3ULXA

Crystal structural of the conserved domain of rice stress-responsive nac1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
162
structure length
146
Chain Sequence
AEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPIIAEVDLYKFDPWDLPERALFGAREWYFFTPRDRSRPNRAAGNGYWKATGADKPVAPRGRTLGIKKALVFYAGKAPRGVKTDWIMHEYRLADAGRLDDWVLCRLYNKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced transcription factor NAC1
publication title A structural view of the conserved domain of Rice Stress-responsive NAC1
rcsb
source organism Oryza sativa subsp. japonica
molecule tags Dna binding protein
total genus 28
structure length 146
sequence length 162
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02365 NAM No apical meristem (NAM) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.150 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3ulxA01
1UT4A 1UT7A 4DULA 3ULXA
chains in the Genus database with same CATH superfamily
4TPSA 1JFIC 1YTFA 1KYDA 3RSMA 1QTSA 2YA3A 4ROCB 1KO9A 1RM1A 1R4XA 1P5DX 5JN5A 2IV9A 1QN7A 2IV8A 5KL0A 3OH6A 1QN3A 1LWVA 1YTBA 4IL8A 3CWUA 1VKLA 2JOIA 1VOKA 1UL7A 3ASMA 3SNSA 2V8QA 5IYCP 1C47A 2FKFA 2OOXA 1LWWA 2QRCA 2NOFA 2NWVA 1FN7A 3TDHA 4EJYA 2DKAA 1DIZA 1KFIA 2O3OA 1V5SA 1QNCA 1VTLE 5BMPA 1NVPA 4WZSD 1M3QA 1LXTA 2ZFDB 2NOZA 2NOHA 1QNBA 3N89A 4QG5A 3ENCA 2HL8A 3D4VA 4MRQA 2MJ7A 2NLVA 1W80A 1VOLB 5IYBP 2DKDA 1TBAB 4EAJA 4B0AA 1KYUA 2PWWA 4WX8A 1LWYA 1M5Q1 3OSEA 2QREA 1QN4A 3EAYA 3OCIA 1Q9UA 2HL9A 3HS8A 1M3HA 1N3CA 1TBPA 1YQLA 2Y8QA 1KYFA 2FKMX 2JHNA 1TGHA 2NOBA 1E42A 1N3AA 2Z8UA 3IH7A 4EAIA 2QRDA 5AN4A 1WJWA 1PZDA 2MZ8A 4D7QA 4C7PA 4RODB 4EAGA 1B9KA 2NVMA 2YH5A 3CWSA 1P5GX 4D7RA 1QTPA 3CVSA 2H5AX 1EUVA 3OH9A 3VN5A 2LAEA 4WXAA 3RPJA 1N39A 3PMGA 3C04A 3TE5A 3T4NA 1C4GA 3UW2A 3CW7A 3OSTA 4CFFA 3OSMA 5F9CA 1UT7A 3H1ZA 3CVTA 5BMNA 1C9BB 3DPUA 5JMVD 3EIKA 4PY5A 1JDYA 1PVSA 4EALA 2V92A 1K35A 2D0BA 2NOEA 1PCZA 1KY7A 1MP9A 1NH2A 1PCJX 1UT4A 1T6AA 3D7QA 1VTOA 1PCMX 3F10A 3HS9A 4EAKA 2OOYA 1QN9A 2VJ0A 2JHJA 5IYDP 2DKCA 4I8OA 2FGTA 2H4LX 1AISA 1QNEA 1QN8A 3CWAA 2HZMA 2Z0FA 1YQKA 1WQAA 3F0ZA 2D0CA 1K2YX 1J3MA 3OLPA 5EPCA 4DULA 3KTUA 1QN5A 1QNAA 4EJZA 2QLVA 1HU0A 2HKPA 1MPGA 1YQRA 2Y8LA 3BKQX 2JPIA 2G30A 1YQMA 1QN6A 2NOLA 3PDKA 2V9JA 2NOIA 5HSHA 3OGDA 4ROEB 4HJHA 3DPTA 1EBMA 3KRMA 3I0XA 2R5XA 2QR1A 1KFQA 1TUOA 2F7LA 1CDWA 3NA5A 2XHIA 3I3WA 2EHBD 2D0AA 3OC3C 1NGMA 3I0WA 4BJUA 1XSZA 2HZSA 3CWTA 2FUVA 4Q11A 1D3UA 3ULXA 3ENOC 1KY6A 2I5WA
chains in the Genus database with same CATH topology
4TPSA 1JFIC 1YTFA 1KYDA 4ROCB 1QTSA 1KO9A 1RM1A 1R4XA 2IV9A 1QN7A 2IV8A 1QN3A 1LWVA 1YTBA 2JOIA 1VOKA 5IYCP 3ASMA 3SNSA 1LWWA 2NOFA 1FN7A 4EJYA 2O3OA 1QNCA 1VTLE 1NVPA 4WZSD 1M3QA 2NOZA 2NOHA 1QNBA 3N89A 2MJ7A 1W80A 1VOLB 5IYBP 1TBAB 4B0AA 1KYUA 1LWYA 1QN4A 3OCIA 3HS8A 1M3HA 1N3CA 1TBPA 1YQLA 1KYFA 1TGHA 2NOBA 1E42A 1N3AA 2Z8UA 3IH7A 5AN4A 1PZDA 2MZ8A 4RODB 1B9KA 2YH5A 1QTPA 3VN5A 2LAEA 3RPJA 1N39A 3OSTA 3OSMA 1UT7A 3H1ZA 1C9BB 3DPUA 3EIKA 4PY5A 2D0BA 2NOEA 1PCZA 1KY7A 1MP9A 1NH2A 1UT4A 1VTOA 3HS9A 3F10A 1QN9A 2VJ0A 5IYDP 4I8OA 2FGTA 1AISA 1QNEA 1QN8A 2HZMA 1YQKA 3F0ZA 2D0CA 4DULA 3KTUA 1QN5A 1QNAA 4EJZA 1HU0A 1YQRA 2G30A 1YQMA 1QN6A 2NOLA 2NOIA 4ROEB 3DPTA 1EBMA 3KRMA 3I0XA 1CDWA 2XHIA 3OC3C 2D0AA 1NGMA 3I0WA 2HZSA 4Q11A 1D3UA 3ULXA 1KY6A 2I5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UT4 A;  1UT7 A;  4DUL A;  3ULX A; 
#chains in the Genus database with same CATH topology
 4TPS A;  1JFI C;  1YTF A;  1KYD A;  3RSM A;  1QTS A;  2YA3 A;  4ROC B;  1KO9 A;  1RM1 A;  1R4X A;  1P5D X;  5JN5 A;  2IV9 A;  1QN7 A;  2IV8 A;  5KL0 A;  3OH6 A;  1QN3 A;  1LWV A;  1YTB A;  4IL8 A;  3CWU A;  1VKL A;  2JOI A;  1VOK A;  1UL7 A;  3ASM A;  3SNS A;  2V8Q A;  5IYC P;  1C47 A;  2FKF A;  2OOX A;  1LWW A;  2QRC A;  2NOF A;  2NWV A;  1FN7 A;  3TDH A;  4EJY A;  2DKA A;  1DIZ A;  1KFI A;  2O3O A;  1V5S A;  1QNC A;  1VTL E;  5BMP A;  1NVP A;  4WZS D;  1M3Q A;  1LXT A;  2ZFD B;  2NOZ A;  2NOH A;  1QNB A;  3N89 A;  4QG5 A;  3ENC A;  2HL8 A;  3D4V A;  4MRQ A;  2MJ7 A;  2NLV A;  1W80 A;  1VOL B;  5IYB P;  2DKD A;  1TBA B;  4EAJ A;  4B0A A;  1KYU A;  2PWW A;  4WX8 A;  1LWY A;  1M5Q 1;  3OSE A;  2QRE A;  1QN4 A;  3EAY A;  3OCI A;  1Q9U A;  2HL9 A;  3HS8 A;  1M3H A;  1N3C A;  1TBP A;  1YQL A;  2Y8Q A;  1KYF A;  2FKM X;  2JHN A;  1TGH A;  2NOB A;  1E42 A;  1N3A A;  2Z8U A;  3IH7 A;  4EAI A;  2QRD A;  5AN4 A;  1WJW A;  1PZD A;  2MZ8 A;  4D7Q A;  4C7P A;  4ROD B;  4EAG A;  1B9K A;  2NVM A;  2YH5 A;  3CWS A;  1P5G X;  4D7R A;  1QTP A;  3CVS A;  2H5A X;  1EUV A;  3OH9 A;  3VN5 A;  2LAE A;  4WXA A;  3RPJ A;  1N39 A;  3PMG A;  3C04 A;  3TE5 A;  3T4N A;  1C4G A;  3UW2 A;  3CW7 A;  3OST A;  4CFF A;  3OSM A;  5F9C A;  1UT7 A;  3H1Z A;  3CVT A;  5BMN A;  1C9B B;  3DPU A;  5JMV D;  3EIK A;  4PY5 A;  1JDY A;  1PVS A;  4EAL A;  2V92 A;  1K35 A;  2D0B A;  2NOE A;  1PCZ A;  1KY7 A;  1MP9 A;  1NH2 A;  1PCJ X;  1UT4 A;  1T6A A;  3D7Q A;  1VTO A;  1PCM X;  3F10 A;  3HS9 A;  4EAK A;  2OOY A;  1QN9 A;  2VJ0 A;  2JHJ A;  5IYD P;  2DKC A;  4I8O A;  2FGT A;  2H4L X;  1AIS A;  1QNE A;  1QN8 A;  3CWA A;  2HZM A;  2Z0F A;  1YQK A;  1WQA A;  3F0Z A;  2D0C A;  1K2Y X;  1J3M A;  3OLP A;  5EPC A;  4DUL A;  3KTU A;  1QN5 A;  1QNA A;  4EJZ A;  2QLV A;  1HU0 A;  2HKP A;  1MPG A;  1YQR A;  2Y8L A;  3BKQ X;  2JPI A;  2G30 A;  1YQM A;  1QN6 A;  2NOL A;  3PDK A;  2V9J A;  2NOI A;  5HSH A;  3OGD A;  4ROE B;  4HJH A;  3DPT A;  1EBM A;  3KRM A;  3I0X A;  2R5X A;  2QR1 A;  1KFQ A;  1TUO A;  2F7L A;  1CDW A;  3NA5 A;  2XHI A;  3I3W A;  2EHB D;  2D0A A;  3OC3 C;  1NGM A;  3I0W A;  4BJU A;  1XSZ A;  2HZS A;  3CWT A;  2FUV A;  4Q11 A;  1D3U A;  3ULX A;  3ENO C;  1KY6 A;  2I5W A; 
#chains in the Genus database with same CATH homology
 4TPS A;  1JFI C;  1YTF A;  1KYD A;  4ROC B;  1QTS A;  1KO9 A;  1RM1 A;  1R4X A;  2IV9 A;  1QN7 A;  2IV8 A;  1QN3 A;  1LWV A;  1YTB A;  2JOI A;  1VOK A;  5IYC P;  3ASM A;  3SNS A;  1LWW A;  2NOF A;  1FN7 A;  4EJY A;  2O3O A;  1QNC A;  1VTL E;  1NVP A;  4WZS D;  1M3Q A;  2NOZ A;  2NOH A;  1QNB A;  3N89 A;  2MJ7 A;  1W80 A;  1VOL B;  5IYB P;  1TBA B;  4B0A A;  1KYU A;  1LWY A;  1QN4 A;  3OCI A;  3HS8 A;  1M3H A;  1N3C A;  1TBP A;  1YQL A;  1KYF A;  1TGH A;  2NOB A;  1E42 A;  1N3A A;  2Z8U A;  3IH7 A;  5AN4 A;  1PZD A;  2MZ8 A;  4ROD B;  1B9K A;  2YH5 A;  1QTP A;  3VN5 A;  2LAE A;  3RPJ A;  1N39 A;  3OST A;  3OSM A;  1UT7 A;  3H1Z A;  1C9B B;  3DPU A;  3EIK A;  4PY5 A;  2D0B A;  2NOE A;  1PCZ A;  1KY7 A;  1MP9 A;  1NH2 A;  1UT4 A;  1VTO A;  3HS9 A;  3F10 A;  1QN9 A;  2VJ0 A;  5IYD P;  4I8O A;  2FGT A;  1AIS A;  1QNE A;  1QN8 A;  2HZM A;  1YQK A;  3F0Z A;  2D0C A;  4DUL A;  3KTU A;  1QN5 A;  1QNA A;  4EJZ A;  1HU0 A;  1YQR A;  2G30 A;  1YQM A;  1QN6 A;  2NOL A;  2NOI A;  4ROE B;  3DPT A;  1EBM A;  3KRM A;  3I0X A;  1CDW A;  2XHI A;  3OC3 C;  2D0A A;  1NGM A;  3I0W A;  2HZS A;  4Q11 A;  1D3U A;  3ULX A;  1KY6 A;  2I5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...