3SNSA

Crystal structure of the c-terminal domain of escherichia coli lipoprotein bamc
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
120
structure length
119
Chain Sequence
ASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lipoprotein 34
publication title Crystallographic analysis of the C-terminal domain of the Escherichia coli lipoprotein BamC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 32
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.170 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3snsA00
2LAEA 2YH5A 3SNSA
chains in the Genus database with same CATH superfamily
1QNAA 2NOHA 2NOZA 4IL8A 1KO9A 3I0WA 3CVSA 1DIZA 3F0ZA 1YTFA 1XSZA 3IH7A 2HKPA 1QN6A 2Y8LA 1NVPA 2ZFDB 2FKFA 1LXTA 2H4LX 1QN7A 1VOLB 1QN5A 2JPIA 2NOFA 1CDWA 3ENOC 1YTBA 2QR1A 3OC3C 1PVSA 2NOBA 4EAGA 1RM1A 1AISA 3EAYA 5IYBP 1JFIC 2Z8UA 1KYUA 4EAKA 4HJHA 2NOLA 1QNCA 1B9KA 4DULA 1QN3A 1W80A 2NVMA 4ROCB 1TGHA 2V9JA 2YA3A 4RODB 1V5SA 3H1ZA 2DKDA 2JHJA 1VOKA 2XHIA 5IYDP 3OSTA 2DKAA 2JOIA 1YQRA 3DPUA 3CWUA 1VKLA 1C47A 4C7PA 1K2YX 3UW2A 1TBAB 2O3OA 4EALA 2QREA 1UL7A 3ASMA 2IV8A 2H5AX 3OH9A 1KY7A 4EAIA 3OH6A 2FGTA 3CVTA 2FUVA 2FKMX 2EHBD 3N89A 4QG5A 2NOIA 3VN5A 2OOYA 5JN5A 2HL8A 3CWTA 1N3AA 1KY6A 3NA5A 4D7RA 3OCIA 4EJYA 3T4NA 1YQKA 4PY5A 1PCMX 3HS8A 3KTUA 1HU0A 5BMNA 1TBPA 1D3UA 5EPCA 1MPGA 1VTLE 1KYDA 2HL9A 3ULXA 2I5WA 3EIKA 3PDKA 5BMPA 1QN9A 4WX8A 1TUOA 4Q11A 1WQAA 1QN4A 1KFQA 2IV9A 2MZ8A 2MJ7A 1J3MA 1KFIA 1PZDA 1C9BB 2D0CA 1YQLA 2D0BA 1QNEA 2G30A 2V8QA 1LWYA 2YH5A 4ROEB 2OOXA 1M5Q1 4WZSD 3CWAA 2Y8QA 5AN4A 2LAEA 1K35A 3C04A 1NH2A 4MRQA 4EAJA 4B0AA 3ENCA 3CWSA 3CW7A 1LWVA 1FN7A 4I8OA 1P5GX 1QNBA 3I3WA 1PCJX 4D7QA 1MP9A 1T6AA 2QLVA 1PCZA 2V92A 3SNSA 5HSHA 2HZSA 4EJZA 5KL0A 1EUVA 2PWWA 2QRCA 3D4VA 3BKQX 3HS9A 1VTOA 2D0AA 2NLVA 3RPJA 1N3CA 2NWVA 3OSMA 3KRMA 3TDHA 1YQMA 1M3QA 1EBMA 3I0XA 3PMGA 5IYCP 1M3HA 2F7LA 3OSEA 2DKCA 2QRDA 3OGDA 1LWWA 1N39A 4BJUA 3F10A 1Q9UA 3TE5A 1UT4A 1C4GA 2Z0FA 1NGMA 5JMVD 2VJ0A 3DPTA 1UT7A 4CFFA 3RSMA 1WJWA 2JHNA 3D7QA 1KYFA 2R5XA 3OLPA 5F9CA 4TPSA 4WXAA 2HZMA 1JDYA 1P5DX 1E42A 1QTPA 1QTSA 1R4XA 1QN8A 2NOEA
chains in the Genus database with same CATH topology
1QNAA 2NOHA 2NOZA 1KO9A 3I0WA 3F0ZA 1YTFA 3IH7A 1QN6A 1NVPA 1VOLB 1QN7A 1QN5A 2NOFA 1CDWA 1YTBA 3OC3C 2NOBA 1RM1A 1AISA 5IYBP 1JFIC 2Z8UA 1KYUA 2NOLA 1QNCA 1B9KA 4DULA 1QN3A 1W80A 4ROCB 1TGHA 4RODB 3H1ZA 1VOKA 2XHIA 5IYDP 3OSTA 2JOIA 1YQRA 3DPUA 1TBAB 2O3OA 3ASMA 2IV8A 1KY7A 2FGTA 3N89A 2NOIA 3VN5A 1N3AA 1KY6A 3OCIA 4EJYA 1YQKA 4PY5A 3HS8A 3KTUA 1HU0A 1TBPA 1D3UA 1VTLE 1KYDA 3ULXA 2I5WA 3EIKA 1QN9A 4Q11A 1QN4A 2IV9A 2MZ8A 2MJ7A 1PZDA 1C9BB 2D0CA 1YQLA 2D0BA 1QNEA 2G30A 1LWYA 2YH5A 4ROEB 4WZSD 5AN4A 2LAEA 1NH2A 4B0AA 1LWVA 1FN7A 4I8OA 1QNBA 1MP9A 1PCZA 3SNSA 2HZSA 4EJZA 3HS9A 1VTOA 2D0AA 3RPJA 1N3CA 3OSMA 1YQMA 3KRMA 1M3QA 1EBMA 3I0XA 5IYCP 1M3HA 1LWWA 1N39A 3F10A 1UT4A 1NGMA 2VJ0A 3DPTA 1UT7A 1KYFA 4TPSA 2HZMA 1E42A 1QTPA 1QTSA 1R4XA 1QN8A 2NOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAE A;  2YH5 A;  3SNS A; 
#chains in the Genus database with same CATH topology
 1QNA A;  2NOH A;  2NOZ A;  4IL8 A;  1KO9 A;  3I0W A;  3CVS A;  1DIZ A;  3F0Z A;  1YTF A;  1XSZ A;  3IH7 A;  2HKP A;  1QN6 A;  2Y8L A;  1NVP A;  2ZFD B;  2FKF A;  1LXT A;  2H4L X;  1QN7 A;  1VOL B;  1QN5 A;  2JPI A;  2NOF A;  1CDW A;  3ENO C;  1YTB A;  2QR1 A;  3OC3 C;  1PVS A;  2NOB A;  4EAG A;  1RM1 A;  1AIS A;  3EAY A;  5IYB P;  1JFI C;  2Z8U A;  1KYU A;  4EAK A;  4HJH A;  2NOL A;  1QNC A;  1B9K A;  4DUL A;  1QN3 A;  1W80 A;  2NVM A;  4ROC B;  1TGH A;  2V9J A;  2YA3 A;  4ROD B;  1V5S A;  3H1Z A;  2DKD A;  2JHJ A;  1VOK A;  2XHI A;  5IYD P;  3OST A;  2DKA A;  2JOI A;  1YQR A;  3DPU A;  3CWU A;  1VKL A;  1C47 A;  4C7P A;  1K2Y X;  3UW2 A;  1TBA B;  2O3O A;  4EAL A;  2QRE A;  1UL7 A;  3ASM A;  2IV8 A;  2H5A X;  3OH9 A;  1KY7 A;  4EAI A;  3OH6 A;  2FGT A;  3CVT A;  2FUV A;  2FKM X;  2EHB D;  3N89 A;  4QG5 A;  2NOI A;  3VN5 A;  2OOY A;  5JN5 A;  2HL8 A;  3CWT A;  1N3A A;  1KY6 A;  3NA5 A;  4D7R A;  3OCI A;  4EJY A;  3T4N A;  1YQK A;  4PY5 A;  1PCM X;  3HS8 A;  3KTU A;  1HU0 A;  5BMN A;  1TBP A;  1D3U A;  5EPC A;  1MPG A;  1VTL E;  1KYD A;  2HL9 A;  3ULX A;  2I5W A;  3EIK A;  3PDK A;  5BMP A;  1QN9 A;  4WX8 A;  1TUO A;  4Q11 A;  1WQA A;  1QN4 A;  1KFQ A;  2IV9 A;  2MZ8 A;  2MJ7 A;  1J3M A;  1KFI A;  1PZD A;  1C9B B;  2D0C A;  1YQL A;  2D0B A;  1QNE A;  2G30 A;  2V8Q A;  1LWY A;  2YH5 A;  4ROE B;  2OOX A;  1M5Q 1;  4WZS D;  3CWA A;  2Y8Q A;  5AN4 A;  2LAE A;  1K35 A;  3C04 A;  1NH2 A;  4MRQ A;  4EAJ A;  4B0A A;  3ENC A;  3CWS A;  3CW7 A;  1LWV A;  1FN7 A;  4I8O A;  1P5G X;  1QNB A;  3I3W A;  1PCJ X;  4D7Q A;  1MP9 A;  1T6A A;  2QLV A;  1PCZ A;  2V92 A;  3SNS A;  5HSH A;  2HZS A;  4EJZ A;  5KL0 A;  1EUV A;  2PWW A;  2QRC A;  3D4V A;  3BKQ X;  3HS9 A;  1VTO A;  2D0A A;  2NLV A;  3RPJ A;  1N3C A;  2NWV A;  3OSM A;  3KRM A;  3TDH A;  1YQM A;  1M3Q A;  1EBM A;  3I0X A;  3PMG A;  5IYC P;  1M3H A;  2F7L A;  3OSE A;  2DKC A;  2QRD A;  3OGD A;  1LWW A;  1N39 A;  4BJU A;  3F10 A;  1Q9U A;  3TE5 A;  1UT4 A;  1C4G A;  2Z0F A;  1NGM A;  5JMV D;  2VJ0 A;  3DPT A;  1UT7 A;  4CFF A;  3RSM A;  1WJW A;  2JHN A;  3D7Q A;  1KYF A;  2R5X A;  3OLP A;  5F9C A;  4TPS A;  4WXA A;  2HZM A;  1JDY A;  1P5D X;  1E42 A;  1QTP A;  1QTS A;  1R4X A;  1QN8 A;  2NOE A; 
#chains in the Genus database with same CATH homology
 1QNA A;  2NOH A;  2NOZ A;  1KO9 A;  3I0W A;  3F0Z A;  1YTF A;  3IH7 A;  1QN6 A;  1NVP A;  1VOL B;  1QN7 A;  1QN5 A;  2NOF A;  1CDW A;  1YTB A;  3OC3 C;  2NOB A;  1RM1 A;  1AIS A;  5IYB P;  1JFI C;  2Z8U A;  1KYU A;  2NOL A;  1QNC A;  1B9K A;  4DUL A;  1QN3 A;  1W80 A;  4ROC B;  1TGH A;  4ROD B;  3H1Z A;  1VOK A;  2XHI A;  5IYD P;  3OST A;  2JOI A;  1YQR A;  3DPU A;  1TBA B;  2O3O A;  3ASM A;  2IV8 A;  1KY7 A;  2FGT A;  3N89 A;  2NOI A;  3VN5 A;  1N3A A;  1KY6 A;  3OCI A;  4EJY A;  1YQK A;  4PY5 A;  3HS8 A;  3KTU A;  1HU0 A;  1TBP A;  1D3U A;  1VTL E;  1KYD A;  3ULX A;  2I5W A;  3EIK A;  1QN9 A;  4Q11 A;  1QN4 A;  2IV9 A;  2MZ8 A;  2MJ7 A;  1PZD A;  1C9B B;  2D0C A;  1YQL A;  2D0B A;  1QNE A;  2G30 A;  1LWY A;  2YH5 A;  4ROE B;  4WZS D;  5AN4 A;  2LAE A;  1NH2 A;  4B0A A;  1LWV A;  1FN7 A;  4I8O A;  1QNB A;  1MP9 A;  1PCZ A;  3SNS A;  2HZS A;  4EJZ A;  3HS9 A;  1VTO A;  2D0A A;  3RPJ A;  1N3C A;  3OSM A;  1YQM A;  3KRM A;  1M3Q A;  1EBM A;  3I0X A;  5IYC P;  1M3H A;  1LWW A;  1N39 A;  3F10 A;  1UT4 A;  1NGM A;  2VJ0 A;  3DPT A;  1UT7 A;  1KYF A;  4TPS A;  2HZM A;  1E42 A;  1QTP A;  1QTS A;  1R4X A;  1QN8 A;  2NOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...