V9J A;  3TE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...