1TBPA

Crystal structure of yeast tata-binding protein and model for interaction with dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
180
structure length
180
Chain Sequence
MGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TATA-BINDING PROTEIN
publication title Crystal structure of yeast TATA-binding protein and model for interaction with DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Binding protein
total genus 34
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbpA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbpA02
1TBPA 4ROEB 2Z8UA 1PZDA 1QN9A 1QN7A 1PCZA 2D0CA 3HS9A 3VN5A 1NVPA 1QN8A 5IYDP 1QN5A 1RM1A 1TGHA 2D0BA 3HS8A 1B9KA 1E42A 1CDWA 1YTFA 1KY7A 1TBAB 1VTOA 1JFIC 1VTLE 2IV8A 1C9BB 3ASMA 4ROCB 3OC3C 1QNBA 2D0AA 1AISA 1VOLB 1KY6A 2IV9A 1NH2A 4RODB 1QTPA 4WZSD 1QNAA 2MJ7A 1MP9A 1KYFA 1VOKA 1QNCA 2G30A 1KYUA 1W80A 1QTSA 1R4XA 4B0AA 1QNEA 1D3UA 3OCIA 3EIKA 1QN3A 1YTBA 4PY5A 1QN6A 1NGMA 1KYDA 5IYCP 5IYBP 3H1ZA 1QN4A 2VJ0A
chains in the Genus database with same CATH superfamily
1PCMX 5HSHA 4QG5A 1QN7A 3OLPA 2QR1A 3VN5A 5AN4A 3OSMA 1YQRA 1RM1A 3C04A 2Y8QA 1DIZA 2NOLA 3HS8A 2QRCA 3CWUA 2HZSA 2LAEA 1PCJX 2IV8A 3ASMA 2XHIA 3OH6A 1JDYA 2D0AA 3CVTA 3OH9A 3CWTA 4Q11A 4RODB 4CFFA 1QNAA 3DPUA 4D7QA 4D7RA 1HU0A 1KYFA 1MPGA 2H4LX 1EBMA 2V92A 1QNCA 3TE5A 2NOIA 3OSEA 4EAKA 3D7QA 4EAJA 3EIKA 1XSZA 2V9JA 1LWVA 3RPJA 1J3MA 2PWWA 1Q9UA 2YA3A 3CVSA 1N39A 1M3HA 1QN4A 5BMNA 1TBPA 1WJWA 2HL8A 3SNSA 2D0CA 1PVSA 3OGDA 3HS9A 3ENCA 1NVPA 3RSMA 3PMGA 3T4NA 1K35A 2FKMX 4WX8A 2D0BA 3PDKA 4EAIA 2V8QA 3EAYA 1CDWA 1YTFA 2NOZA 2F7LA 1VTOA 1V5SA 4TPSA 1YQLA 2JHNA 1JFIC 4ROCB 3OC3C 1FN7A 1AISA 1QNBA 2NOBA 1LXTA 1N3CA 1MP9A 1VOKA 2G30A 2DKCA 4I8OA 4B0AA 1UT7A 1VKLA 5KL0A 3UW2A 1KFIA 2HKPA 3KRMA 3I0WA 2EHBD 2OOYA 1NGMA 2OOXA 3DPTA 5JN5A 5IYCP 5JMVD 2VJ0A 3I0XA 1KO9A 2Z8UA 1C4GA 2NOFA 4C7PA 1QN8A 2O3OA 2FUVA 2QLVA 3KTUA 3OSTA 3NA5A 4EJYA 3BKQX 1M3QA 1TBAB 1P5DX 1C9BB 1VTLE 2JPIA 1KY6A 2FKFA 1NH2A 2NLVA 1WQAA 4EALA 1TUOA 4BJUA 2Y8LA 4HJHA 1KYUA 1W80A 3ULXA 2NVMA 1D3UA 3OCIA 4PY5A 1QN6A 3ENOC 2FGTA 1T6AA 2H5AX 2HZMA 2QRDA 3F0ZA 1KYDA 3I3WA 3F10A 5IYBP 2DKDA 3H1ZA 4DULA 2NWVA 2HL9A 1M5Q1 4ROEB 4EJZA 1QN9A 1PZDA 1PCZA 5IYDP 2Z0FA 1QN5A 1YQMA 4WXAA 1TGHA 5F9CA 1YQKA 2ZFDB 2NOEA 1B9KA 1E42A 2JHJA 1KY7A 1UT4A 2YH5A 1EUVA 5BMPA 1VOLB 2IV9A 3IH7A 1P5GX 1QTPA 2JOIA 4WZSD 1N3AA 2MJ7A 4IL8A 3CWAA 3D4VA 2DKAA 2I5WA 3TDHA 4MRQA 1KFQA 3CWSA 1C47A 2MZ8A 3CW7A 1QTSA 1R4XA 4EAGA 1QNEA 1QN3A 1YTBA 3N89A 2NOHA 2R5XA 5EPCA 1UL7A 2QREA 1LWYA 1K2YX 1LWWA
chains in the Genus database with same CATH topology
1QN7A 3VN5A 5AN4A 3OSMA 1YQRA 1RM1A 2NOLA 3HS8A 2HZSA 2LAEA 2IV8A 3ASMA 2XHIA 2D0AA 4Q11A 4RODB 1QNAA 3DPUA 1HU0A 1KYFA 1EBMA 1QNCA 2NOIA 3EIKA 1LWVA 3RPJA 1N39A 1M3HA 1QN4A 1TBPA 3SNSA 2D0CA 3HS9A 1NVPA 2D0BA 2NOZA 1CDWA 1VTOA 4TPSA 1JFIC 1YQLA 1QNBA 1YTFA 4ROCB 3OC3C 1FN7A 1AISA 2NOBA 1N3CA 1MP9A 1VOKA 2G30A 4I8OA 4B0AA 1UT7A 3KRMA 3I0WA 1NGMA 5IYCP 3DPTA 2VJ0A 3I0XA 1KO9A 2Z8UA 2NOFA 1QN8A 2O3OA 3KTUA 3OSTA 4EJYA 1M3QA 1TBAB 1C9BB 1VTLE 1KY6A 1NH2A 1KYUA 1W80A 3ULXA 1D3UA 3OCIA 4PY5A 1QN6A 2FGTA 3F0ZA 2HZMA 1KYDA 5IYBP 3F10A 4DULA 3H1ZA 4ROEB 4EJZA 1QN9A 1PZDA 1PCZA 5IYDP 1QN5A 1YQMA 1TGHA 1YQKA 2NOEA 1B9KA 1E42A 1KY7A 1UT4A 2YH5A 1VOLB 2IV9A 3IH7A 1QTPA 2JOIA 4WZSD 1N3AA 2MJ7A 2I5WA 2MZ8A 1QTSA 1R4XA 1QNEA 1QN3A 1YTBA 3N89A 2NOHA 1LWYA 1LWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBP A;  4ROE B;  2Z8U A;  1PZD A;  1QN9 A;  1QN7 A;  1PCZ A;  2D0C A;  3HS9 A;  3VN5 A;  1NVP A;  1QN8 A;  5IYD P;  1QN5 A;  1RM1 A;  1TGH A;  2D0B A;  3HS8 A;  1B9K A;  1E42 A;  1CDW A;  1YTF A;  1KY7 A;  1TBA B;  1VTO A;  1JFI C;  1VTL E;  2IV8 A;  1C9B B;  3ASM A;  4ROC B;  3OC3 C;  1QNB A;  2D0A A;  1AIS A;  1VOL B;  1KY6 A;  2IV9 A;  1NH2 A;  4ROD B;  1QTP A;  4WZS D;  1QNA A;  2MJ7 A;  1MP9 A;  1KYF A;  1VOK A;  1QNC A;  2G30 A;  1KYU A;  1W80 A;  1QTS A;  1R4X A;  4B0A A;  1QNE A;  1D3U A;  3OCI A;  3EIK A;  1QN3 A;  1YTB A;  4PY5 A;  1QN6 A;  1NGM A;  1KYD A;  5IYC P;  5IYB P;  3H1Z A;  1QN4 A;  2VJ0 A; 
#chains in the Genus database with same CATH topology
 1PCM X;  5HSH A;  4QG5 A;  1QN7 A;  3OLP A;  2QR1 A;  3VN5 A;  5AN4 A;  3OSM A;  1YQR A;  1RM1 A;  3C04 A;  2Y8Q A;  1DIZ A;  2NOL A;  3HS8 A;  2QRC A;  3CWU A;  2HZS A;  2LAE A;  1PCJ X;  2IV8 A;  3ASM A;  2XHI A;  3OH6 A;  1JDY A;  2D0A A;  3CVT A;  3OH9 A;  3CWT A;  4Q11 A;  4ROD B;  4CFF A;  1QNA A;  3DPU A;  4D7Q A;  4D7R A;  1HU0 A;  1KYF A;  1MPG A;  2H4L X;  1EBM A;  2V92 A;  1QNC A;  3TE5 A;  2NOI A;  3OSE A;  4EAK A;  3D7Q A;  4EAJ A;  3EIK A;  1XSZ A;  2V9J A;  1LWV A;  3RPJ A;  1J3M A;  2PWW A;  1Q9U A;  2YA3 A;  3CVS A;  1N39 A;  1M3H A;  1QN4 A;  5BMN A;  1TBP A;  1WJW A;  2HL8 A;  3SNS A;  2D0C A;  1PVS A;  3OGD A;  3HS9 A;  3ENC A;  1NVP A;  3RSM A;  3PMG A;  3T4N A;  1K35 A;  2FKM X;  4WX8 A;  2D0B A;  3PDK A;  4EAI A;  2V8Q A;  3EAY A;  1CDW A;  1YTF A;  2NOZ A;  2F7L A;  1VTO A;  1V5S A;  4TPS A;  1YQL A;  2JHN A;  1JFI C;  4ROC B;  3OC3 C;  1FN7 A;  1AIS A;  1QNB A;  2NOB A;  1LXT A;  1N3C A;  1MP9 A;  1VOK A;  2G30 A;  2DKC A;  4I8O A;  4B0A A;  1UT7 A;  1VKL A;  5KL0 A;  3UW2 A;  1KFI A;  2HKP A;  3KRM A;  3I0W A;  2EHB D;  2OOY A;  1NGM A;  2OOX A;  3DPT A;  5JN5 A;  5IYC P;  5JMV D;  2VJ0 A;  3I0X A;  1KO9 A;  2Z8U A;  1C4G A;  2NOF A;  4C7P A;  1QN8 A;  2O3O A;  2FUV A;  2QLV A;  3KTU A;  3OST A;  3NA5 A;  4EJY A;  3BKQ X;  1M3Q A;  1TBA B;  1P5D X;  1C9B B;  1VTL E;  2JPI A;  1KY6 A;  2FKF A;  1NH2 A;  2NLV A;  1WQA A;  4EAL A;  1TUO A;  4BJU A;  2Y8L A;  4HJH A;  1KYU A;  1W80 A;  3ULX A;  2NVM A;  1D3U A;  3OCI A;  4PY5 A;  1QN6 A;  3ENO C;  2FGT A;  1T6A A;  2H5A X;  2HZM A;  2QRD A;  3F0Z A;  1KYD A;  3I3W A;  3F10 A;  5IYB P;  2DKD A;  3H1Z A;  4DUL A;  2NWV A;  2HL9 A;  1M5Q 1;  4ROE B;  4EJZ A;  1QN9 A;  1PZD A;  1PCZ A;  5IYD P;  2Z0F A;  1QN5 A;  1YQM A;  4WXA A;  1TGH A;  5F9C A;  1YQK A;  2ZFD B;  2NOE A;  1B9K A;  1E42 A;  2JHJ A;  1KY7 A;  1UT4 A;  2YH5 A;  1EUV A;  5BMP A;  1VOL B;  2IV9 A;  3IH7 A;  1P5G X;  1QTP A;  2JOI A;  4WZS D;  1N3A A;  2MJ7 A;  4IL8 A;  3CWA A;  3D4V A;  2DKA A;  2I5W A;  3TDH A;  4MRQ A;  1KFQ A;  3CWS A;  1C47 A;  2MZ8 A;  3CW7 A;  1QTS A;  1R4X A;  4EAG A;  1QNE A;  1QN3 A;  1YTB A;  3N89 A;  2NOH A;  2R5X A;  5EPC A;  1UL7 A;  2QRE A;  1LWY A;  1K2Y X;  1LWW A; 
#chains in the Genus database with same CATH homology
 1QN7 A;  3VN5 A;  5AN4 A;  3OSM A;  1YQR A;  1RM1 A;  2NOL A;  3HS8 A;  2HZS A;  2LAE A;  2IV8 A;  3ASM A;  2XHI A;  2D0A A;  4Q11 A;  4ROD B;  1QNA A;  3DPU A;  1HU0 A;  1KYF A;  1EBM A;  1QNC A;  2NOI A;  3EIK A;  1LWV A;  3RPJ A;  1N39 A;  1M3H A;  1QN4 A;  1TBP A;  3SNS A;  2D0C A;  3HS9 A;  1NVP A;  2D0B A;  2NOZ A;  1CDW A;  1VTO A;  4TPS A;  1JFI C;  1YQL A;  1QNB A;  1YTF A;  4ROC B;  3OC3 C;  1FN7 A;  1AIS A;  2NOB A;  1N3C A;  1MP9 A;  1VOK A;  2G30 A;  4I8O A;  4B0A A;  1UT7 A;  3KRM A;  3I0W A;  1NGM A;  5IYC P;  3DPT A;  2VJ0 A;  3I0X A;  1KO9 A;  2Z8U A;  2NOF A;  1QN8 A;  2O3O A;  3KTU A;  3OST A;  4EJY A;  1M3Q A;  1TBA B;  1C9B B;  1VTL E;  1KY6 A;  1NH2 A;  1KYU A;  1W80 A;  3ULX A;  1D3U A;  3OCI A;  4PY5 A;  1QN6 A;  2FGT A;  3F0Z A;  2HZM A;  1KYD A;  5IYB P;  3F10 A;  4DUL A;  3H1Z A;  4ROE B;  4EJZ A;  1QN9 A;  1PZD A;  1PCZ A;  5IYD P;  1QN5 A;  1YQM A;  1TGH A;  1YQK A;  2NOE A;  1B9K A;  1E42 A;  1KY7 A;  1UT4 A;  2YH5 A;  1VOL B;  2IV9 A;  3IH7 A;  1QTP A;  2JOI A;  4WZS D;  1N3A A;  2MJ7 A;  2I5W A;  2MZ8 A;  1QTS A;  1R4X A;  1QNE A;  1QN3 A;  1YTB A;  3N89 A;  2NOH A;  1LWY A;  1LWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...