3OCIA

Crystal structure of tbp (tata box binding protein)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
179
structure length
179
Chain Sequence
SGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID (TFIID-1)
publication title Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 39
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3ociA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3ociA02
4PY5A 5IYDP 1VOKA 1QNBA 4ROCB 1NH2A 1C9BB 1QNEA 1YTFA 1B9KA 3ASMA 1TGHA 1KYDA 2D0AA 1W80A 1QNAA 1E42A 3H1ZA 4WZSD 2IV9A 1QN9A 1KY6A 1TBPA 1NVPA 1MP9A 1TBAB 3HS8A 3VN5A 3OCIA 2D0CA 2MJ7A 3EIKA 1RM1A 1QTPA 1QNCA 2G30A 1QN6A 1CDWA 1VOLB 1VTLE 1R4XA 2IV8A 1QN8A 1KYUA 1AISA 1QN7A 3OC3C 4RODB 1YTBA 2VJ0A 1KYFA 3HS9A 1JFIC 1D3UA 1PCZA 4B0AA 4ROEB 1NGMA 1QN5A 2Z8UA 1PZDA 2D0BA 1QTSA 1KY7A 5IYCP 1VTOA 1QN4A 5IYBP 1QN3A
chains in the Genus database with same CATH superfamily
1JDYA 1FN7A 2YA3A 4WXAA 3C04A 2NOFA 1LWWA 4C7PA 3N89A 2D0AA 2DKDA 2NOHA 3RPJA 3SNSA 4D7RA 1TUOA 1QN9A 1V5SA 2R5XA 1T6AA 2YH5A 1LWYA 1TBAB 3D7QA 1M3HA 3EAYA 3D4VA 2FKMX 3OCIA 4IL8A 1M3QA 3RSMA 3TDHA 1RM1A 1P5DX 3I3WA 1C47A 1WJWA 2JHJA 1KFQA 3DPTA 1N3CA 1QNCA 1QN6A 1CDWA 3CVTA 4EJZA 1VTLE 1R4XA 2Y8LA 1KYUA 1KO9A 5AN4A 2I5WA 2NVMA 4WX8A 3CWUA 2HKPA 4B0AA 2QRDA 5IYDP 2OOXA 1PZDA 1VTOA 2QRCA 1QN8A 4Q11A 3OSEA 3IH7A 1HU0A 1VOKA 2F7LA 2HZSA 2NOIA 3DPUA 3ASMA 3CVSA 2QLVA 1N3AA 1UT7A 1KYDA 5JMVD 2V92A 1E42A 4WZSD 3CWSA 1WQAA 2IV9A 5BMNA 1TBPA 1NVPA 1MP9A 2LAEA 2QREA 3CWTA 1Q9UA 3F10A 1QTPA 3BKQX 4QG5A 3PMGA 3OSTA 1YQMA 2QR1A 2IV8A 2NLVA 5EPCA 1AISA 2FGTA 4EAKA 4RODB 4EALA 1LXTA 2VJ0A 2XHIA 2NOZA 3UW2A 1PVSA 3PDKA 1TGHA 1M5Q1 1QN5A 2HL9A 1QN4A 2D0BA 2DKAA 1VKLA 4EAGA 3OH6A 2FUVA 2V8QA 1EBMA 1YQKA 3OLPA 4TPSA 1QNBA 4ROCB 1UL7A 1NH2A 2DKCA 2JOIA 1C9BB 1QNEA 1YTFA 3CWAA 2NOLA 3KRMA 4DULA 2V9JA 1P5GX 1J3MA 1PCJX 1XSZA 1W80A 4HJHA 1EUVA 1K35A 3ENOC 1YQLA 1YQRA 5KL0A 4EAIA 4MRQA 2D0CA 2MJ7A 5BMPA 2NOBA 2OOYA 2Y8QA 2G30A 4D7QA 3OC3C 1YTBA 3OGDA 2NOEA 3I0WA 1JFIC 2FKFA 4ROEB 2JHNA 1QTSA 5IYCP 4BJUA 3OH9A 1MPGA 4PY5A 5JN5A 3KTUA 2O3OA 1PCMX 2ZFDB 1B9KA 5F9CA 2H4LX 1LWVA 3ULXA 1QNAA 1K2YX 3H1ZA 3OSMA 1KFIA 2Z0FA 1KY6A 4CFFA 3HS8A 1UT4A 3VN5A 2HL8A 3I0XA 3CW7A 3EIKA 4EJYA 2H5AX 3NA5A 2JPIA 4EAJA 3F0ZA 1VOLB 4I8OA 1DIZA 1QN7A 3T4NA 1KYFA 2NWVA 3HS9A 2PWWA 3TE5A 1PCZA 2HZMA 1NGMA 1N39A 5HSHA 2Z8UA 1D3UA 1C4GA 1QN3A 1KY7A 3ENCA 5IYBP 2EHBD 2MZ8A
chains in the Genus database with same CATH topology
1FN7A 2NOFA 1LWWA 3N89A 2D0AA 2NOHA 3RPJA 3SNSA 1QN9A 2YH5A 1LWYA 1TBAB 1M3HA 1M3QA 3OCIA 1RM1A 1QNCA 3DPTA 1N3CA 1QN6A 1CDWA 4EJZA 1VTLE 1R4XA 1KYUA 1KO9A 5AN4A 2I5WA 4B0AA 5IYDP 1QN8A 1PZDA 1VTOA 4Q11A 3IH7A 1HU0A 1VOKA 2HZSA 2NOIA 3DPUA 3ASMA 1N3AA 1UT7A 1KYDA 1E42A 4WZSD 2IV9A 1TBPA 1NVPA 1MP9A 2LAEA 3F10A 1QTPA 3OSTA 1YQMA 2IV8A 1AISA 2FGTA 4RODB 2VJ0A 2XHIA 2NOZA 1TGHA 1QN5A 1QN4A 2D0BA 1EBMA 1YQKA 4TPSA 1QNBA 4ROCB 1NH2A 2NOLA 1C9BB 2JOIA 1QNEA 1YTFA 3KRMA 4DULA 1W80A 1YQLA 1YQRA 2D0CA 2MJ7A 2NOBA 2G30A 3OC3C 1YTBA 2NOEA 3I0WA 1JFIC 4ROEB 1QTSA 5IYCP 4PY5A 3KTUA 2O3OA 1B9KA 1LWVA 3ULXA 1QNAA 3OSMA 3H1ZA 1KY6A 3HS8A 1UT4A 3VN5A 3I0XA 3EIKA 4EJYA 3F0ZA 1VOLB 4I8OA 1QN7A 1KYFA 3HS9A 1N39A 1PCZA 2HZMA 1NGMA 1D3UA 2Z8UA 1QN3A 1KY7A 5IYBP 2MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PY5 A;  5IYD P;  1VOK A;  1QNB A;  4ROC B;  1NH2 A;  1C9B B;  1QNE A;  1YTF A;  1B9K A;  3ASM A;  1TGH A;  1KYD A;  2D0A A;  1W80 A;  1QNA A;  1E42 A;  3H1Z A;  4WZS D;  2IV9 A;  1QN9 A;  1KY6 A;  1TBP A;  1NVP A;  1MP9 A;  1TBA B;  3HS8 A;  3VN5 A;  3OCI A;  2D0C A;  2MJ7 A;  3EIK A;  1RM1 A;  1QTP A;  1QNC A;  2G30 A;  1QN6 A;  1CDW A;  1VOL B;  1VTL E;  1R4X A;  2IV8 A;  1QN8 A;  1KYU A;  1AIS A;  1QN7 A;  3OC3 C;  4ROD B;  1YTB A;  2VJ0 A;  1KYF A;  3HS9 A;  1JFI C;  1D3U A;  1PCZ A;  4B0A A;  4ROE B;  1NGM A;  1QN5 A;  2Z8U A;  1PZD A;  2D0B A;  1QTS A;  1KY7 A;  5IYC P;  1VTO A;  1QN4 A;  5IYB P;  1QN3 A; 
#chains in the Genus database with same CATH topology
 1JDY A;  1FN7 A;  2YA3 A;  4WXA A;  3C04 A;  2NOF A;  1LWW A;  4C7P A;  3N89 A;  2D0A A;  2DKD A;  2NOH A;  3RPJ A;  3SNS A;  4D7R A;  1TUO A;  1QN9 A;  1V5S A;  2R5X A;  1T6A A;  2YH5 A;  1LWY A;  1TBA B;  3D7Q A;  1M3H A;  3EAY A;  3D4V A;  2FKM X;  3OCI A;  4IL8 A;  1M3Q A;  3RSM A;  3TDH A;  1RM1 A;  1P5D X;  3I3W A;  1C47 A;  1WJW A;  2JHJ A;  1KFQ A;  3DPT A;  1N3C A;  1QNC A;  1QN6 A;  1CDW A;  3CVT A;  4EJZ A;  1VTL E;  1R4X A;  2Y8L A;  1KYU A;  1KO9 A;  5AN4 A;  2I5W A;  2NVM A;  4WX8 A;  3CWU A;  2HKP A;  4B0A A;  2QRD A;  5IYD P;  2OOX A;  1PZD A;  1VTO A;  2QRC A;  1QN8 A;  4Q11 A;  3OSE A;  3IH7 A;  1HU0 A;  1VOK A;  2F7L A;  2HZS A;  2NOI A;  3DPU A;  3ASM A;  3CVS A;  2QLV A;  1N3A A;  1UT7 A;  1KYD A;  5JMV D;  2V92 A;  1E42 A;  4WZS D;  3CWS A;  1WQA A;  2IV9 A;  5BMN A;  1TBP A;  1NVP A;  1MP9 A;  2LAE A;  2QRE A;  3CWT A;  1Q9U A;  3F10 A;  1QTP A;  3BKQ X;  4QG5 A;  3PMG A;  3OST A;  1YQM A;  2QR1 A;  2IV8 A;  2NLV A;  5EPC A;  1AIS A;  2FGT A;  4EAK A;  4ROD B;  4EAL A;  1LXT A;  2VJ0 A;  2XHI A;  2NOZ A;  3UW2 A;  1PVS A;  3PDK A;  1TGH A;  1M5Q 1;  1QN5 A;  2HL9 A;  1QN4 A;  2D0B A;  2DKA A;  1VKL A;  4EAG A;  3OH6 A;  2FUV A;  2V8Q A;  1EBM A;  1YQK A;  3OLP A;  4TPS A;  1QNB A;  4ROC B;  1UL7 A;  1NH2 A;  2DKC A;  2JOI A;  1C9B B;  1QNE A;  1YTF A;  3CWA A;  2NOL A;  3KRM A;  4DUL A;  2V9J A;  1P5G X;  1J3M A;  1PCJ X;  1XSZ A;  1W80 A;  4HJH A;  1EUV A;  1K35 A;  3ENO C;  1YQL A;  1YQR A;  5KL0 A;  4EAI A;  4MRQ A;  2D0C A;  2MJ7 A;  5BMP A;  2NOB A;  2OOY A;  2Y8Q A;  2G30 A;  4D7Q A;  3OC3 C;  1YTB A;  3OGD A;  2NOE A;  3I0W A;  1JFI C;  2FKF A;  4ROE B;  2JHN A;  1QTS A;  5IYC P;  4BJU A;  3OH9 A;  1MPG A;  4PY5 A;  5JN5 A;  3KTU A;  2O3O A;  1PCM X;  2ZFD B;  1B9K A;  5F9C A;  2H4L X;  1LWV A;  3ULX A;  1QNA A;  1K2Y X;  3H1Z A;  3OSM A;  1KFI A;  2Z0F A;  1KY6 A;  4CFF A;  3HS8 A;  1UT4 A;  3VN5 A;  2HL8 A;  3I0X A;  3CW7 A;  3EIK A;  4EJY A;  2H5A X;  3NA5 A;  2JPI A;  4EAJ A;  3F0Z A;  1VOL B;  4I8O A;  1DIZ A;  1QN7 A;  3T4N A;  1KYF A;  2NWV A;  3HS9 A;  2PWW A;  3TE5 A;  1PCZ A;  2HZM A;  1NGM A;  1N39 A;  5HSH A;  2Z8U A;  1D3U A;  1C4G A;  1QN3 A;  1KY7 A;  3ENC A;  5IYB P;  2EHB D;  2MZ8 A; 
#chains in the Genus database with same CATH homology
 1FN7 A;  2NOF A;  1LWW A;  3N89 A;  2D0A A;  2NOH A;  3RPJ A;  3SNS A;  1QN9 A;  2YH5 A;  1LWY A;  1TBA B;  1M3H A;  1M3Q A;  3OCI A;  1RM1 A;  1QNC A;  3DPT A;  1N3C A;  1QN6 A;  1CDW A;  4EJZ A;  1VTL E;  1R4X A;  1KYU A;  1KO9 A;  5AN4 A;  2I5W A;  4B0A A;  5IYD P;  1QN8 A;  1PZD A;  1VTO A;  4Q11 A;  3IH7 A;  1HU0 A;  1VOK A;  2HZS A;  2NOI A;  3DPU A;  3ASM A;  1N3A A;  1UT7 A;  1KYD A;  1E42 A;  4WZS D;  2IV9 A;  1TBP A;  1NVP A;  1MP9 A;  2LAE A;  3F10 A;  1QTP A;  3OST A;  1YQM A;  2IV8 A;  1AIS A;  2FGT A;  4ROD B;  2VJ0 A;  2XHI A;  2NOZ A;  1TGH A;  1QN5 A;  1QN4 A;  2D0B A;  1EBM A;  1YQK A;  4TPS A;  1QNB A;  4ROC B;  1NH2 A;  2NOL A;  1C9B B;  2JOI A;  1QNE A;  1YTF A;  3KRM A;  4DUL A;  1W80 A;  1YQL A;  1YQR A;  2D0C A;  2MJ7 A;  2NOB A;  2G30 A;  3OC3 C;  1YTB A;  2NOE A;  3I0W A;  1JFI C;  4ROE B;  1QTS A;  5IYC P;  4PY5 A;  3KTU A;  2O3O A;  1B9K A;  1LWV A;  3ULX A;  1QNA A;  3OSM A;  3H1Z A;  1KY6 A;  3HS8 A;  1UT4 A;  3VN5 A;  3I0X A;  3EIK A;  4EJY A;  3F0Z A;  1VOL B;  4I8O A;  1QN7 A;  1KYF A;  3HS9 A;  1N39 A;  1PCZ A;  2HZM A;  1NGM A;  1D3U A;  2Z8U A;  1QN3 A;  1KY7 A;  5IYB P;  2MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...