3SNSA

Crystal structure of the c-terminal domain of escherichia coli lipoprotein bamc
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
120
structure length
119
Chain Sequence
ASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Lipoprotein 34
publication title Crystallographic analysis of the C-terminal domain of the Escherichia coli lipoprotein BamC.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.170 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3snsA00
3SNSA 2LAEA 2YH5A
chains in the Genus database with same CATH superfamily
1KFIA 1QN6A 4EJZA 3RPJA 4DULA 5HSHA 1UT7A 3DPTA 1PVSA 1UT4A 2NOHA 1QNEA 2NOFA 3OCIA 1KYUA 2OOXA 1N3AA 3D7QA 4PY5A 2NOIA 1HU0A 2DKCA 1P5GX 2MJ7A 3OH9A 5BMPA 1D3UA 3ULXA 1B9KA 1QTPA 2FUVA 1DIZA 1QN5A 4EAJA 1QTSA 3N89A 2OOYA 4D7RA 1M5Q1 2O3OA 1C4GA 5IYCP 3HS8A 1AISA 1QN7A 1N39A 4ROEB 3CWUA 1Q9UA 3CWTA 3I0XA 1PCMX 1C9BB 1YQMA 2XHIA 3CVTA 4Q11A 1WQAA 1KFQA 1PZDA 1VTLE 2HKPA 1QNCA 2MZ8A 1M3HA 2QR1A 3F10A 2HL8A 2D0AA 3HS9A 2EHBD 3OSTA 3TDHA 1MPGA 1QN8A 1LXTA 4EALA 3OH6A 5AN4A 3RSMA 5IYBP 3I0WA 2NOEA 3C04A 1EUVA 1KY6A 3CW7A 2HZSA 3OSMA 4IL8A 3T4NA 5EPCA 1KYFA 4CFFA 2DKDA 4C7PA 2FKMX 1YQLA 1NH2A 1QNAA 3I3WA 2JOIA 2NWVA 3EIKA 2DKAA 1WJWA 2D0CA 2IV8A 3OC3C 3SNSA 4RODB 2HL9A 1MP9A 2LAEA 1NGMA 1W80A 2F7LA 1QN4A 2IV9A 1M3QA 1YQRA 3NA5A 4WZSD 3D4VA 3KRMA 2V9JA 1VOLB 4BJUA 4EAGA 3CWAA 2HZMA 1K2YX 1JDYA 1LWWA 5IYDP 2R5XA 1LWVA 1C47A 2Y8LA 3OSEA 4I8OA 5JN5A 1NVPA 3H1ZA 2FKFA 4B0AA 3UW2A 1E42A 4QG5A 1TBPA 2PWWA 2QRCA 2QREA 3BKQX 1J3MA 3ASMA 3PDKA 2Z0FA 1P5DX 1PCZA 1KYDA 2JPIA 2D0BA 2NVMA 1LWYA 2Z8UA 4ROCB 2NOLA 4MRQA 2Y8QA 1K35A 4WX8A 2NOBA 1CDWA 2NOZA 1VTOA 1N3CA 3EAYA 2FGTA 3CWSA 1R4XA 3OGDA 1QNBA 1TGHA 1XSZA 3OLPA 1VKLA 1PCJX 2YH5A 4D7QA 5JMVD 3TE5A 2NLVA 3IH7A 5BMNA 1YTBA 2QLVA 1T6AA 2G30A 1JFIC 1VOKA 5KL0A 2QRDA 3ENCA 1UL7A 1YQKA 5F9CA 3VN5A 1KY7A 1QN9A 2JHNA 3PMGA 1KO9A 1EBMA 1YTFA 2H4LX 2ZFDB 1V5SA 4EAIA 3CVSA 2I5WA 3F0ZA 4WXAA 4EJYA 2YA3A 4HJHA 4TPSA 3KTUA 4EAKA 2VJ0A 3DPUA 1FN7A 1TBAB 1QN3A 1TUOA 1RM1A 2V8QA 2JHJA 2H5AX 2V92A 3ENOC
chains in the Genus database with same CATH topology
1QN6A 4EJZA 3RPJA 4DULA 1UT7A 3DPTA 1UT4A 2NOHA 1QNEA 2NOFA 3OCIA 1KYUA 1N3AA 4PY5A 2NOIA 1HU0A 2MJ7A 1D3UA 3ULXA 1B9KA 1QTPA 1QN5A 1QTSA 3N89A 2O3OA 5IYCP 1QN7A 3HS8A 1AISA 1N39A 4ROEB 3I0XA 1C9BB 1YQMA 2XHIA 4Q11A 1VTLE 1QNCA 1PZDA 2MZ8A 1M3HA 3F10A 2D0AA 3HS9A 3OSTA 1QN8A 2NOEA 5AN4A 5IYBP 3I0WA 1KY6A 2HZSA 3OSMA 1KYFA 1YQLA 1NH2A 1QNAA 2JOIA 3EIKA 2D0CA 2IV8A 3OC3C 3SNSA 4RODB 1MP9A 2LAEA 1NGMA 1W80A 1QN4A 2IV9A 1M3QA 1YQRA 4WZSD 3KRMA 1VOLB 2HZMA 1LWWA 5IYDP 1LWVA 4I8OA 1NVPA 3H1ZA 4B0AA 1E42A 1TBPA 3ASMA 1PCZA 1KYDA 2D0BA 1LWYA 2Z8UA 4ROCB 2NOLA 2NOBA 1CDWA 2NOZA 1VTOA 1N3CA 2FGTA 1R4XA 1QNBA 1TGHA 2YH5A 3IH7A 1YTBA 2G30A 1JFIC 1VOKA 1YQKA 3VN5A 1KY7A 1QN9A 1KO9A 1EBMA 1YTFA 2I5WA 4EJYA 3F0ZA 3KTUA 4TPSA 1QN3A 2VJ0A 3DPUA 1FN7A 1TBAB 1RM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNS A;  2LAE A;  2YH5 A; 
#chains in the Genus database with same CATH topology
 1KFI A;  1QN6 A;  4EJZ A;  3RPJ A;  4DUL A;  5HSH A;  1UT7 A;  3DPT A;  1PVS A;  1UT4 A;  2NOH A;  1QNE A;  2NOF A;  3OCI A;  1KYU A;  2OOX A;  1N3A A;  3D7Q A;  4PY5 A;  2NOI A;  1HU0 A;  2DKC A;  1P5G X;  2MJ7 A;  3OH9 A;  5BMP A;  1D3U A;  3ULX A;  1B9K A;  1QTP A;  2FUV A;  1DIZ A;  1QN5 A;  4EAJ A;  1QTS A;  3N89 A;  2OOY A;  4D7R A;  1M5Q 1;  2O3O A;  1C4G A;  5IYC P;  3HS8 A;  1AIS A;  1QN7 A;  1N39 A;  4ROE B;  3CWU A;  1Q9U A;  3CWT A;  3I0X A;  1PCM X;  1C9B B;  1YQM A;  2XHI A;  3CVT A;  4Q11 A;  1WQA A;  1KFQ A;  1PZD A;  1VTL E;  2HKP A;  1QNC A;  2MZ8 A;  1M3H A;  2QR1 A;  3F10 A;  2HL8 A;  2D0A A;  3HS9 A;  2EHB D;  3OST A;  3TDH A;  1MPG A;  1QN8 A;  1LXT A;  4EAL A;  3OH6 A;  5AN4 A;  3RSM A;  5IYB P;  3I0W A;  2NOE A;  3C04 A;  1EUV A;  1KY6 A;  3CW7 A;  2HZS A;  3OSM A;  4IL8 A;  3T4N A;  5EPC A;  1KYF A;  4CFF A;  2DKD A;  4C7P A;  2FKM X;  1YQL A;  1NH2 A;  1QNA A;  3I3W A;  2JOI A;  2NWV A;  3EIK A;  2DKA A;  1WJW A;  2D0C A;  2IV8 A;  3OC3 C;  3SNS A;  4ROD B;  2HL9 A;  1MP9 A;  2LAE A;  1NGM A;  1W80 A;  2F7L A;  1QN4 A;  2IV9 A;  1M3Q A;  1YQR A;  3NA5 A;  4WZS D;  3D4V A;  3KRM A;  2V9J A;  1VOL B;  4BJU A;  4EAG A;  3CWA A;  2HZM A;  1K2Y X;  1JDY A;  1LWW A;  5IYD P;  2R5X A;  1LWV A;  1C47 A;  2Y8L A;  3OSE A;  4I8O A;  5JN5 A;  1NVP A;  3H1Z A;  2FKF A;  4B0A A;  3UW2 A;  1E42 A;  4QG5 A;  1TBP A;  2PWW A;  2QRC A;  2QRE A;  3BKQ X;  1J3M A;  3ASM A;  3PDK A;  2Z0F A;  1P5D X;  1PCZ A;  1KYD A;  2JPI A;  2D0B A;  2NVM A;  1LWY A;  2Z8U A;  4ROC B;  2NOL A;  4MRQ A;  2Y8Q A;  1K35 A;  4WX8 A;  2NOB A;  1CDW A;  2NOZ A;  1VTO A;  1N3C A;  3EAY A;  2FGT A;  3CWS A;  1R4X A;  3OGD A;  1QNB A;  1TGH A;  1XSZ A;  3OLP A;  1VKL A;  1PCJ X;  2YH5 A;  4D7Q A;  5JMV D;  3TE5 A;  2NLV A;  3IH7 A;  5BMN A;  1YTB A;  2QLV A;  1T6A A;  2G30 A;  1JFI C;  1VOK A;  5KL0 A;  2QRD A;  3ENC A;  1UL7 A;  1YQK A;  5F9C A;  3VN5 A;  1KY7 A;  1QN9 A;  2JHN A;  3PMG A;  1KO9 A;  1EBM A;  1YTF A;  2H4L X;  2ZFD B;  1V5S A;  4EAI A;  3CVS A;  2I5W A;  3F0Z A;  4WXA A;  4EJY A;  2YA3 A;  4HJH A;  4TPS A;  3KTU A;  4EAK A;  2VJ0 A;  3DPU A;  1FN7 A;  1TBA B;  1QN3 A;  1TUO A;  1RM1 A;  2V8Q A;  2JHJ A;  2H5A X;  2V92 A;  3ENO C; 
#chains in the Genus database with same CATH homology
 1QN6 A;  4EJZ A;  3RPJ A;  4DUL A;  1UT7 A;  3DPT A;  1UT4 A;  2NOH A;  1QNE A;  2NOF A;  3OCI A;  1KYU A;  1N3A A;  4PY5 A;  2NOI A;  1HU0 A;  2MJ7 A;  1D3U A;  3ULX A;  1B9K A;  1QTP A;  1QN5 A;  1QTS A;  3N89 A;  2O3O A;  5IYC P;  1QN7 A;  3HS8 A;  1AIS A;  1N39 A;  4ROE B;  3I0X A;  1C9B B;  1YQM A;  2XHI A;  4Q11 A;  1VTL E;  1QNC A;  1PZD A;  2MZ8 A;  1M3H A;  3F10 A;  2D0A A;  3HS9 A;  3OST A;  1QN8 A;  2NOE A;  5AN4 A;  5IYB P;  3I0W A;  1KY6 A;  2HZS A;  3OSM A;  1KYF A;  1YQL A;  1NH2 A;  1QNA A;  2JOI A;  3EIK A;  2D0C A;  2IV8 A;  3OC3 C;  3SNS A;  4ROD B;  1MP9 A;  2LAE A;  1NGM A;  1W80 A;  1QN4 A;  2IV9 A;  1M3Q A;  1YQR A;  4WZS D;  3KRM A;  1VOL B;  2HZM A;  1LWW A;  5IYD P;  1LWV A;  4I8O A;  1NVP A;  3H1Z A;  4B0A A;  1E42 A;  1TBP A;  3ASM A;  1PCZ A;  1KYD A;  2D0B A;  1LWY A;  2Z8U A;  4ROC B;  2NOL A;  2NOB A;  1CDW A;  2NOZ A;  1VTO A;  1N3C A;  2FGT A;  1R4X A;  1QNB A;  1TGH A;  2YH5 A;  3IH7 A;  1YTB A;  2G30 A;  1JFI C;  1VOK A;  1YQK A;  3VN5 A;  1KY7 A;  1QN9 A;  1KO9 A;  1EBM A;  1YTF A;  2I5W A;  4EJY A;  3F0Z A;  3KTU A;  4TPS A;  1QN3 A;  2VJ0 A;  3DPU A;  1FN7 A;  1TBA B;  1RM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...