3ULXA

Crystal structural of the conserved domain of rice stress-responsive nac1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
162
structure length
146
Chain Sequence
AEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPIIAEVDLYKFDPWDLPERALFGAREWYFFTPRDRSRPNRAAGNGYWKATGADKPVAPRGRTLGIKKALVFYAGKAPRGVKTDWIMHEYRLADAGRLDDWVLCRLYNKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced transcription factor NAC1
publication title A structural view of the conserved domain of Rice Stress-responsive NAC1
rcsb
source organism Oryza sativa subsp. japonica
molecule tags Dna binding protein
total genus 28
structure length 146
sequence length 162
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02365 NAM No apical meristem (NAM) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.150 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3ulxA01
3ULXA 4DULA 1UT4A 1UT7A
chains in the Genus database with same CATH superfamily
1N3AA 1B9KA 1TUOA 3OCIA 2IV8A 2ZFDB 2OOXA 1MP9A 3HS9A 2NOFA 3EAYA 3DPTA 3T4NA 1N39A 3D4VA 5BMPA 4EJYA 1M3QA 1Q9UA 1AISA 1R4XA 4WZSD 1EBMA 4B0AA 2V9JA 4Q11A 4EAKA 1YQRA 5HSHA 4EAGA 1KFQA 1QN4A 1YQKA 1KO9A 1QTSA 4BJUA 2JHNA 2HZSA 5AN4A 5F9CA 1V5SA 5BMNA 1JFIC 3PMGA 1P5DX 1PCJX 1QNEA 3RPJA 1QN5A 5IYBP 5IYCP 2HZMA 1C4GA 2NOBA 2QREA 1EUVA 2NOEA 3ULXA 1KYUA 3HS8A 1LWYA 1KY7A 1TGHA 4D7QA 1UT4A 3I3WA 1KYFA 1QN3A 2H4LX 3ENCA 2DKDA 3CWTA 2YA3A 2JOIA 1M3HA 3VN5A 3CVTA 2Y8QA 3CVSA 5KL0A 4TPSA 2NOLA 3OSTA 2D0CA 1P5GX 2HL8A 2D0AA 4ROEB 1LWVA 3CWSA 1PCZA 4DULA 5JMVD 1HU0A 3F10A 3UW2A 4CFFA 1NGMA 4QG5A 2O3OA 1WJWA 1KFIA 3KTUA 2HKPA 1C47A 3TE5A 2NOZA 3OSMA 4I8OA 1NH2A 1DIZA 2DKCA 2NOIA 2FUVA 2DKAA 2H5AX 1QTPA 2V92A 2YH5A 2Z0FA 1QNAA 3OSEA 2NLVA 3OH9A 1RM1A 4HJHA 2IV9A 1QNCA 3SNSA 4ROCB 1CDWA 1MPGA 2VJ0A 1VTLE 2FKMX 2NOHA 1TBAB 2Y8LA 3RSMA 2Z8UA 1QN9A 1WQAA 3OLPA 1YQMA 1YTBA 1QNBA 1VOLB 2QLVA 2F7LA 3DPUA 3CWAA 1QN8A 1T6AA 3D7QA 2MJ7A 4MRQA 3TDHA 3ASMA 5IYDP 4C7PA 1UT7A 3I0XA 3PDKA 1N3CA 3CWUA 1QN7A 4IL8A 2FKFA 1VTOA 1LXTA 3ENOC 3EIKA 2PWWA 2QRDA 1XSZA 3OH6A 2NWVA 5JN5A 2JPIA 1VOKA 3NA5A 2QRCA 2OOYA 1KYDA 2JHJA 3IH7A 1LWWA 1FN7A 1JDYA 5EPCA 3OC3C 1UL7A 1VKLA 2MZ8A 3C04A 4WXAA 2LAEA 3OGDA 4WX8A 3H1ZA 3I0WA 1YQLA 3CW7A 3BKQX 4EAJA 1PZDA 1D3UA 4EJZA 1QN6A 2V8QA 2HL9A 1YTFA 1E42A 1TBPA 1C9BB 1M5Q1 3KRMA 4EALA 2G30A 1K2YX 1PCMX 1KY6A 4PY5A 3N89A 2D0BA 1J3MA 2EHBD 1K35A 2FGTA 4RODB 1W80A 4EAIA 2XHIA 4D7RA 2QR1A 2I5WA 1NVPA 2NVMA 3F0ZA 2R5XA 1PVSA
chains in the Genus database with same CATH topology
1N3AA 1B9KA 3OCIA 2IV8A 1MP9A 3HS9A 2NOFA 3DPTA 1N39A 4EJYA 1M3QA 1AISA 1R4XA 4WZSD 1EBMA 4B0AA 4Q11A 1QN4A 1YQRA 4EJZA 1YQKA 1QTSA 1KO9A 2HZSA 5AN4A 1JFIC 1QNEA 3RPJA 1QN5A 5IYBP 5IYCP 2HZMA 2NOBA 2NOEA 3ULXA 1KYUA 3HS8A 1LWYA 1KY7A 1TGHA 1UT4A 1KYFA 1QN3A 1M3HA 2JOIA 3VN5A 4TPSA 2NOLA 3OSTA 2D0CA 4ROEB 2D0AA 1LWVA 1PCZA 4DULA 1HU0A 3F10A 1NGMA 2O3OA 3KTUA 2NOZA 3OSMA 4I8OA 1NH2A 2NOIA 1QTPA 2YH5A 1QNAA 1RM1A 2IV9A 1QNCA 3SNSA 4ROCB 1CDWA 2VJ0A 1VTLE 2NOHA 1TBAB 1QN9A 2Z8UA 1YQMA 1YTBA 1QNBA 1VOLB 3DPUA 1QN8A 2MJ7A 3ASMA 5IYDP 1N3CA 1UT7A 3I0XA 1QN7A 1VTOA 3EIKA 1VOKA 1KYDA 3IH7A 1LWWA 1FN7A 3OC3C 2MZ8A 2LAEA 3H1ZA 3I0WA 1YQLA 1PZDA 1D3UA 1QN6A 1YTFA 1E42A 1TBPA 1C9BB 3KRMA 2G30A 1KY6A 4PY5A 3N89A 2D0BA 2FGTA 4RODB 1W80A 2XHIA 2I5WA 1NVPA 3F0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULX A;  4DUL A;  1UT4 A;  1UT7 A; 
#chains in the Genus database with same CATH topology
 1N3A A;  1B9K A;  1TUO A;  3OCI A;  2IV8 A;  2ZFD B;  2OOX A;  1MP9 A;  3HS9 A;  2NOF A;  3EAY A;  3DPT A;  3T4N A;  1N39 A;  3D4V A;  5BMP A;  4EJY A;  1M3Q A;  1Q9U A;  1AIS A;  1R4X A;  4WZS D;  1EBM A;  4B0A A;  2V9J A;  4Q11 A;  4EAK A;  1YQR A;  5HSH A;  4EAG A;  1KFQ A;  1QN4 A;  1YQK A;  1KO9 A;  1QTS A;  4BJU A;  2JHN A;  2HZS A;  5AN4 A;  5F9C A;  1V5S A;  5BMN A;  1JFI C;  3PMG A;  1P5D X;  1PCJ X;  1QNE A;  3RPJ A;  1QN5 A;  5IYB P;  5IYC P;  2HZM A;  1C4G A;  2NOB A;  2QRE A;  1EUV A;  2NOE A;  3ULX A;  1KYU A;  3HS8 A;  1LWY A;  1KY7 A;  1TGH A;  4D7Q A;  1UT4 A;  3I3W A;  1KYF A;  1QN3 A;  2H4L X;  3ENC A;  2DKD A;  3CWT A;  2YA3 A;  2JOI A;  1M3H A;  3VN5 A;  3CVT A;  2Y8Q A;  3CVS A;  5KL0 A;  4TPS A;  2NOL A;  3OST A;  2D0C A;  1P5G X;  2HL8 A;  2D0A A;  4ROE B;  1LWV A;  3CWS A;  1PCZ A;  4DUL A;  5JMV D;  1HU0 A;  3F10 A;  3UW2 A;  4CFF A;  1NGM A;  4QG5 A;  2O3O A;  1WJW A;  1KFI A;  3KTU A;  2HKP A;  1C47 A;  3TE5 A;  2NOZ A;  3OSM A;  4I8O A;  1NH2 A;  1DIZ A;  2DKC A;  2NOI A;  2FUV A;  2DKA A;  2H5A X;  1QTP A;  2V92 A;  2YH5 A;  2Z0F A;  1QNA A;  3OSE A;  2NLV A;  3OH9 A;  1RM1 A;  4HJH A;  2IV9 A;  1QNC A;  3SNS A;  4ROC B;  1CDW A;  1MPG A;  2VJ0 A;  1VTL E;  2FKM X;  2NOH A;  1TBA B;  2Y8L A;  3RSM A;  2Z8U A;  1QN9 A;  1WQA A;  3OLP A;  1YQM A;  1YTB A;  1QNB A;  1VOL B;  2QLV A;  2F7L A;  3DPU A;  3CWA A;  1QN8 A;  1T6A A;  3D7Q A;  2MJ7 A;  4MRQ A;  3TDH A;  3ASM A;  5IYD P;  4C7P A;  1UT7 A;  3I0X A;  3PDK A;  1N3C A;  3CWU A;  1QN7 A;  4IL8 A;  2FKF A;  1VTO A;  1LXT A;  3ENO C;  3EIK A;  2PWW A;  2QRD A;  1XSZ A;  3OH6 A;  2NWV A;  5JN5 A;  2JPI A;  1VOK A;  3NA5 A;  2QRC A;  2OOY A;  1KYD A;  2JHJ A;  3IH7 A;  1LWW A;  1FN7 A;  1JDY A;  5EPC A;  3OC3 C;  1UL7 A;  1VKL A;  2MZ8 A;  3C04 A;  4WXA A;  2LAE A;  3OGD A;  4WX8 A;  3H1Z A;  3I0W A;  1YQL A;  3CW7 A;  3BKQ X;  4EAJ A;  1PZD A;  1D3U A;  4EJZ A;  1QN6 A;  2V8Q A;  2HL9 A;  1YTF A;  1E42 A;  1TBP A;  1C9B B;  1M5Q 1;  3KRM A;  4EAL A;  2G30 A;  1K2Y X;  1PCM X;  1KY6 A;  4PY5 A;  3N89 A;  2D0B A;  1J3M A;  2EHB D;  1K35 A;  2FGT A;  4ROD B;  1W80 A;  4EAI A;  2XHI A;  4D7R A;  2QR1 A;  2I5W A;  1NVP A;  2NVM A;  3F0Z A;  2R5X A;  1PVS A; 
#chains in the Genus database with same CATH homology
 1N3A A;  1B9K A;  3OCI A;  2IV8 A;  1MP9 A;  3HS9 A;  2NOF A;  3DPT A;  1N39 A;  4EJY A;  1M3Q A;  1AIS A;  1R4X A;  4WZS D;  1EBM A;  4B0A A;  4Q11 A;  1QN4 A;  1YQR A;  4EJZ A;  1YQK A;  1QTS A;  1KO9 A;  2HZS A;  5AN4 A;  1JFI C;  1QNE A;  3RPJ A;  1QN5 A;  5IYB P;  5IYC P;  2HZM A;  2NOB A;  2NOE A;  3ULX A;  1KYU A;  3HS8 A;  1LWY A;  1KY7 A;  1TGH A;  1UT4 A;  1KYF A;  1QN3 A;  1M3H A;  2JOI A;  3VN5 A;  4TPS A;  2NOL A;  3OST A;  2D0C A;  4ROE B;  2D0A A;  1LWV A;  1PCZ A;  4DUL A;  1HU0 A;  3F10 A;  1NGM A;  2O3O A;  3KTU A;  2NOZ A;  3OSM A;  4I8O A;  1NH2 A;  2NOI A;  1QTP A;  2YH5 A;  1QNA A;  1RM1 A;  2IV9 A;  1QNC A;  3SNS A;  4ROC B;  1CDW A;  2VJ0 A;  1VTL E;  2NOH A;  1TBA B;  1QN9 A;  2Z8U A;  1YQM A;  1YTB A;  1QNB A;  1VOL B;  3DPU A;  1QN8 A;  2MJ7 A;  3ASM A;  5IYD P;  1N3C A;  1UT7 A;  3I0X A;  1QN7 A;  1VTO A;  3EIK A;  1VOK A;  1KYD A;  3IH7 A;  1LWW A;  1FN7 A;  3OC3 C;  2MZ8 A;  2LAE A;  3H1Z A;  3I0W A;  1YQL A;  1PZD A;  1D3U A;  1QN6 A;  1YTF A;  1E42 A;  1TBP A;  1C9B B;  3KRM A;  2G30 A;  1KY6 A;  4PY5 A;  3N89 A;  2D0B A;  2FGT A;  4ROD B;  1W80 A;  2XHI A;  2I5W A;  1NVP A;  3F0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...