1TBPA

Crystal structure of yeast tata-binding protein and model for interaction with dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
180
structure length
180
Chain Sequence
MGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords TATA-BINDING PROTEIN
publication title Crystal structure of yeast TATA-binding protein and model for interaction with DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbpA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbpA02
1QN5A 5IYDP 2VJ0A 1QN9A 1VOKA 1QNAA 1NVPA 1VOLB 3VN5A 3OC3C 1KYUA 1VTLE 1QN6A 3HS8A 4RODB 1QNEA 1C9BB 1TGHA 1QN7A 4ROCB 4ROEB 1QNCA 5IYBP 3ASMA 1D3UA 1RM1A 2D0CA 3HS9A 4B0AA 1E42A 1QTSA 1QN4A 3EIKA 4PY5A 1QN8A 1KY7A 1AISA 1CDWA 3OCIA 1R4XA 1KY6A 1KYFA 2Z8UA 2IV9A 1VTOA 1NH2A 2D0BA 1YTFA 1NGMA 1KYDA 1PZDA 1QNBA 1QTPA 1YTBA 3H1ZA 2IV8A 1JFIC 1MP9A 2MJ7A 4WZSD 2G30A 5IYCP 1TBPA 1PCZA 1QN3A 2D0AA 1TBAB 1W80A 1B9KA
chains in the Genus database with same CATH superfamily
3PDKA 3ENOC 4D7RA 2V9JA 3ENCA 3F10A 1LXTA 1N39A 1NVPA 2ZFDB 2F7LA 3ULXA 1VTLE 4RODB 1QNEA 1KFIA 4ROCB 4ROEB 3OGDA 1QN7A 3DPTA 3CW7A 3RPJA 2QRDA 3HS9A 4B0AA 3TDHA 2PWWA 3OCIA 2NOLA 1R4XA 1KYFA 1MPGA 4WXAA 4C7PA 3CVSA 1WJWA 4TPSA 1MP9A 5F9CA 3NA5A 3OLPA 4QG5A 2G30A 3D7QA 2NVMA 1TBPA 1QN3A 2NOHA 1C47A 1B9KA 2HL9A 5KL0A 1QN9A 1QNAA 2O3OA 3CWTA 1J3MA 2FKFA 1HU0A 2JOIA 3KRMA 2LAEA 2V8QA 1TGHA 5IYBP 2DKAA 5BMPA 1KO9A 1E42A 1VKLA 1UT4A 3EIKA 1JDYA 1T6AA 2NOIA 2MZ8A 3C04A 3BKQX 5AN4A 3RSMA 1VTOA 1KFQA 1M5Q1 3SNSA 2D0BA 4CFFA 1YTFA 5JMVD 4BJUA 1QNBA 3I0WA 1QTPA 4WX8A 4D7QA 1UL7A 2FUVA 3CWUA 2FKMX 4EAKA 3OSEA 2MJ7A 3D4VA 2H4LX 1TUOA 4IL8A 5JN5A 3CWAA 1C4GA 3TE5A 1M3QA 1TBAB 1P5GX 1W80A 2NLVA 5IYDP 1EBMA 2VJ0A 1VOKA 1WQAA 2HZMA 1VOLB 2NOZA 1LWYA 1P5DX 2OOYA 3DPUA 3PMGA 3ASMA 1D3UA 2JPIA 1QTSA 2I5WA 2Y8LA 2QLVA 3OH9A 1QN8A 3UW2A 2DKDA 1CDWA 4PY5A 2JHJA 3OSMA 1KY6A 2Z8UA 2Z0FA 2H5AX 2JHNA 3N89A 4EAGA 1YQKA 2HL8A 1NGMA 1KYDA 1PZDA 2NOBA 1JFIC 3CVTA 1EUVA 2YH5A 4EAIA 3KTUA 2HKPA 1V5SA 3F0ZA 5IYCP 3I3WA 2YA3A 2R5XA 2NWVA 1QN5A 2V92A 4MRQA 1PVSA 3T4NA 1LWVA 3IH7A 3VN5A 3OC3C 1KYUA 3I0XA 1YQMA 1QN6A 3HS8A 3CWSA 1PCMX 4EAJA 1C9BB 3OSTA 2QR1A 5HSHA 1K2YX 5EPCA 1QNCA 1DIZA 1RM1A 2D0CA 2QRCA 4Q11A 1QN4A 2NOEA 1K35A 2Y8QA 4DULA 3EAYA 1KY7A 2FGTA 2OOXA 1AISA 4EJYA 4EJZA 2EHBD 4I8OA 1YQRA 2NOFA 2IV9A 2XHIA 1NH2A 1Q9UA 1LWWA 4EALA 2QREA 1XSZA 1YTBA 3H1ZA 2IV8A 1M3HA 5BMNA 2DKCA 1N3CA 2HZSA 1N3AA 4WZSD 1FN7A 4HJHA 1PCZA 3OH6A 2D0AA 1PCJX 1YQLA 1UT7A
chains in the Genus database with same CATH topology
3F10A 1N39A 1NVPA 3ULXA 4RODB 1QNEA 1QN7A 4ROCB 4ROEB 3DPTA 3RPJA 3HS9A 4B0AA 3OCIA 2NOLA 1R4XA 1KYFA 4TPSA 1MP9A 2G30A 1TBPA 1QN3A 2NOHA 1B9KA 1QN9A 1QNAA 2O3OA 1HU0A 2JOIA 3KRMA 2LAEA 1TGHA 5IYBP 1KO9A 1E42A 1UT4A 3EIKA 2NOIA 2MZ8A 5AN4A 1VTOA 3SNSA 2D0BA 1YTFA 1QNBA 3I0WA 1QTPA 2MJ7A 1M3QA 1TBAB 1W80A 5IYDP 1EBMA 2VJ0A 1VOKA 2HZMA 1VOLB 2NOZA 1LWYA 3ASMA 1D3UA 1QTSA 2I5WA 4PY5A 1QN8A 1CDWA 3OSMA 1KY6A 2Z8UA 3N89A 1YQKA 1NGMA 1KYDA 1PZDA 2NOBA 1JFIC 2YH5A 3KTUA 3F0ZA 5IYCP 1UT7A 1QN5A 1LWVA 3IH7A 3VN5A 3OC3C 1KYUA 3I0XA 1YQMA 1QN6A 3HS8A 1C9BB 3OSTA 1QNCA 1RM1A 2D0CA 1QN4A 4Q11A 2NOEA 4DULA 4EJZA 1KY7A 2FGTA 1AISA 4EJYA 2NOFA 4I8OA 1YQRA 2IV9A 2XHIA 1NH2A 1LWWA 1YTBA 3H1ZA 2IV8A 1M3HA 1N3CA 2HZSA 1N3AA 4WZSD 1FN7A 1PCZA 2D0AA 3DPUA 1YQLA 1VTLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QN5 A;  5IYD P;  2VJ0 A;  1QN9 A;  1VOK A;  1QNA A;  1NVP A;  1VOL B;  3VN5 A;  3OC3 C;  1KYU A;  1VTL E;  1QN6 A;  3HS8 A;  4ROD B;  1QNE A;  1C9B B;  1TGH A;  1QN7 A;  4ROC B;  4ROE B;  1QNC A;  5IYB P;  3ASM A;  1D3U A;  1RM1 A;  2D0C A;  3HS9 A;  4B0A A;  1E42 A;  1QTS A;  1QN4 A;  3EIK A;  4PY5 A;  1QN8 A;  1KY7 A;  1AIS A;  1CDW A;  3OCI A;  1R4X A;  1KY6 A;  1KYF A;  2Z8U A;  2IV9 A;  1VTO A;  1NH2 A;  2D0B A;  1YTF A;  1NGM A;  1KYD A;  1PZD A;  1QNB A;  1QTP A;  1YTB A;  3H1Z A;  2IV8 A;  1JFI C;  1MP9 A;  2MJ7 A;  4WZS D;  2G30 A;  5IYC P;  1TBP A;  1PCZ A;  1QN3 A;  2D0A A;  1TBA B;  1W80 A;  1B9K A; 
#chains in the Genus database with same CATH topology
 3PDK A;  3ENO C;  4D7R A;  2V9J A;  3ENC A;  3F10 A;  1LXT A;  1N39 A;  1NVP A;  2ZFD B;  2F7L A;  3ULX A;  1VTL E;  4ROD B;  1QNE A;  1KFI A;  4ROC B;  4ROE B;  3OGD A;  1QN7 A;  3DPT A;  3CW7 A;  3RPJ A;  2QRD A;  3HS9 A;  4B0A A;  3TDH A;  2PWW A;  3OCI A;  2NOL A;  1R4X A;  1KYF A;  1MPG A;  4WXA A;  4C7P A;  3CVS A;  1WJW A;  4TPS A;  1MP9 A;  5F9C A;  3NA5 A;  3OLP A;  4QG5 A;  2G30 A;  3D7Q A;  2NVM A;  1TBP A;  1QN3 A;  2NOH A;  1C47 A;  1B9K A;  2HL9 A;  5KL0 A;  1QN9 A;  1QNA A;  2O3O A;  3CWT A;  1J3M A;  2FKF A;  1HU0 A;  2JOI A;  3KRM A;  2LAE A;  2V8Q A;  1TGH A;  5IYB P;  2DKA A;  5BMP A;  1KO9 A;  1E42 A;  1VKL A;  1UT4 A;  3EIK A;  1JDY A;  1T6A A;  2NOI A;  2MZ8 A;  3C04 A;  3BKQ X;  5AN4 A;  3RSM A;  1VTO A;  1KFQ A;  1M5Q 1;  3SNS A;  2D0B A;  4CFF A;  1YTF A;  5JMV D;  4BJU A;  1QNB A;  3I0W A;  1QTP A;  4WX8 A;  4D7Q A;  1UL7 A;  2FUV A;  3CWU A;  2FKM X;  4EAK A;  3OSE A;  2MJ7 A;  3D4V A;  2H4L X;  1TUO A;  4IL8 A;  5JN5 A;  3CWA A;  1C4G A;  3TE5 A;  1M3Q A;  1TBA B;  1P5G X;  1W80 A;  2NLV A;  5IYD P;  1EBM A;  2VJ0 A;  1VOK A;  1WQA A;  2HZM A;  1VOL B;  2NOZ A;  1LWY A;  1P5D X;  2OOY A;  3DPU A;  3PMG A;  3ASM A;  1D3U A;  2JPI A;  1QTS A;  2I5W A;  2Y8L A;  2QLV A;  3OH9 A;  1QN8 A;  3UW2 A;  2DKD A;  1CDW A;  4PY5 A;  2JHJ A;  3OSM A;  1KY6 A;  2Z8U A;  2Z0F A;  2H5A X;  2JHN A;  3N89 A;  4EAG A;  1YQK A;  2HL8 A;  1NGM A;  1KYD A;  1PZD A;  2NOB A;  1JFI C;  3CVT A;  1EUV A;  2YH5 A;  4EAI A;  3KTU A;  2HKP A;  1V5S A;  3F0Z A;  5IYC P;  3I3W A;  2YA3 A;  2R5X A;  2NWV A;  1QN5 A;  2V92 A;  4MRQ A;  1PVS A;  3T4N A;  1LWV A;  3IH7 A;  3VN5 A;  3OC3 C;  1KYU A;  3I0X A;  1YQM A;  1QN6 A;  3HS8 A;  3CWS A;  1PCM X;  4EAJ A;  1C9B B;  3OST A;  2QR1 A;  5HSH A;  1K2Y X;  5EPC A;  1QNC A;  1DIZ A;  1RM1 A;  2D0C A;  2QRC A;  4Q11 A;  1QN4 A;  2NOE A;  1K35 A;  2Y8Q A;  4DUL A;  3EAY A;  1KY7 A;  2FGT A;  2OOX A;  1AIS A;  4EJY A;  4EJZ A;  2EHB D;  4I8O A;  1YQR A;  2NOF A;  2IV9 A;  2XHI A;  1NH2 A;  1Q9U A;  1LWW A;  4EAL A;  2QRE A;  1XSZ A;  1YTB A;  3H1Z A;  2IV8 A;  1M3H A;  5BMN A;  2DKC A;  1N3C A;  2HZS A;  1N3A A;  4WZS D;  1FN7 A;  4HJH A;  1PCZ A;  3OH6 A;  2D0A A;  1PCJ X;  1YQL A;  1UT7 A; 
#chains in the Genus database with same CATH homology
 3F10 A;  1N39 A;  1NVP A;  3ULX A;  4ROD B;  1QNE A;  1QN7 A;  4ROC B;  4ROE B;  3DPT A;  3RPJ A;  3HS9 A;  4B0A A;  3OCI A;  2NOL A;  1R4X A;  1KYF A;  4TPS A;  1MP9 A;  2G30 A;  1TBP A;  1QN3 A;  2NOH A;  1B9K A;  1QN9 A;  1QNA A;  2O3O A;  1HU0 A;  2JOI A;  3KRM A;  2LAE A;  1TGH A;  5IYB P;  1KO9 A;  1E42 A;  1UT4 A;  3EIK A;  2NOI A;  2MZ8 A;  5AN4 A;  1VTO A;  3SNS A;  2D0B A;  1YTF A;  1QNB A;  3I0W A;  1QTP A;  2MJ7 A;  1M3Q A;  1TBA B;  1W80 A;  5IYD P;  1EBM A;  2VJ0 A;  1VOK A;  2HZM A;  1VOL B;  2NOZ A;  1LWY A;  3ASM A;  1D3U A;  1QTS A;  2I5W A;  4PY5 A;  1QN8 A;  1CDW A;  3OSM A;  1KY6 A;  2Z8U A;  3N89 A;  1YQK A;  1NGM A;  1KYD A;  1PZD A;  2NOB A;  1JFI C;  2YH5 A;  3KTU A;  3F0Z A;  5IYC P;  1UT7 A;  1QN5 A;  1LWV A;  3IH7 A;  3VN5 A;  3OC3 C;  1KYU A;  3I0X A;  1YQM A;  1QN6 A;  3HS8 A;  1C9B B;  3OST A;  1QNC A;  1RM1 A;  2D0C A;  1QN4 A;  4Q11 A;  2NOE A;  4DUL A;  4EJZ A;  1KY7 A;  2FGT A;  1AIS A;  4EJY A;  2NOF A;  4I8O A;  1YQR A;  2IV9 A;  2XHI A;  1NH2 A;  1LWW A;  1YTB A;  3H1Z A;  2IV8 A;  1M3H A;  1N3C A;  2HZS A;  1N3A A;  4WZS D;  1FN7 A;  1PCZ A;  2D0A A;  3DPU A;  1YQL A;  1VTL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...