3ULXA

Crystal structural of the conserved domain of rice stress-responsive nac1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
162
structure length
146
Chain Sequence
AEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPIIAEVDLYKFDPWDLPERALFGAREWYFFTPRDRSRPNRAAGNGYWKATGADKPVAPRGRTLGIKKALVFYAGKAPRGVKTDWIMHEYRLADAGRLDDWVLCRLYNKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Stress-induced transcription factor NAC1
publication title A structural view of the conserved domain of Rice Stress-responsive NAC1
rcsb
source organism Oryza sativa subsp. japonica
total genus 28
structure length 146
sequence length 162
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02365 NAM No apical meristem (NAM) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.150 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3ulxA01
4DULA 1UT4A 1UT7A 3ULXA
chains in the Genus database with same CATH superfamily
2Y8QA 1TGHA 1K2YX 2G30A 2QRCA 4B0AA 1QTPA 1N3CA 1KO9A 2R5XA 4ROCB 4DULA 2V92A 2MJ7A 4I8OA 2YH5A 3OSMA 2XHIA 2QREA 1QN3A 2FKMX 4IL8A 1KYDA 3TE5A 3UW2A 1DIZA 2ZFDB 4QG5A 1M3HA 3I0WA 3CVTA 5F9CA 2PWWA 3D4VA 1VTLE 2D0BA 4WX8A 4EALA 1HU0A 1QN5A 2JOIA 2YA3A 1QNAA 1YTFA 1MP9A 3OC3C 3I0XA 1QNEA 1J3MA 3NA5A 1YQKA 2H5AX 1W80A 2FKFA 2NWVA 4TPSA 3EAYA 4EAJA 1AISA 5IYDP 3SNSA 2JHJA 1VTOA 2D0CA 2NOFA 1TBAB 1VOLB 1PCZA 1PVSA 1LXTA 2Z8UA 3PMGA 5EPCA 3DPTA 1QN8A 1TUOA 1E42A 2JHNA 2LAEA 3D7QA 2FUVA 1KFQA 3OCIA 1QN7A 1P5DX 1KY6A 3ULXA 2F7LA 4D7RA 3OGDA 1C4GA 4CFFA 1XSZA 4RODB 5AN4A 2NOEA 1M5Q1 3T4NA 2MZ8A 3C04A 2NOBA 5IYBP 1Q9UA 1QNBA 2NOIA 3ASMA 4MRQA 1QN4A 2FGTA 3EIKA 2HL9A 2HL8A 3CWAA 4EAGA 1K35A 2HZMA 3ENCA 1QN9A 2OOXA 3RSMA 1YQMA 2NOZA 3ENOC 2EHBD 2NLVA 1B9KA 3HS9A 2O3OA 4D7QA 2QRDA 3RPJA 3H1ZA 4PY5A 2DKAA 1NVPA 5HSHA 1LWWA 4EJYA 1C47A 3CWTA 2IV9A 2I5WA 5BMPA 3TDHA 1KYUA 1CDWA 1V5SA 2HKPA 1UT7A 2DKCA 2QR1A 4EAKA 1UT4A 2Y8LA 1PCMX 1YTBA 4WXAA 4EAIA 1PZDA 2OOYA 3BKQX 1PCJX 5BMNA 1LWVA 4EJZA 1N3AA 1TBPA 3CWSA 2Z0FA 4HJHA 2NOLA 3VN5A 1WQAA 4WZSD 3F10A 3OSTA 5JMVD 1NH2A 1KYFA 1EBMA 1JFIC 2VJ0A 3HS8A 4C7PA 2NOHA 1JDYA 1UL7A 1C9BB 1MPGA 4ROEB 1QNCA 1QTSA 1KY7A 2IV8A 3CVSA 5IYCP 3DPUA 3F0ZA 1N39A 3I3WA 3OH9A 3CW7A 1WJWA 1EUVA 1R4XA 1VKLA 1YQLA 1RM1A 3IH7A 1T6AA 2D0AA 3OH6A 4Q11A 2NVMA 2V9JA 3KTUA 1FN7A 3OSEA 1KFIA 1VOKA 2DKDA 1LWYA 2JPIA 2H4LX 3CWUA 1NGMA 1QN6A 3N89A 1P5GX 2HZSA 3PDKA 1D3UA 1M3QA 4BJUA 2V8QA 1YQRA 5JN5A 3OLPA 5KL0A 3KRMA 2QLVA
chains in the Genus database with same CATH topology
1TGHA 2G30A 4B0AA 1QTPA 1N3CA 1KO9A 4ROCB 4DULA 2MJ7A 4I8OA 2YH5A 3OSMA 2XHIA 1QN3A 1KYDA 1M3HA 3I0WA 1VTLE 2D0BA 1HU0A 1QN5A 2JOIA 1QNAA 1YTFA 1MP9A 3OC3C 3I0XA 1QNEA 1YQKA 1W80A 4TPSA 1AISA 5IYDP 3SNSA 1VTOA 2D0CA 2NOFA 1TBAB 1VOLB 1PCZA 2Z8UA 3DPTA 1QN8A 1E42A 2LAEA 3OCIA 1QN7A 1KY6A 3ULXA 4RODB 5AN4A 2NOEA 2MZ8A 2NOBA 5IYBP 1QNBA 2NOIA 3ASMA 1QN4A 2FGTA 3EIKA 2HZMA 1QN9A 1YQMA 2NOZA 3HS9A 1B9KA 2O3OA 3RPJA 3H1ZA 4PY5A 1NVPA 4EJYA 1LWWA 2IV9A 2I5WA 1KYUA 1CDWA 1UT7A 1UT4A 1YTBA 1PZDA 1LWVA 4EJZA 1N3AA 1TBPA 2NOLA 3VN5A 4WZSD 3F10A 3OSTA 1NH2A 1KYFA 1EBMA 1JFIC 2VJ0A 3HS8A 2NOHA 1C9BB 4ROEB 1QNCA 1QTSA 1KY7A 2IV8A 5IYCP 3DPUA 3F0ZA 1N39A 1R4XA 1YQLA 3IH7A 2D0AA 4Q11A 1FN7A 3KTUA 1VOKA 1LWYA 1NGMA 1QN6A 3N89A 2HZSA 1D3UA 1M3QA 1YQRA 3KRMA 1RM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUL A;  1UT4 A;  1UT7 A;  3ULX A; 
#chains in the Genus database with same CATH topology
 2Y8Q A;  1TGH A;  1K2Y X;  2G30 A;  2QRC A;  4B0A A;  1QTP A;  1N3C A;  1KO9 A;  2R5X A;  4ROC B;  4DUL A;  2V92 A;  2MJ7 A;  4I8O A;  2YH5 A;  3OSM A;  2XHI A;  2QRE A;  1QN3 A;  2FKM X;  4IL8 A;  1KYD A;  3TE5 A;  3UW2 A;  1DIZ A;  2ZFD B;  4QG5 A;  1M3H A;  3I0W A;  3CVT A;  5F9C A;  2PWW A;  3D4V A;  1VTL E;  2D0B A;  4WX8 A;  4EAL A;  1HU0 A;  1QN5 A;  2JOI A;  2YA3 A;  1QNA A;  1YTF A;  1MP9 A;  3OC3 C;  3I0X A;  1QNE A;  1J3M A;  3NA5 A;  1YQK A;  2H5A X;  1W80 A;  2FKF A;  2NWV A;  4TPS A;  3EAY A;  4EAJ A;  1AIS A;  5IYD P;  3SNS A;  2JHJ A;  1VTO A;  2D0C A;  2NOF A;  1TBA B;  1VOL B;  1PCZ A;  1PVS A;  1LXT A;  2Z8U A;  3PMG A;  5EPC A;  3DPT A;  1QN8 A;  1TUO A;  1E42 A;  2JHN A;  2LAE A;  3D7Q A;  2FUV A;  1KFQ A;  3OCI A;  1QN7 A;  1P5D X;  1KY6 A;  3ULX A;  2F7L A;  4D7R A;  3OGD A;  1C4G A;  4CFF A;  1XSZ A;  4ROD B;  5AN4 A;  2NOE A;  1M5Q 1;  3T4N A;  2MZ8 A;  3C04 A;  2NOB A;  5IYB P;  1Q9U A;  1QNB A;  2NOI A;  3ASM A;  4MRQ A;  1QN4 A;  2FGT A;  3EIK A;  2HL9 A;  2HL8 A;  3CWA A;  4EAG A;  1K35 A;  2HZM A;  3ENC A;  1QN9 A;  2OOX A;  3RSM A;  1YQM A;  2NOZ A;  3ENO C;  2EHB D;  2NLV A;  1B9K A;  3HS9 A;  2O3O A;  4D7Q A;  2QRD A;  3RPJ A;  3H1Z A;  4PY5 A;  2DKA A;  1NVP A;  5HSH A;  1LWW A;  4EJY A;  1C47 A;  3CWT A;  2IV9 A;  2I5W A;  5BMP A;  3TDH A;  1KYU A;  1CDW A;  1V5S A;  2HKP A;  1UT7 A;  2DKC A;  2QR1 A;  4EAK A;  1UT4 A;  2Y8L A;  1PCM X;  1YTB A;  4WXA A;  4EAI A;  1PZD A;  2OOY A;  3BKQ X;  1PCJ X;  5BMN A;  1LWV A;  4EJZ A;  1N3A A;  1TBP A;  3CWS A;  2Z0F A;  4HJH A;  2NOL A;  3VN5 A;  1WQA A;  4WZS D;  3F10 A;  3OST A;  5JMV D;  1NH2 A;  1KYF A;  1EBM A;  1JFI C;  2VJ0 A;  3HS8 A;  4C7P A;  2NOH A;  1JDY A;  1UL7 A;  1C9B B;  1MPG A;  4ROE B;  1QNC A;  1QTS A;  1KY7 A;  2IV8 A;  3CVS A;  5IYC P;  3DPU A;  3F0Z A;  1N39 A;  3I3W A;  3OH9 A;  3CW7 A;  1WJW A;  1EUV A;  1R4X A;  1VKL A;  1YQL A;  1RM1 A;  3IH7 A;  1T6A A;  2D0A A;  3OH6 A;  4Q11 A;  2NVM A;  2V9J A;  3KTU A;  1FN7 A;  3OSE A;  1KFI A;  1VOK A;  2DKD A;  1LWY A;  2JPI A;  2H4L X;  3CWU A;  1NGM A;  1QN6 A;  3N89 A;  1P5G X;  2HZS A;  3PDK A;  1D3U A;  1M3Q A;  4BJU A;  2V8Q A;  1YQR A;  5JN5 A;  3OLP A;  5KL0 A;  3KRM A;  2QLV A; 
#chains in the Genus database with same CATH homology
 1TGH A;  2G30 A;  4B0A A;  1QTP A;  1N3C A;  1KO9 A;  4ROC B;  4DUL A;  2MJ7 A;  4I8O A;  2YH5 A;  3OSM A;  2XHI A;  1QN3 A;  1KYD A;  1M3H A;  3I0W A;  1VTL E;  2D0B A;  1HU0 A;  1QN5 A;  2JOI A;  1QNA A;  1YTF A;  1MP9 A;  3OC3 C;  3I0X A;  1QNE A;  1YQK A;  1W80 A;  4TPS A;  1AIS A;  5IYD P;  3SNS A;  1VTO A;  2D0C A;  2NOF A;  1TBA B;  1VOL B;  1PCZ A;  2Z8U A;  3DPT A;  1QN8 A;  1E42 A;  2LAE A;  3OCI A;  1QN7 A;  1KY6 A;  3ULX A;  4ROD B;  5AN4 A;  2NOE A;  2MZ8 A;  2NOB A;  5IYB P;  1QNB A;  2NOI A;  3ASM A;  1QN4 A;  2FGT A;  3EIK A;  2HZM A;  1QN9 A;  1YQM A;  2NOZ A;  3HS9 A;  1B9K A;  2O3O A;  3RPJ A;  3H1Z A;  4PY5 A;  1NVP A;  4EJY A;  1LWW A;  2IV9 A;  2I5W A;  1KYU A;  1CDW A;  1UT7 A;  1UT4 A;  1YTB A;  1PZD A;  1LWV A;  4EJZ A;  1N3A A;  1TBP A;  2NOL A;  3VN5 A;  4WZS D;  3F10 A;  3OST A;  1NH2 A;  1KYF A;  1EBM A;  1JFI C;  2VJ0 A;  3HS8 A;  2NOH A;  1C9B B;  4ROE B;  1QNC A;  1QTS A;  1KY7 A;  2IV8 A;  5IYC P;  3DPU A;  3F0Z A;  1N39 A;  1R4X A;  1YQL A;  3IH7 A;  2D0A A;  4Q11 A;  1FN7 A;  3KTU A;  1VOK A;  1LWY A;  1NGM A;  1QN6 A;  3N89 A;  2HZS A;  1D3U A;  1M3Q A;  1YQR A;  3KRM A;  1RM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...