2NWVA

Crystal structure of xisi protein-like (yp_323822.1) from anabaena variabilis atcc 29413 at 1.85 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
DNVAEYRKLIKQVLTEYDNLSRQSPETNYETCLVFDENHDNYLWLAVDWQGSKRIKYTYVHIRIKNEKIYIEEDYTEEGIATELMRLGVTNNDIVLAFHPPDVRKFTDFATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics/unknown function
molecule keywords XisI protein-like
publication title Site-specific recombination of nitrogen-fixation genes in cyanobacteria by XisF-XisH-XisI complex: Structures and models.
pubmed doi rcsb
source organism Anabaena variabilis
total genus 33
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08869 XisI XisI protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.110 Alpha Beta 2-Layer Sandwich TATA-Binding Protein XisI-like 2nwvA00
2NLVA 3D7QA 2NWVA 2NVMA
chains in the Genus database with same CATH superfamily
1MPGA 5KL0A 3ENOC 2V92A 2NOBA 2H4LX 2QRDA 3OSMA 1QN9A 2Z8UA 1QN7A 1PZDA 1QTSA 3RSMA 2R5XA 1UT4A 4RODB 1TGHA 1DIZA 2DKCA 1QNEA 2I5WA 2NWVA 1QN3A 3I0WA 1LWVA 1UL7A 1N3CA 5JMVD 4PY5A 2NOIA 3KTUA 5AN4A 1NVPA 2LAEA 3PDKA 5IYDP 2QREA 1Q9UA 2O3OA 3OC3C 1KFIA 1TBPA 2D0CA 1PVSA 4ROCB 2JOIA 5IYCP 1P5GX 1QN4A 2Y8LA 5BMPA 5HSHA 1E42A 4EJZA 2PWWA 3HS8A 2QR1A 4EJYA 3TE5A 2OOYA 5IYBP 4BJUA 1KO9A 3EAYA 3T4NA 2FGTA 1R4XA 1WQAA 1WJWA 4TPSA 1VTOA 2NVMA 3OGDA 2ZFDB 1LWWA 4I8OA 5EPCA 2VJ0A 2YH5A 3DPTA 1C47A 1NGMA 1M3QA 1YQLA 1QN8A 3D7QA 2NOFA 4WX8A 2EHBD 3CWUA 1B9KA 2JHJA 4DULA 3CW7A 2JHNA 1KYUA 2Z0FA 5F9CA 1UT7A 1QNCA 1PCJX 1VKLA 3ULXA 3CVSA 1T6AA 1MP9A 3OH6A 1VTLE 1RM1A 1D3UA 4B0AA 4CFFA 2NOLA 2DKAA 2D0BA 2FUVA 2HL8A 3SNSA 1YTBA 1XSZA 1K2YX 1YQKA 2IV9A 2NOZA 2HKPA 3TDHA 3ENCA 3OH9A 1FN7A 1M5Q1 1VOKA 1W80A 1EUVA 1LXTA 1KY7A 2DKDA 2HZSA 2V9JA 3KRMA 2YA3A 4EAJA 2NOEA 3OLPA 3CVTA 3OSEA 3EIKA 1PCMX 3H1ZA 1QNBA 1QN5A 2H5AX 4WZSD 1N39A 2NOHA 3N89A 3I3WA 1KYDA 1VOLB 2F7LA 4ROEB 1LWYA 1P5DX 2FKFA 4HJHA 1KFQA 2OOXA 2QLVA 4EAIA 2HL9A 1C9BB 4WXAA 2FKMX 1EBMA 1K35A 4EAGA 1N3AA 3IH7A 3CWSA 4MRQA 2XHIA 3OSTA 1YQMA 3UW2A 3BKQX 1QN6A 4IL8A 4D7QA 1JDYA 3D4VA 4EALA 2G30A 4Q11A 3VN5A 3CWTA 1HU0A 3OCIA 1QNAA 1QTPA 1V5SA 3HS9A 1YTFA 3F10A 2V8QA 2D0AA 3RPJA 3F0ZA 3PMGA 2JPIA 1M3HA 1AISA 2MZ8A 2QRCA 4D7RA 2NLVA 1KY6A 3C04A 3I0XA 3CWAA 1YQRA 5BMNA 1NH2A 3NA5A 5JN5A 2Y8QA 1JFIC 1CDWA 1J3MA 1TBAB 1C4GA 4EAKA 3ASMA 1TUOA 2IV8A 4C7PA 1KYFA 2MJ7A 3DPUA 4QG5A 1PCZA 2HZMA
chains in the Genus database with same CATH topology
2NLVA 3D7QA 2NWVA 2NVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NLV A;  3D7Q A;  2NWV A;  2NVM A; 
#chains in the Genus database with same CATH topology
 1MPG A;  5KL0 A;  3ENO C;  2V92 A;  2NOB A;  2H4L X;  2QRD A;  3OSM A;  1QN9 A;  2Z8U A;  1QN7 A;  1PZD A;  1QTS A;  3RSM A;  2R5X A;  1UT4 A;  4ROD B;  1TGH A;  1DIZ A;  2DKC A;  1QNE A;  2I5W A;  2NWV A;  1QN3 A;  3I0W A;  1LWV A;  1UL7 A;  1N3C A;  5JMV D;  4PY5 A;  2NOI A;  3KTU A;  5AN4 A;  1NVP A;  2LAE A;  3PDK A;  5IYD P;  2QRE A;  1Q9U A;  2O3O A;  3OC3 C;  1KFI A;  1TBP A;  2D0C A;  1PVS A;  4ROC B;  2JOI A;  5IYC P;  1P5G X;  1QN4 A;  2Y8L A;  5BMP A;  5HSH A;  1E42 A;  4EJZ A;  2PWW A;  3HS8 A;  2QR1 A;  4EJY A;  3TE5 A;  2OOY A;  5IYB P;  4BJU A;  1KO9 A;  3EAY A;  3T4N A;  2FGT A;  1R4X A;  1WQA A;  1WJW A;  4TPS A;  1VTO A;  2NVM A;  3OGD A;  2ZFD B;  1LWW A;  4I8O A;  5EPC A;  2VJ0 A;  2YH5 A;  3DPT A;  1C47 A;  1NGM A;  1M3Q A;  1YQL A;  1QN8 A;  3D7Q A;  2NOF A;  4WX8 A;  2EHB D;  3CWU A;  1B9K A;  2JHJ A;  4DUL A;  3CW7 A;  2JHN A;  1KYU A;  2Z0F A;  5F9C A;  1UT7 A;  1QNC A;  1PCJ X;  1VKL A;  3ULX A;  3CVS A;  1T6A A;  1MP9 A;  3OH6 A;  1VTL E;  1RM1 A;  1D3U A;  4B0A A;  4CFF A;  2NOL A;  2DKA A;  2D0B A;  2FUV A;  2HL8 A;  3SNS A;  1YTB A;  1XSZ A;  1K2Y X;  1YQK A;  2IV9 A;  2NOZ A;  2HKP A;  3TDH A;  3ENC A;  3OH9 A;  1FN7 A;  1M5Q 1;  1VOK A;  1W80 A;  1EUV A;  1LXT A;  1KY7 A;  2DKD A;  2HZS A;  2V9J A;  3KRM A;  2YA3 A;  4EAJ A;  2NOE A;  3OLP A;  3CVT A;  3OSE A;  3EIK A;  1PCM X;  3H1Z A;  1QNB A;  1QN5 A;  2H5A X;  4WZS D;  1N39 A;  2NOH A;  3N89 A;  3I3W A;  1KYD A;  1VOL B;  2F7L A;  4ROE B;  1LWY A;  1P5D X;  2FKF A;  4HJH A;  1KFQ A;  2OOX A;  2QLV A;  4EAI A;  2HL9 A;  1C9B B;  4WXA A;  2FKM X;  1EBM A;  1K35 A;  4EAG A;  1N3A A;  3IH7 A;  3CWS A;  4MRQ A;  2XHI A;  3OST A;  1YQM A;  3UW2 A;  3BKQ X;  1QN6 A;  4IL8 A;  4D7Q A;  1JDY A;  3D4V A;  4EAL A;  2G30 A;  4Q11 A;  3VN5 A;  3CWT A;  1HU0 A;  3OCI A;  1QNA A;  1QTP A;  1V5S A;  3HS9 A;  1YTF A;  3F10 A;  2V8Q A;  2D0A A;  3RPJ A;  3F0Z A;  3PMG A;  2JPI A;  1M3H A;  1AIS A;  2MZ8 A;  2QRC A;  4D7R A;  2NLV A;  1KY6 A;  3C04 A;  3I0X A;  3CWA A;  1YQR A;  5BMN A;  1NH2 A;  3NA5 A;  5JN5 A;  2Y8Q A;  1JFI C;  1CDW A;  1J3M A;  1TBA B;  1C4G A;  4EAK A;  3ASM A;  1TUO A;  2IV8 A;  4C7P A;  1KYF A;  2MJ7 A;  3DPU A;  4QG5 A;  1PCZ A;  2HZM A; 
#chains in the Genus database with same CATH homology
 2NLV A;  3D7Q A;  2NWV A;  2NVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...