2NWVA

Crystal structure of xisi protein-like (yp_323822.1) from anabaena variabilis atcc 29413 at 1.85 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
DNVAEYRKLIKQVLTEYDNLSRQSPETNYETCLVFDENHDNYLWLAVDWQGSKRIKYTYVHIRIKNEKIYIEEDYTEEGIATELMRLGVTNNDIVLAFHPPDVRKFTDFATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XisI protein-like
publication title Site-specific recombination of nitrogen-fixation genes in cyanobacteria by XisF-XisH-XisI complex: Structures and models.
pubmed doi rcsb
source organism Anabaena variabilis
molecule tags Structural genomics/unknown function
total genus 33
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08869 XisI XisI protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.110 Alpha Beta 2-Layer Sandwich TATA-Binding Protein XisI-like 2nwvA00
2NVMA 3D7QA 2NLVA 2NWVA
chains in the Genus database with same CATH superfamily
1TBAB 1PZDA 1PVSA 4EAIA 5IYBP 5HSHA 2NVMA 1CDWA 1VKLA 3VN5A 1EUVA 1PCJX 2HKPA 3KRMA 1KO9A 3CWAA 1XSZA 2V9JA 1UT7A 1TBPA 3OCIA 1C47A 2IV9A 1FN7A 3PMGA 1W80A 2VJ0A 1KYFA 1VTOA 2D0BA 3TDHA 2MZ8A 2Z0FA 1LWYA 1QNAA 1QNEA 3CWSA 4CFFA 2HZSA 4D7QA 4RODB 1HU0A 1JFIC 1TGHA 4WXAA 3I0XA 2H5AX 3NA5A 3H1ZA 1DIZA 1P5DX 3I0WA 3DPUA 2IV8A 1WJWA 2FKFA 4IL8A 2JPIA 1M5Q1 1B9KA 1NH2A 2OOXA 1YQRA 3RSMA 1QN5A 5JMVD 2V92A 3ENCA 1M3HA 2ZFDB 2DKAA 2FKMX 2QR1A 3CVTA 4TPSA 1M3QA 1MPGA 1JDYA 2Z8UA 1QN7A 1UL7A 2NOIA 5EPCA 2QLVA 4DULA 4EALA 5BMNA 2G30A 3CWUA 2I5WA 3OSEA 1KYDA 1KFIA 1MP9A 3ENOC 4ROCB 4C7PA 1K35A 2Y8QA 3F10A 3HS9A 2NOBA 1VOKA 2OOYA 1YTFA 3OSTA 1RM1A 2D0AA 1T6AA 1LXTA 3TE5A 5F9CA 4I8OA 3DPTA 3OH6A 3OC3C 1Q9UA 3SNSA 1LWWA 1C9BB 1PCMX 2R5XA 1WQAA 4QG5A 3HS8A 3EIKA 4Q11A 4WX8A 1KFQA 2EHBD 2NOZA 3ULXA 4EJYA 3EAYA 4EAKA 1E42A 3D7QA 3KTUA 1QN3A 3C04A 2PWWA 3RPJA 2QRDA 1QN9A 3CW7A 4MRQA 4PY5A 1YQMA 5AN4A 1NVPA 4EAJA 2NOEA 2JHJA 4HJHA 3OGDA 2LAEA 2O3OA 3T4NA 2D0CA 2HL9A 2Y8LA 1LWVA 3BKQX 1QTPA 2NOFA 1VOLB 2QREA 5IYDP 2YH5A 1YQKA 3OH9A 3OSMA 1QN8A 1V5SA 3N89A 5IYCP 2NOLA 4EJZA 2HZMA 2NLVA 3UW2A 1QN4A 1QNBA 1D3UA 2XHIA 5KL0A 4ROEB 1N39A 4BJUA 2FGTA 1KY7A 1QTSA 1N3AA 1VTLE 1K2YX 3CWTA 3I3WA 2FUVA 3ASMA 4EAGA 1YQLA 1R4XA 1YTBA 3OLPA 2YA3A 3F0ZA 2JHNA 1QNCA 1KY6A 3IH7A 1NGMA 2F7LA 3D4VA 1EBMA 1TUOA 4WZSD 1J3MA 3PDKA 5BMPA 4D7RA 1N3CA 2MJ7A 4B0AA 1PCZA 1UT4A 1QN6A 5JN5A 2JOIA 2DKDA 1P5GX 1KYUA 2NWVA 2V8QA 2NOHA 2HL8A 1C4GA 3CVSA 2QRCA 2DKCA 2H4LX 1AISA
chains in the Genus database with same CATH topology
2NVMA 3D7QA 2NLVA 2NWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVM A;  3D7Q A;  2NLV A;  2NWV A; 
#chains in the Genus database with same CATH topology
 1TBA B;  1PZD A;  1PVS A;  4EAI A;  5IYB P;  5HSH A;  2NVM A;  1CDW A;  1VKL A;  3VN5 A;  1EUV A;  1PCJ X;  2HKP A;  3KRM A;  1KO9 A;  3CWA A;  1XSZ A;  2V9J A;  1UT7 A;  1TBP A;  3OCI A;  1C47 A;  2IV9 A;  1FN7 A;  3PMG A;  1W80 A;  2VJ0 A;  1KYF A;  1VTO A;  2D0B A;  3TDH A;  2MZ8 A;  2Z0F A;  1LWY A;  1QNA A;  1QNE A;  3CWS A;  4CFF A;  2HZS A;  4D7Q A;  4ROD B;  1HU0 A;  1JFI C;  1TGH A;  4WXA A;  3I0X A;  2H5A X;  3NA5 A;  3H1Z A;  1DIZ A;  1P5D X;  3I0W A;  3DPU A;  2IV8 A;  1WJW A;  2FKF A;  4IL8 A;  2JPI A;  1M5Q 1;  1B9K A;  1NH2 A;  2OOX A;  1YQR A;  3RSM A;  1QN5 A;  5JMV D;  2V92 A;  3ENC A;  1M3H A;  2ZFD B;  2DKA A;  2FKM X;  2QR1 A;  3CVT A;  4TPS A;  1M3Q A;  1MPG A;  1JDY A;  2Z8U A;  1QN7 A;  1UL7 A;  2NOI A;  5EPC A;  2QLV A;  4DUL A;  4EAL A;  5BMN A;  2G30 A;  3CWU A;  2I5W A;  3OSE A;  1KYD A;  1KFI A;  1MP9 A;  3ENO C;  4ROC B;  4C7P A;  1K35 A;  2Y8Q A;  3F10 A;  3HS9 A;  2NOB A;  1VOK A;  2OOY A;  1YTF A;  3OST A;  1RM1 A;  2D0A A;  1T6A A;  1LXT A;  3TE5 A;  5F9C A;  4I8O A;  3DPT A;  3OH6 A;  3OC3 C;  1Q9U A;  3SNS A;  1LWW A;  1C9B B;  1PCM X;  2R5X A;  1WQA A;  4QG5 A;  3HS8 A;  3EIK A;  4Q11 A;  4WX8 A;  1KFQ A;  2EHB D;  2NOZ A;  3ULX A;  4EJY A;  3EAY A;  4EAK A;  1E42 A;  3D7Q A;  3KTU A;  1QN3 A;  3C04 A;  2PWW A;  3RPJ A;  2QRD A;  1QN9 A;  3CW7 A;  4MRQ A;  4PY5 A;  1YQM A;  5AN4 A;  1NVP A;  4EAJ A;  2NOE A;  2JHJ A;  4HJH A;  3OGD A;  2LAE A;  2O3O A;  3T4N A;  2D0C A;  2HL9 A;  2Y8L A;  1LWV A;  3BKQ X;  1QTP A;  2NOF A;  1VOL B;  2QRE A;  5IYD P;  2YH5 A;  1YQK A;  3OH9 A;  3OSM A;  1QN8 A;  1V5S A;  3N89 A;  5IYC P;  2NOL A;  4EJZ A;  2HZM A;  2NLV A;  3UW2 A;  1QN4 A;  1QNB A;  1D3U A;  2XHI A;  5KL0 A;  4ROE B;  1N39 A;  4BJU A;  2FGT A;  1KY7 A;  1QTS A;  1N3A A;  1VTL E;  1K2Y X;  3CWT A;  3I3W A;  2FUV A;  3ASM A;  4EAG A;  1YQL A;  1R4X A;  1YTB A;  3OLP A;  2YA3 A;  3F0Z A;  2JHN A;  1QNC A;  1KY6 A;  3IH7 A;  1NGM A;  2F7L A;  3D4V A;  1EBM A;  1TUO A;  4WZS D;  1J3M A;  3PDK A;  5BMP A;  4D7R A;  1N3C A;  2MJ7 A;  4B0A A;  1PCZ A;  1UT4 A;  1QN6 A;  5JN5 A;  2JOI A;  2DKD A;  1P5G X;  1KYU A;  2NWV A;  2V8Q A;  2NOH A;  2HL8 A;  1C4G A;  3CVS A;  2QRC A;  2DKC A;  2H4L X;  1AIS A; 
#chains in the Genus database with same CATH homology
 2NVM A;  3D7Q A;  2NLV A;  2NWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...