2YA3A

Structure of the regulatory fragment of mammalian ampk in complex with coumarin adp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
156
structure length
102
Chain Sequence
MAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKNSCTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structure of Mammalian Ampk and its Regulation by Adp
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2ya3A01
3TDHA 2V9JA 4EAJA 2QRDA 4EALA 1UL7A 2OOYA 4EAGA 4EAKA 2YA3A 2V8QA 2V92A 1V5SA 4EAIA 2Y8LA 2QREA 2QR1A 3OSEA 2OOXA 2QLVA 2Y8QA 4CFFA 3TE5A 2EHBD 2QRCA 2ZFDB 3T4NA
chains in the Genus database with same CATH superfamily
1KFIA 1TBAB 1YQLA 2PWWA 1LWYA 1UL7A 3I3WA 4QG5A 1VOKA 1KYFA 1QTPA 2V8QA 3CWUA 1C4GA 3UW2A 1TBPA 3ASMA 1KY7A 2V92A 1PCMX 1V5SA 3HS8A 1M3HA 1DIZA 4EAIA 3H1ZA 3OGDA 2D0AA 1QN9A 2QREA 2QR1A 3D7QA 3PDKA 3I0XA 2JOIA 1RM1A 1QN3A 2D0BA 5KL0A 3D4VA 1LWVA 2JHJA 2HKPA 2QLVA 3OSTA 3SNSA 3ULXA 4WZSD 1YQMA 1FN7A 1C47A 1E42A 1KO9A 4B0AA 5JN5A 1QN4A 1UT4A 3T4NA 2NOFA 2O3OA 1PZDA 3CVTA 5BMPA 2Z8UA 1QNEA 4EAGA 4EAKA 2IV8A 2HZMA 2YH5A 1K35A 1HU0A 3DPTA 1QTSA 1LXTA 2NOBA 1R4XA 1P5GX 2HL8A 1YQKA 2XHIA 2NOHA 5F9CA 3BKQX 3DPUA 1QNBA 2R5XA 3EAYA 3C04A 1WQAA 2DKAA 3OSEA 3PMGA 4IL8A 1KYDA 2NOLA 2LAEA 3F10A 2OOXA 1N39A 4WXAA 2Y8QA 4CFFA 1EUVA 3KTUA 4RODB 2NLVA 2G30A 1PCJX 2DKCA 3IH7A 2QRCA 1D3UA 1QNAA 1N3AA 3OH6A 2VJ0A 1KFQA 2JHNA 3KRMA 4WX8A 3TDHA 5AN4A 1KYUA 4DULA 1VTLE 2V9JA 1QN7A 3OC3C 2D0CA 2QRDA 1JFIC 2OOYA 1NGMA 1VOLB 1KY6A 2JPIA 4Q11A 3RPJA 4ROEB 2NOEA 3NA5A 3VN5A 1NH2A 4C7PA 1J3MA 1PVSA 3EIKA 3ENOC 1VKLA 1LWWA 1YTFA 2Y8LA 5IYCP 1TGHA 1XSZA 2FUVA 1WJWA 2HZSA 3I0WA 4D7RA 2FKFA 1MPGA 1MP9A 1Q9UA 2DKDA 4MRQA 1NVPA 2NOZA 5JMVD 2ZFDB 1C9BB 1QN8A 2Z0FA 3OLPA 5HSHA 3OSMA 4PY5A 1M3QA 4EAJA 1QN6A 4EALA 2F7LA 2H4LX 2YA3A 3N89A 2FKMX 5IYDP 1YQRA 3OH9A 1CDWA 2I5WA 4I8OA 2H5AX 1M5Q1 4HJHA 1VTOA 2NOIA 1W80A 1B9KA 3CWTA 1YTBA 1N3CA 2MJ7A 4TPSA 1K2YX 1AISA 1UT7A 5IYBP 3CWAA 1P5DX 1T6AA 1QN5A 4EJZA 1JDYA 5BMNA 5EPCA 2IV9A 2MZ8A 4ROCB 1QNCA 3RSMA 4D7QA 4BJUA 3TE5A 1EBMA 3OCIA 2FGTA 3F0ZA 2HL9A 3HS9A 2EHBD 3CVSA 3CW7A 4EJYA 3ENCA 2NVMA 1PCZA 2NWVA 1TUOA 3CWSA
chains in the Genus database with same CATH topology
3TDHA 2V9JA 4EAJA 2QRDA 4EALA 1UL7A 2OOYA 4EAGA 4EAKA 2YA3A 2V8QA 2V92A 1V5SA 4EAIA 2Y8LA 2QREA 2QR1A 3OSEA 2OOXA 2QLVA 2Y8QA 4CFFA 3TE5A 2EHBD 2QRCA 2ZFDB 3T4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDH A;  2V9J A;  4EAJ A;  2QRD A;  4EAL A;  1UL7 A;  2OOY A;  4EAG A;  4EAK A;  2YA3 A;  2V8Q A;  2V92 A;  1V5S A;  4EAI A;  2Y8L A;  2QRE A;  2QR1 A;  3OSE A;  2OOX A;  2QLV A;  2Y8Q A;  4CFF A;  3TE5 A;  2EHB D;  2QRC A;  2ZFD B;  3T4N A; 
#chains in the Genus database with same CATH topology
 1KFI A;  1TBA B;  1YQL A;  2PWW A;  1LWY A;  1UL7 A;  3I3W A;  4QG5 A;  1VOK A;  1KYF A;  1QTP A;  2V8Q A;  3CWU A;  1C4G A;  3UW2 A;  1TBP A;  3ASM A;  1KY7 A;  2V92 A;  1PCM X;  1V5S A;  3HS8 A;  1M3H A;  1DIZ A;  4EAI A;  3H1Z A;  3OGD A;  2D0A A;  1QN9 A;  2QRE A;  2QR1 A;  3D7Q A;  3PDK A;  3I0X A;  2JOI A;  1RM1 A;  1QN3 A;  2D0B A;  5KL0 A;  3D4V A;  1LWV A;  2JHJ A;  2HKP A;  2QLV A;  3OST A;  3SNS A;  3ULX A;  4WZS D;  1YQM A;  1FN7 A;  1C47 A;  1E42 A;  1KO9 A;  4B0A A;  5JN5 A;  1QN4 A;  1UT4 A;  3T4N A;  2NOF A;  2O3O A;  1PZD A;  3CVT A;  5BMP A;  2Z8U A;  1QNE A;  4EAG A;  4EAK A;  2IV8 A;  2HZM A;  2YH5 A;  1K35 A;  1HU0 A;  3DPT A;  1QTS A;  1LXT A;  2NOB A;  1R4X A;  1P5G X;  2HL8 A;  1YQK A;  2XHI A;  2NOH A;  5F9C A;  3BKQ X;  3DPU A;  1QNB A;  2R5X A;  3EAY A;  3C04 A;  1WQA A;  2DKA A;  3OSE A;  3PMG A;  4IL8 A;  1KYD A;  2NOL A;  2LAE A;  3F10 A;  2OOX A;  1N39 A;  4WXA A;  2Y8Q A;  4CFF A;  1EUV A;  3KTU A;  4ROD B;  2NLV A;  2G30 A;  1PCJ X;  2DKC A;  3IH7 A;  2QRC A;  1D3U A;  1QNA A;  1N3A A;  3OH6 A;  2VJ0 A;  1KFQ A;  2JHN A;  3KRM A;  4WX8 A;  3TDH A;  5AN4 A;  1KYU A;  4DUL A;  1VTL E;  2V9J A;  1QN7 A;  3OC3 C;  2D0C A;  2QRD A;  1JFI C;  2OOY A;  1NGM A;  1VOL B;  1KY6 A;  2JPI A;  4Q11 A;  3RPJ A;  4ROE B;  2NOE A;  3NA5 A;  3VN5 A;  1NH2 A;  4C7P A;  1J3M A;  1PVS A;  3EIK A;  3ENO C;  1VKL A;  1LWW A;  1YTF A;  2Y8L A;  5IYC P;  1TGH A;  1XSZ A;  2FUV A;  1WJW A;  2HZS A;  3I0W A;  4D7R A;  2FKF A;  1MPG A;  1MP9 A;  1Q9U A;  2DKD A;  4MRQ A;  1NVP A;  2NOZ A;  5JMV D;  2ZFD B;  1C9B B;  1QN8 A;  2Z0F A;  3OLP A;  5HSH A;  3OSM A;  4PY5 A;  1M3Q A;  4EAJ A;  1QN6 A;  4EAL A;  2F7L A;  2H4L X;  2YA3 A;  3N89 A;  2FKM X;  5IYD P;  1YQR A;  3OH9 A;  1CDW A;  2I5W A;  4I8O A;  2H5A X;  1M5Q 1;  4HJH A;  1VTO A;  2NOI A;  1W80 A;  1B9K A;  3CWT A;  1YTB A;  1N3C A;  2MJ7 A;  4TPS A;  1K2Y X;  1AIS A;  1UT7 A;  5IYB P;  3CWA A;  1P5D X;  1T6A A;  1QN5 A;  4EJZ A;  1JDY A;  5BMN A;  5EPC A;  2IV9 A;  2MZ8 A;  4ROC B;  1QNC A;  3RSM A;  4D7Q A;  4BJU A;  3TE5 A;  1EBM A;  3OCI A;  2FGT A;  3F0Z A;  2HL9 A;  3HS9 A;  2EHB D;  3CVS A;  3CW7 A;  4EJY A;  3ENC A;  2NVM A;  1PCZ A;  2NWV A;  1TUO A;  3CWS A; 
#chains in the Genus database with same CATH homology
 3TDH A;  2V9J A;  4EAJ A;  2QRD A;  4EAL A;  1UL7 A;  2OOY A;  4EAG A;  4EAK A;  2YA3 A;  2V8Q A;  2V92 A;  1V5S A;  4EAI A;  2Y8L A;  2QRE A;  2QR1 A;  3OSE A;  2OOX A;  2QLV A;  2Y8Q A;  4CFF A;  3TE5 A;  2EHB D;  2QRC A;  2ZFD B;  3T4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...