3OCIA

Crystal structure of tbp (tata box binding protein)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
179
structure length
179
Chain Sequence
SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID (TFIID-1)
publication title Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
total genus 39
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3ociA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3ociA02
2IV9A 3OCIA 4ROCB 3OC3C 3ASMA 5IYDP 4B0AA 1VTLE 2Z8UA 1YTFA 4PY5A 1QTSA 1QNEA 1NGMA 3VN5A 1QNBA 5IYBP 1RM1A 1QN5A 1E42A 1KYUA 2D0CA 2IV8A 3HS8A 1TBPA 2VJ0A 1QNAA 1TBAB 1C9BB 1KY6A 1W80A 1JFIC 2D0AA 1AISA 4WZSD 1QN7A 3HS9A 1VOKA 1TGHA 1QN3A 1NVPA 1QN4A 1QN8A 1R4XA 1VTOA 1QN6A 1VOLB 1MP9A 4RODB 1PZDA 5IYCP 1QNCA 3EIKA 1YTBA 1KYFA 1KYDA 1NH2A 1QN9A 3H1ZA 2D0BA 1QTPA 2MJ7A 4ROEB 1CDWA 1D3UA 1PCZA 2G30A 1KY7A 1B9KA
chains in the Genus database with same CATH superfamily
4EALA 1N3CA 4I8OA 2NWVA 1TUOA 2ZFDB 4TPSA 4DULA 1QTSA 1V5SA 2YA3A 1EUVA 2V8QA 3OSTA 1QN5A 3KRMA 2FUVA 1E42A 2D0CA 2IV8A 4EAKA 1EBMA 1QNAA 1K35A 3PDKA 1KY6A 2QREA 1C47A 5F9CA 1AISA 4WZSD 1Q9UA 2NOEA 4BJUA 3CW7A 1VOKA 4C7PA 3F0ZA 2XHIA 3PMGA 1QN4A 5HSHA 2OOXA 5KL0A 1N3AA 2QRCA 4D7RA 2NOIA 2NOHA 1LWVA 3CWAA 2EHBD 1YTBA 1KYFA 1KFQA 1KYDA 2NVMA 5BMPA 3N89A 1M5Q1 4Q11A 4EAIA 2YH5A 1PVSA 1M3HA 1PCZA 1MPGA 2NOLA 1B9KA 4WX8A 1XSZA 4ROCB 2JHJA 5BMNA 3OH9A 3I3WA 2QRDA 1KO9A 1VTLE 2NLVA 2Z8UA 3RSMA 4WXAA 1NGMA 1P5DX 5IYBP 1QNBA 2H4LX 3TE5A 1KYUA 1UL7A 2Z0FA 3OSMA 4IL8A 1LWYA 2F7LA 1TBAB 1UT7A 1VKLA 1PCJX 1W80A 2D0AA 3F10A 3HS9A 1YQRA 3DPUA 3BKQX 1QN3A 1VTOA 1VOLB 2HL8A 1MP9A 1WQAA 1PZDA 3UW2A 1YQMA 1QNCA 4EJZA 3EIKA 1JDYA 1P5GX 2NOFA 4EAJA 1QN9A 2FKMX 2D0BA 1J3MA 1KY7A 2OOYA 5EPCA 1C4GA 3OC3C 2MZ8A 3I0WA 2DKDA 4B0AA 3NA5A 1YTFA 1UT4A 1M3QA 3ENCA 1RM1A 3CWUA 3CWTA 3HS8A 3OGDA 1TBPA 2JPIA 2VJ0A 2I5WA 4HJHA 1C9BB 1JFIC 1K2YX 3DPTA 2V9JA 1QN7A 2FKFA 3D7QA 1TGHA 3C04A 3OLPA 2FGTA 3TDHA 1QN8A 1R4XA 1QN6A 2HKPA 4RODB 1PCMX 5IYCP 1DIZA 2HZMA 2V92A 1NH2A 3KTUA 2HL9A 2MJ7A 1D3UA 2G30A 3T4NA 2IV9A 2Y8QA 3OCIA 2NOZA 3I0XA 1FN7A 3ASMA 5IYDP 1YQKA 2DKAA 1WJWA 5AN4A 1QNEA 2QR1A 2PWWA 3VN5A 4PY5A 3ULXA 3OSEA 3RPJA 4CFFA 1LWWA 2R5XA 2Y8LA 1LXTA 3SNSA 3CVSA 4EJYA 2QLVA 2HZSA 2H5AX 5JN5A 1NVPA 3CVTA 2DKCA 1HU0A 3OH6A 1KFIA 2O3OA 3IH7A 4EAGA 2JHNA 4D7QA 1T6AA 5JMVD 2LAEA 4MRQA 3D4VA 3H1ZA 1YQLA 4QG5A 1QTPA 4ROEB 2NOBA 1CDWA 3EAYA 3CWSA 2JOIA 3ENOC 1N39A
chains in the Genus database with same CATH topology
1N3CA 4I8OA 4TPSA 4DULA 1QTSA 1QN5A 3KRMA 1EBMA 1E42A 2D0CA 2IV8A 1QNAA 1KY6A 1AISA 4WZSD 2NOEA 1VOKA 3F0ZA 2XHIA 1QN4A 1N3AA 2NOHA 1LWVA 1YTBA 1KYFA 1KYDA 3N89A 4Q11A 2YH5A 1M3HA 1PCZA 2NOLA 1B9KA 4ROCB 1KO9A 1VTLE 2Z8UA 1NGMA 1QNBA 5IYBP 1KYUA 1LWYA 3OSMA 1TBAB 1UT7A 1W80A 2D0AA 3F10A 3HS9A 1YQRA 3DPUA 1QN3A 1VTOA 1VOLB 1MP9A 1PZDA 1YQMA 1QNCA 4EJZA 3EIKA 2NOFA 1QN9A 2D0BA 1KY7A 3OC3C 2MZ8A 3I0WA 4B0AA 1YTFA 1UT4A 1M3QA 1RM1A 3HS8A 1TBPA 2VJ0A 2I5WA 1C9BB 1JFIC 3DPTA 1QN7A 1TGHA 2FGTA 1QN8A 1R4XA 1QN6A 4RODB 5IYCP 2HZMA 1NH2A 3KTUA 2MJ7A 1D3UA 2G30A 2IV9A 2NOZA 3OCIA 3I0XA 1FN7A 3ASMA 5IYDP 1YQKA 5AN4A 1QNEA 4PY5A 3VN5A 3ULXA 3RPJA 1LWWA 3SNSA 4EJYA 2HZSA 1NVPA 1HU0A 2O3OA 3IH7A 2LAEA 3H1ZA 1YQLA 1QTPA 4ROEB 2NOBA 1CDWA 2NOIA 2JOIA 3OSTA 1N39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IV9 A;  3OCI A;  4ROC B;  3OC3 C;  3ASM A;  5IYD P;  4B0A A;  1VTL E;  2Z8U A;  1YTF A;  4PY5 A;  1QTS A;  1QNE A;  1NGM A;  3VN5 A;  1QNB A;  5IYB P;  1RM1 A;  1QN5 A;  1E42 A;  1KYU A;  2D0C A;  2IV8 A;  3HS8 A;  1TBP A;  2VJ0 A;  1QNA A;  1TBA B;  1C9B B;  1KY6 A;  1W80 A;  1JFI C;  2D0A A;  1AIS A;  4WZS D;  1QN7 A;  3HS9 A;  1VOK A;  1TGH A;  1QN3 A;  1NVP A;  1QN4 A;  1QN8 A;  1R4X A;  1VTO A;  1QN6 A;  1VOL B;  1MP9 A;  4ROD B;  1PZD A;  5IYC P;  1QNC A;  3EIK A;  1YTB A;  1KYF A;  1KYD A;  1NH2 A;  1QN9 A;  3H1Z A;  2D0B A;  1QTP A;  2MJ7 A;  4ROE B;  1CDW A;  1D3U A;  1PCZ A;  2G30 A;  1KY7 A;  1B9K A; 
#chains in the Genus database with same CATH topology
 4EAL A;  1N3C A;  4I8O A;  2NWV A;  1TUO A;  2ZFD B;  4TPS A;  4DUL A;  1QTS A;  1V5S A;  2YA3 A;  1EUV A;  2V8Q A;  3OST A;  1QN5 A;  3KRM A;  2FUV A;  1E42 A;  2D0C A;  2IV8 A;  4EAK A;  1EBM A;  1QNA A;  1K35 A;  3PDK A;  1KY6 A;  2QRE A;  1C47 A;  5F9C A;  1AIS A;  4WZS D;  1Q9U A;  2NOE A;  4BJU A;  3CW7 A;  1VOK A;  4C7P A;  3F0Z A;  2XHI A;  3PMG A;  1QN4 A;  5HSH A;  2OOX A;  5KL0 A;  1N3A A;  2QRC A;  4D7R A;  2NOI A;  2NOH A;  1LWV A;  3CWA A;  2EHB D;  1YTB A;  1KYF A;  1KFQ A;  1KYD A;  2NVM A;  5BMP A;  3N89 A;  1M5Q 1;  4Q11 A;  4EAI A;  2YH5 A;  1PVS A;  1M3H A;  1PCZ A;  1MPG A;  2NOL A;  1B9K A;  4WX8 A;  1XSZ A;  4ROC B;  2JHJ A;  5BMN A;  3OH9 A;  3I3W A;  2QRD A;  1KO9 A;  1VTL E;  2NLV A;  2Z8U A;  3RSM A;  4WXA A;  1NGM A;  1P5D X;  5IYB P;  1QNB A;  2H4L X;  3TE5 A;  1KYU A;  1UL7 A;  2Z0F A;  3OSM A;  4IL8 A;  1LWY A;  2F7L A;  1TBA B;  1UT7 A;  1VKL A;  1PCJ X;  1W80 A;  2D0A A;  3F10 A;  3HS9 A;  1YQR A;  3DPU A;  3BKQ X;  1QN3 A;  1VTO A;  1VOL B;  2HL8 A;  1MP9 A;  1WQA A;  1PZD A;  3UW2 A;  1YQM A;  1QNC A;  4EJZ A;  3EIK A;  1JDY A;  1P5G X;  2NOF A;  4EAJ A;  1QN9 A;  2FKM X;  2D0B A;  1J3M A;  1KY7 A;  2OOY A;  5EPC A;  1C4G A;  3OC3 C;  2MZ8 A;  3I0W A;  2DKD A;  4B0A A;  3NA5 A;  1YTF A;  1UT4 A;  1M3Q A;  3ENC A;  1RM1 A;  3CWU A;  3CWT A;  3HS8 A;  3OGD A;  1TBP A;  2JPI A;  2VJ0 A;  2I5W A;  4HJH A;  1C9B B;  1JFI C;  1K2Y X;  3DPT A;  2V9J A;  1QN7 A;  2FKF A;  3D7Q A;  1TGH A;  3C04 A;  3OLP A;  2FGT A;  3TDH A;  1QN8 A;  1R4X A;  1QN6 A;  2HKP A;  4ROD B;  1PCM X;  5IYC P;  1DIZ A;  2HZM A;  2V92 A;  1NH2 A;  3KTU A;  2HL9 A;  2MJ7 A;  1D3U A;  2G30 A;  3T4N A;  2IV9 A;  2Y8Q A;  3OCI A;  2NOZ A;  3I0X A;  1FN7 A;  3ASM A;  5IYD P;  1YQK A;  2DKA A;  1WJW A;  5AN4 A;  1QNE A;  2QR1 A;  2PWW A;  3VN5 A;  4PY5 A;  3ULX A;  3OSE A;  3RPJ A;  4CFF A;  1LWW A;  2R5X A;  2Y8L A;  1LXT A;  3SNS A;  3CVS A;  4EJY A;  2QLV A;  2HZS A;  2H5A X;  5JN5 A;  1NVP A;  3CVT A;  2DKC A;  1HU0 A;  3OH6 A;  1KFI A;  2O3O A;  3IH7 A;  4EAG A;  2JHN A;  4D7Q A;  1T6A A;  5JMV D;  2LAE A;  4MRQ A;  3D4V A;  3H1Z A;  1YQL A;  4QG5 A;  1QTP A;  4ROE B;  2NOB A;  1CDW A;  3EAY A;  3CWS A;  2JOI A;  3ENO C;  1N39 A; 
#chains in the Genus database with same CATH homology
 1N3C A;  4I8O A;  4TPS A;  4DUL A;  1QTS A;  1QN5 A;  3KRM A;  1EBM A;  1E42 A;  2D0C A;  2IV8 A;  1QNA A;  1KY6 A;  1AIS A;  4WZS D;  2NOE A;  1VOK A;  3F0Z A;  2XHI A;  1QN4 A;  1N3A A;  2NOH A;  1LWV A;  1YTB A;  1KYF A;  1KYD A;  3N89 A;  4Q11 A;  2YH5 A;  1M3H A;  1PCZ A;  2NOL A;  1B9K A;  4ROC B;  1KO9 A;  1VTL E;  2Z8U A;  1NGM A;  1QNB A;  5IYB P;  1KYU A;  1LWY A;  3OSM A;  1TBA B;  1UT7 A;  1W80 A;  2D0A A;  3F10 A;  3HS9 A;  1YQR A;  3DPU A;  1QN3 A;  1VTO A;  1VOL B;  1MP9 A;  1PZD A;  1YQM A;  1QNC A;  4EJZ A;  3EIK A;  2NOF A;  1QN9 A;  2D0B A;  1KY7 A;  3OC3 C;  2MZ8 A;  3I0W A;  4B0A A;  1YTF A;  1UT4 A;  1M3Q A;  1RM1 A;  3HS8 A;  1TBP A;  2VJ0 A;  2I5W A;  1C9B B;  1JFI C;  3DPT A;  1QN7 A;  1TGH A;  2FGT A;  1QN8 A;  1R4X A;  1QN6 A;  4ROD B;  5IYC P;  2HZM A;  1NH2 A;  3KTU A;  2MJ7 A;  1D3U A;  2G30 A;  2IV9 A;  2NOZ A;  3OCI A;  3I0X A;  1FN7 A;  3ASM A;  5IYD P;  1YQK A;  5AN4 A;  1QNE A;  4PY5 A;  3VN5 A;  3ULX A;  3RPJ A;  1LWW A;  3SNS A;  4EJY A;  2HZS A;  1NVP A;  1HU0 A;  2O3O A;  3IH7 A;  2LAE A;  3H1Z A;  1YQL A;  1QTP A;  4ROE B;  2NOB A;  1CDW A;  2NOI A;  2JOI A;  3OST A;  1N39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...