2MZ8A

Solution nmr structure of salmonella typhimurium transcriptional regulator protein crl
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
133
structure length
133
Chain Sequence
MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Sigma factor-binding protein Crl
publication title Binding interface between the Salmonella sigma (S)/RpoS subunit of RNA polymerase and Crl: hints from bacterial species lacking crl.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
total genus 22
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07417 Crl Sigma factor-binding transcriptional regulator Crl
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.230 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2mz8A00
4Q11A 2MZ8A 3RPJA
chains in the Genus database with same CATH superfamily
3SNSA 5BMNA 1B9KA 1YQKA 2V92A 3CVSA 1LXTA 1J3MA 2QR1A 3KTUA 1C9BB 1TBPA 2YA3A 1QN4A 1VKLA 2O3OA 3T4NA 2NOZA 1LWWA 1JFIC 1QN3A 2Z8UA 3EIKA 5IYCP 1PCZA 2H5AX 4TPSA 2F7LA 2JPIA 3OCIA 3OLPA 1KFQA 1QNAA 5JMVD 1M3HA 1YTFA 2V8QA 4EJYA 1TBAB 3TE5A 1QTSA 1C4GA 3F0ZA 2MZ8A 1QN6A 1YTBA 4WX8A 2NOEA 2I5WA 5JN5A 1NGMA 1YQMA 1UL7A 2QREA 2XHIA 1P5DX 3F10A 3RPJA 1UT7A 1NVPA 4DULA 4Q11A 2FKMX 2JHJA 1EUVA 1D3UA 5EPCA 1E42A 1T6AA 5IYBP 3OH6A 1QNEA 1R4XA 3D4VA 4ROEB 2R5XA 3ENOC 2HZSA 1QNCA 3CW7A 5HSHA 3HS9A 2LAEA 1N39A 2VJ0A 3CWSA 2NOFA 3RSMA 3CVTA 1YQLA 3UW2A 3DPTA 2G30A 2FUVA 1K2YX 2HZMA 2Z0FA 3IH7A 1LWYA 2NOHA 1VTLE 2OOYA 3CWUA 1TGHA 1K35A 5F9CA 2D0AA 1C47A 3I0WA 3OSTA 4HJHA 1TUOA 1FN7A 4EAIA 1XSZA 2HKPA 4WZSD 1QTPA 1YQRA 2NOBA 4EJZA 4ROCB 1UT4A 3OC3C 2NOIA 3HS8A 2NVMA 4CFFA 1JDYA 3ENCA 4EALA 3DPUA 1M3QA 2MJ7A 3VN5A 1PZDA 2JHNA 3N89A 4PY5A 1PCMX 2D0CA 4IL8A 4BJUA 3BKQX 3CWAA 3ULXA 1KYFA 1P5GX 1M5Q1 4RODB 3OGDA 2FGTA 2HL8A 1KY7A 2DKDA 2HL9A 2IV8A 2YH5A 2DKCA 1PVSA 3I3WA 3PMGA 1MPGA 2NWVA 4D7QA 1N3CA 1KO9A 5KL0A 2Y8LA 1KFIA 1V5SA 1AISA 1QN5A 3D7QA 4B0AA 1QN9A 1NH2A 2ZFDB 4EAGA 2QLVA 2NLVA 2V9JA 3KRMA 3TDHA 3OH9A 1MP9A 3EAYA 2QRCA 4EAJA 3OSMA 1N3AA 1QNBA 2NOLA 1CDWA 3I0XA 1W80A 4I8OA 5BMPA 1VTOA 1RM1A 1WJWA 4D7RA 1KY6A 4MRQA 2FKFA 3H1ZA 2EHBD 2QRDA 3C04A 1VOLB 3CWTA 1LWVA 3ASMA 1VOKA 2DKAA 1QN7A 1EBMA 2JOIA 4WXAA 3NA5A 2IV9A 1HU0A 2PWWA 4C7PA 1WQAA 2OOXA 1DIZA 3OSEA 3PDKA 1PCJX 5IYDP 2H4LX 2Y8QA 1QN8A 1KYDA 2D0BA 5AN4A 4QG5A 4EAKA 1KYUA 1Q9UA
chains in the Genus database with same CATH topology
3SNSA 1B9KA 1YQKA 3KTUA 1C9BB 1TBPA 1QN4A 2O3OA 2NOZA 1LWWA 1JFIC 1QN3A 2Z8UA 3EIKA 5IYCP 1PCZA 4TPSA 3OCIA 1YTFA 1QNAA 1M3HA 4EJYA 1TBAB 1QTSA 2MZ8A 1QN6A 1YTBA 2NOEA 2I5WA 1NGMA 1YQMA 2XHIA 3F10A 3RPJA 1UT7A 1NVPA 4DULA 4Q11A 1D3UA 1E42A 5IYBP 1QNEA 1R4XA 4ROEB 2HZSA 1QNCA 3HS9A 2LAEA 1N39A 2VJ0A 2NOFA 1YQLA 3DPTA 2G30A 2NOHA 2HZMA 3IH7A 1LWYA 1VTLE 1TGHA 2D0AA 3I0WA 3OSTA 1FN7A 2NOBA 4WZSD 1QTPA 1YQRA 4EJZA 4ROCB 1UT4A 3OC3C 2NOIA 3HS8A 1M3QA 3DPUA 2MJ7A 3VN5A 1PZDA 3N89A 4PY5A 2D0CA 3ULXA 1KYFA 4RODB 2FGTA 2YH5A 1KY7A 2IV8A 1N3CA 1KO9A 1AISA 1QN5A 4B0AA 1QN9A 1NH2A 3KRMA 1MP9A 2NOLA 3OSMA 1N3AA 1QNBA 1CDWA 3I0XA 1W80A 4I8OA 1VTOA 1RM1A 1KY6A 3H1ZA 1VOLB 1LWVA 3ASMA 1VOKA 1QN7A 1EBMA 2JOIA 2IV9A 1HU0A 5IYDP 1QN8A 1KYDA 2D0BA 5AN4A 1KYUA 3F0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q11 A;  2MZ8 A;  3RPJ A; 
#chains in the Genus database with same CATH topology
 3SNS A;  5BMN A;  1B9K A;  1YQK A;  2V92 A;  3CVS A;  1LXT A;  1J3M A;  2QR1 A;  3KTU A;  1C9B B;  1TBP A;  2YA3 A;  1QN4 A;  1VKL A;  2O3O A;  3T4N A;  2NOZ A;  1LWW A;  1JFI C;  1QN3 A;  2Z8U A;  3EIK A;  5IYC P;  1PCZ A;  2H5A X;  4TPS A;  2F7L A;  2JPI A;  3OCI A;  3OLP A;  1KFQ A;  1QNA A;  5JMV D;  1M3H A;  1YTF A;  2V8Q A;  4EJY A;  1TBA B;  3TE5 A;  1QTS A;  1C4G A;  3F0Z A;  2MZ8 A;  1QN6 A;  1YTB A;  4WX8 A;  2NOE A;  2I5W A;  5JN5 A;  1NGM A;  1YQM A;  1UL7 A;  2QRE A;  2XHI A;  1P5D X;  3F10 A;  3RPJ A;  1UT7 A;  1NVP A;  4DUL A;  4Q11 A;  2FKM X;  2JHJ A;  1EUV A;  1D3U A;  5EPC A;  1E42 A;  1T6A A;  5IYB P;  3OH6 A;  1QNE A;  1R4X A;  3D4V A;  4ROE B;  2R5X A;  3ENO C;  2HZS A;  1QNC A;  3CW7 A;  5HSH A;  3HS9 A;  2LAE A;  1N39 A;  2VJ0 A;  3CWS A;  2NOF A;  3RSM A;  3CVT A;  1YQL A;  3UW2 A;  3DPT A;  2G30 A;  2FUV A;  1K2Y X;  2HZM A;  2Z0F A;  3IH7 A;  1LWY A;  2NOH A;  1VTL E;  2OOY A;  3CWU A;  1TGH A;  1K35 A;  5F9C A;  2D0A A;  1C47 A;  3I0W A;  3OST A;  4HJH A;  1TUO A;  1FN7 A;  4EAI A;  1XSZ A;  2HKP A;  4WZS D;  1QTP A;  1YQR A;  2NOB A;  4EJZ A;  4ROC B;  1UT4 A;  3OC3 C;  2NOI A;  3HS8 A;  2NVM A;  4CFF A;  1JDY A;  3ENC A;  4EAL A;  3DPU A;  1M3Q A;  2MJ7 A;  3VN5 A;  1PZD A;  2JHN A;  3N89 A;  4PY5 A;  1PCM X;  2D0C A;  4IL8 A;  4BJU A;  3BKQ X;  3CWA A;  3ULX A;  1KYF A;  1P5G X;  1M5Q 1;  4ROD B;  3OGD A;  2FGT A;  2HL8 A;  1KY7 A;  2DKD A;  2HL9 A;  2IV8 A;  2YH5 A;  2DKC A;  1PVS A;  3I3W A;  3PMG A;  1MPG A;  2NWV A;  4D7Q A;  1N3C A;  1KO9 A;  5KL0 A;  2Y8L A;  1KFI A;  1V5S A;  1AIS A;  1QN5 A;  3D7Q A;  4B0A A;  1QN9 A;  1NH2 A;  2ZFD B;  4EAG A;  2QLV A;  2NLV A;  2V9J A;  3KRM A;  3TDH A;  3OH9 A;  1MP9 A;  3EAY A;  2QRC A;  4EAJ A;  3OSM A;  1N3A A;  1QNB A;  2NOL A;  1CDW A;  3I0X A;  1W80 A;  4I8O A;  5BMP A;  1VTO A;  1RM1 A;  1WJW A;  4D7R A;  1KY6 A;  4MRQ A;  2FKF A;  3H1Z A;  2EHB D;  2QRD A;  3C04 A;  1VOL B;  3CWT A;  1LWV A;  3ASM A;  1VOK A;  2DKA A;  1QN7 A;  1EBM A;  2JOI A;  4WXA A;  3NA5 A;  2IV9 A;  1HU0 A;  2PWW A;  4C7P A;  1WQA A;  2OOX A;  1DIZ A;  3OSE A;  3PDK A;  1PCJ X;  5IYD P;  2H4L X;  2Y8Q A;  1QN8 A;  1KYD A;  2D0B A;  5AN4 A;  4QG5 A;  4EAK A;  1KYU A;  1Q9U A; 
#chains in the Genus database with same CATH homology
 3SNS A;  1B9K A;  1YQK A;  3KTU A;  1C9B B;  1TBP A;  1QN4 A;  2O3O A;  2NOZ A;  1LWW A;  1JFI C;  1QN3 A;  2Z8U A;  3EIK A;  5IYC P;  1PCZ A;  4TPS A;  3OCI A;  1YTF A;  1QNA A;  1M3H A;  4EJY A;  1TBA B;  1QTS A;  2MZ8 A;  1QN6 A;  1YTB A;  2NOE A;  2I5W A;  1NGM A;  1YQM A;  2XHI A;  3F10 A;  3RPJ A;  1UT7 A;  1NVP A;  4DUL A;  4Q11 A;  1D3U A;  1E42 A;  5IYB P;  1QNE A;  1R4X A;  4ROE B;  2HZS A;  1QNC A;  3HS9 A;  2LAE A;  1N39 A;  2VJ0 A;  2NOF A;  1YQL A;  3DPT A;  2G30 A;  2NOH A;  2HZM A;  3IH7 A;  1LWY A;  1VTL E;  1TGH A;  2D0A A;  3I0W A;  3OST A;  1FN7 A;  2NOB A;  4WZS D;  1QTP A;  1YQR A;  4EJZ A;  4ROC B;  1UT4 A;  3OC3 C;  2NOI A;  3HS8 A;  1M3Q A;  3DPU A;  2MJ7 A;  3VN5 A;  1PZD A;  3N89 A;  4PY5 A;  2D0C A;  3ULX A;  1KYF A;  4ROD B;  2FGT A;  2YH5 A;  1KY7 A;  2IV8 A;  1N3C A;  1KO9 A;  1AIS A;  1QN5 A;  4B0A A;  1QN9 A;  1NH2 A;  3KRM A;  1MP9 A;  2NOL A;  3OSM A;  1N3A A;  1QNB A;  1CDW A;  3I0X A;  1W80 A;  4I8O A;  1VTO A;  1RM1 A;  1KY6 A;  3H1Z A;  1VOL B;  1LWV A;  3ASM A;  1VOK A;  1QN7 A;  1EBM A;  2JOI A;  2IV9 A;  1HU0 A;  5IYD P;  1QN8 A;  1KYD A;  2D0B A;  5AN4 A;  1KYU A;  3F0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...