2MZ8A

Solution nmr structure of salmonella typhimurium transcriptional regulator protein crl
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
133
structure length
133
Chain Sequence
MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sigma factor-binding protein Crl
publication title Binding interface between the Salmonella sigma (S)/RpoS subunit of RNA polymerase and Crl: hints from bacterial species lacking crl.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Transcription regulator
total genus 22
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07417 Crl Sigma factor-binding transcriptional regulator Crl
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.230 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2mz8A00
4Q11A 3RPJA 2MZ8A
chains in the Genus database with same CATH superfamily
1YQKA 1UT7A 3OCIA 4DULA 2QREA 3D7QA 5EPCA 3ENCA 2DKDA 2QLVA 1KO9A 1N39A 1QN8A 5JN5A 3I0WA 2Z0FA 5IYDP 4EAKA 3I0XA 5KL0A 1AISA 3HS9A 2NWVA 3N89A 3F10A 1XSZA 3OSEA 1PCZA 3OGDA 1EBMA 1P5DX 4EALA 2FKMX 3CVTA 1YQLA 2Z8UA 1YTFA 2JHNA 3CWUA 1N3CA 1KFIA 1QN3A 3OSMA 1KFQA 3OSTA 3SNSA 4C7PA 2MZ8A 2V8QA 4ROCB 4B0AA 1LWVA 1M5Q1 3EIKA 2Y8QA 3ASMA 1J3MA 3BKQX 3RSMA 4EAGA 4EAIA 1M3HA 2H4LX 1N3AA 3T4NA 1NVPA 5JMVD 2NOFA 1PZDA 2FKFA 2V92A 3NA5A 1QTPA 3DPUA 3IH7A 1QNBA 1QN4A 3KRMA 2NOHA 2EHBD 1VTOA 1C4GA 1TUOA 1QN7A 4QG5A 1Q9UA 3DPTA 3CWTA 2HZSA 4D7RA 3OLPA 1QN5A 3VN5A 1LXTA 2JHJA 1KYDA 2NOZA 2D0BA 2ZFDB 2NOBA 2VJ0A 5IYCP 2QRDA 4WZSD 4MRQA 2DKCA 4TPSA 3RPJA 4D7QA 2FUVA 1W80A 4WX8A 1FN7A 2LAEA 1TBPA 1T6AA 2NVMA 1RM1A 1NH2A 1LWYA 2H5AX 2NOIA 1PVSA 2MJ7A 3H1ZA 5BMPA 1NGMA 2QRCA 4BJUA 1DIZA 3CWSA 3TE5A 3F0ZA 1QTSA 3HS8A 1JDYA 1C9BB 1D3UA 1VOLB 1KY6A 1UL7A 1VKLA 1YQRA 2YA3A 2NOEA 4ROEB 4EJYA 4RODB 5BMNA 2F7LA 1JFIC 2D0AA 2O3OA 2DKAA 2PWWA 1MP9A 3TDHA 1CDWA 1PCJX 5IYBP 2R5XA 3ENOC 2D0CA 2HL8A 5HSHA 1KYFA 1QNCA 4WXAA 4I8OA 3CWAA 1E42A 5AN4A 1UT4A 4HJHA 1QN9A 3CVSA 2NOLA 2Y8LA 1YQMA 1WQAA 3EAYA 2QR1A 2JOIA 1KYUA 2OOXA 3PDKA 2HKPA 1EUVA 1R4XA 1P5GX 3KTUA 5F9CA 3ULXA 1VTLE 3D4VA 2OOYA 1TGHA 2G30A 1VOKA 2HL9A 2FGTA 1M3QA 2V9JA 1K35A 4IL8A 1TBAB 3OC3C 1LWWA 2IV8A 2XHIA 3OH9A 1YTBA 1PCMX 4EJZA 1HU0A 4Q11A 1KY7A 3UW2A 3OH6A 2YH5A 3PMGA 1QNAA 1QNEA 2I5WA 1B9KA 1WJWA 1V5SA 2IV9A 4CFFA 1MPGA 1QN6A 1K2YX 3C04A 4EAJA 4PY5A 3I3WA 2HZMA 3CW7A 2JPIA 1C47A 2NLVA
chains in the Genus database with same CATH topology
1YQKA 1UT7A 3OCIA 4DULA 1KO9A 1N39A 1QN8A 3I0WA 5IYDP 3I0XA 1AISA 3HS9A 3N89A 3F10A 1PCZA 1EBMA 1YQLA 2Z8UA 1YTFA 1N3CA 1QN3A 3OSMA 3OSTA 3SNSA 2MZ8A 4ROCB 4B0AA 1LWVA 3EIKA 3ASMA 1M3HA 1N3AA 1NVPA 2NOFA 1PZDA 1QTPA 3DPUA 3IH7A 1QNBA 1QN4A 3KRMA 2NOHA 1VTOA 1QN7A 3DPTA 2HZSA 1QN5A 3VN5A 1KYDA 2NOZA 2NOBA 2VJ0A 5IYCP 4WZSD 4TPSA 3RPJA 1W80A 1FN7A 2LAEA 1TBPA 1RM1A 1NH2A 1LWYA 2NOIA 2MJ7A 3H1ZA 1NGMA 3F0ZA 1QTSA 3HS8A 1C9BB 1D3UA 1VOLB 1KY6A 1YQRA 2NOEA 4ROEB 4EJYA 4RODB 1JFIC 2D0AA 2O3OA 1MP9A 1CDWA 5IYBP 2D0CA 1KYFA 1QNCA 4I8OA 1E42A 5AN4A 1UT4A 1QN9A 2NOLA 1YQMA 3KTUA 2JOIA 1KYUA 1R4XA 3ULXA 1VTLE 1TGHA 2G30A 1VOKA 2FGTA 1M3QA 1TBAB 3OC3C 1LWWA 2IV8A 2XHIA 1YTBA 4EJZA 1HU0A 4Q11A 1KY7A 2YH5A 1QNAA 1QNEA 2I5WA 1B9KA 2IV9A 1QN6A 4PY5A 2HZMA 2D0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q11 A;  3RPJ A;  2MZ8 A; 
#chains in the Genus database with same CATH topology
 1YQK A;  1UT7 A;  3OCI A;  4DUL A;  2QRE A;  3D7Q A;  5EPC A;  3ENC A;  2DKD A;  2QLV A;  1KO9 A;  1N39 A;  1QN8 A;  5JN5 A;  3I0W A;  2Z0F A;  5IYD P;  4EAK A;  3I0X A;  5KL0 A;  1AIS A;  3HS9 A;  2NWV A;  3N89 A;  3F10 A;  1XSZ A;  3OSE A;  1PCZ A;  3OGD A;  1EBM A;  1P5D X;  4EAL A;  2FKM X;  3CVT A;  1YQL A;  2Z8U A;  1YTF A;  2JHN A;  3CWU A;  1N3C A;  1KFI A;  1QN3 A;  3OSM A;  1KFQ A;  3OST A;  3SNS A;  4C7P A;  2MZ8 A;  2V8Q A;  4ROC B;  4B0A A;  1LWV A;  1M5Q 1;  3EIK A;  2Y8Q A;  3ASM A;  1J3M A;  3BKQ X;  3RSM A;  4EAG A;  4EAI A;  1M3H A;  2H4L X;  1N3A A;  3T4N A;  1NVP A;  5JMV D;  2NOF A;  1PZD A;  2FKF A;  2V92 A;  3NA5 A;  1QTP A;  3DPU A;  3IH7 A;  1QNB A;  1QN4 A;  3KRM A;  2NOH A;  2EHB D;  1VTO A;  1C4G A;  1TUO A;  1QN7 A;  4QG5 A;  1Q9U A;  3DPT A;  3CWT A;  2HZS A;  4D7R A;  3OLP A;  1QN5 A;  3VN5 A;  1LXT A;  2JHJ A;  1KYD A;  2NOZ A;  2D0B A;  2ZFD B;  2NOB A;  2VJ0 A;  5IYC P;  2QRD A;  4WZS D;  4MRQ A;  2DKC A;  4TPS A;  3RPJ A;  4D7Q A;  2FUV A;  1W80 A;  4WX8 A;  1FN7 A;  2LAE A;  1TBP A;  1T6A A;  2NVM A;  1RM1 A;  1NH2 A;  1LWY A;  2H5A X;  2NOI A;  1PVS A;  2MJ7 A;  3H1Z A;  5BMP A;  1NGM A;  2QRC A;  4BJU A;  1DIZ A;  3CWS A;  3TE5 A;  3F0Z A;  1QTS A;  3HS8 A;  1JDY A;  1C9B B;  1D3U A;  1VOL B;  1KY6 A;  1UL7 A;  1VKL A;  1YQR A;  2YA3 A;  2NOE A;  4ROE B;  4EJY A;  4ROD B;  5BMN A;  2F7L A;  1JFI C;  2D0A A;  2O3O A;  2DKA A;  2PWW A;  1MP9 A;  3TDH A;  1CDW A;  1PCJ X;  5IYB P;  2R5X A;  3ENO C;  2D0C A;  2HL8 A;  5HSH A;  1KYF A;  1QNC A;  4WXA A;  4I8O A;  3CWA A;  1E42 A;  5AN4 A;  1UT4 A;  4HJH A;  1QN9 A;  3CVS A;  2NOL A;  2Y8L A;  1YQM A;  1WQA A;  3EAY A;  2QR1 A;  2JOI A;  1KYU A;  2OOX A;  3PDK A;  2HKP A;  1EUV A;  1R4X A;  1P5G X;  3KTU A;  5F9C A;  3ULX A;  1VTL E;  3D4V A;  2OOY A;  1TGH A;  2G30 A;  1VOK A;  2HL9 A;  2FGT A;  1M3Q A;  2V9J A;  1K35 A;  4IL8 A;  1TBA B;  3OC3 C;  1LWW A;  2IV8 A;  2XHI A;  3OH9 A;  1YTB A;  1PCM X;  4EJZ A;  1HU0 A;  4Q11 A;  1KY7 A;  3UW2 A;  3OH6 A;  2YH5 A;  3PMG A;  1QNA A;  1QNE A;  2I5W A;  1B9K A;  1WJW A;  1V5S A;  2IV9 A;  4CFF A;  1MPG A;  1QN6 A;  1K2Y X;  3C04 A;  4EAJ A;  4PY5 A;  3I3W A;  2HZM A;  3CW7 A;  2JPI A;  1C47 A;  2NLV A; 
#chains in the Genus database with same CATH homology
 1YQK A;  1UT7 A;  3OCI A;  4DUL A;  1KO9 A;  1N39 A;  1QN8 A;  3I0W A;  5IYD P;  3I0X A;  1AIS A;  3HS9 A;  3N89 A;  3F10 A;  1PCZ A;  1EBM A;  1YQL A;  2Z8U A;  1YTF A;  1N3C A;  1QN3 A;  3OSM A;  3OST A;  3SNS A;  2MZ8 A;  4ROC B;  4B0A A;  1LWV A;  3EIK A;  3ASM A;  1M3H A;  1N3A A;  1NVP A;  2NOF A;  1PZD A;  1QTP A;  3DPU A;  3IH7 A;  1QNB A;  1QN4 A;  3KRM A;  2NOH A;  1VTO A;  1QN7 A;  3DPT A;  2HZS A;  1QN5 A;  3VN5 A;  1KYD A;  2NOZ A;  2NOB A;  2VJ0 A;  5IYC P;  4WZS D;  4TPS A;  3RPJ A;  1W80 A;  1FN7 A;  2LAE A;  1TBP A;  1RM1 A;  1NH2 A;  1LWY A;  2NOI A;  2MJ7 A;  3H1Z A;  1NGM A;  3F0Z A;  1QTS A;  3HS8 A;  1C9B B;  1D3U A;  1VOL B;  1KY6 A;  1YQR A;  2NOE A;  4ROE B;  4EJY A;  4ROD B;  1JFI C;  2D0A A;  2O3O A;  1MP9 A;  1CDW A;  5IYB P;  2D0C A;  1KYF A;  1QNC A;  4I8O A;  1E42 A;  5AN4 A;  1UT4 A;  1QN9 A;  2NOL A;  1YQM A;  3KTU A;  2JOI A;  1KYU A;  1R4X A;  3ULX A;  1VTL E;  1TGH A;  2G30 A;  1VOK A;  2FGT A;  1M3Q A;  1TBA B;  3OC3 C;  1LWW A;  2IV8 A;  2XHI A;  1YTB A;  4EJZ A;  1HU0 A;  4Q11 A;  1KY7 A;  2YH5 A;  1QNA A;  1QNE A;  2I5W A;  1B9K A;  2IV9 A;  1QN6 A;  4PY5 A;  2HZM A;  2D0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...