2EHBD

The structure of the c-terminal domain of the protein kinase atsos2 bound to the calcium sensor atsos3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
EGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signalling protein/transferase
molecule keywords Calcineurin B-like protein 4
publication title The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium sensor AtSOS3
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 33
structure length 126
sequence length 126
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03822 NAF NAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2ehbD00
3TDHA 2V8QA 4EAIA 2OOYA 2QREA 2OOXA 2QRDA 3OSEA 4EAKA 2V92A 3TE5A 4EAGA 2YA3A 1V5SA 2EHBD 1UL7A 2QR1A 2ZFDB 2Y8QA 4CFFA 2V9JA 3T4NA 4EAJA 4EALA 2QRCA 2Y8LA 2QLVA
chains in the Genus database with same CATH superfamily
2FKFA 3TDHA 3RSMA 3CWUA 1KYFA 2OOYA 1K35A 3EAYA 2JPIA 5BMNA 1RM1A 1NGMA 2HKPA 3HS8A 4EAKA 1QN3A 3D4VA 2DKAA 2V92A 4D7QA 2MJ7A 2PWWA 5JN5A 4IL8A 1YTBA 3SNSA 2IV8A 1R4XA 3CWSA 1J3MA 3F0ZA 1LWYA 2QR1A 2FKMX 3ULXA 2HZMA 1QN5A 4EJZA 2H4LX 1VOKA 2FUVA 1QNBA 2NWVA 2QRCA 2O3OA 5IYCP 1LWWA 1DIZA 2QLVA 1W80A 2IV9A 2QREA 3VN5A 1PCJX 4C7PA 3DPTA 1NVPA 2JOIA 1PCMX 1QN6A 1MP9A 3EIKA 1FN7A 1UT4A 2HZSA 1PVSA 1QTPA 5IYDP 1YTFA 5BMPA 3TE5A 1VKLA 1QNCA 4EJYA 2YA3A 1QTSA 1WJWA 4B0AA 2VJ0A 4RODB 3F10A 1N3AA 2D0AA 1C4GA 2EHBD 3H1ZA 4TPSA 3I0WA 1C9BB 5HSHA 2Y8QA 1EBMA 3OCIA 1N39A 1JFIC 3I3WA 1P5DX 3OSTA 1EUVA 3CW7A 2YH5A 1TUOA 4WX8A 2NOFA 4EALA 1M3HA 2D0CA 2NOIA 1KYUA 3OGDA 3OSMA 2V8QA 1MPGA 3KRMA 1KY7A 3I0XA 2DKCA 2OOXA 1B9KA 4I8OA 4WXAA 4BJUA 2FGTA 3OLPA 3RPJA 1YQKA 2Z8UA 4PY5A 2JHNA 5JMVD 1TBAB 3CVSA 3CVTA 4WZSD 3OH9A 1LWVA 1E42A 4ROEB 2NOEA 3ENOC 3IH7A 1M5Q1 3D7QA 2DKDA 2HL9A 3C04A 1KO9A 4QG5A 3OH6A 2NOBA 5AN4A 2Z0FA 2D0BA 3KTUA 1VTLE 1KY6A 3HS9A 3OC3C 2HL8A 1KFIA 3CWAA 3UW2A 2NOZA 3BKQX 1VTOA 1LXTA 1NH2A 1YQMA 1M3QA 2NLVA 5F9CA 1K2YX 1D3UA 1TGHA 2R5XA 1YQLA 2NVMA 4EAIA 1YQRA 1C47A 1PCZA 2QRDA 3OSEA 1QNAA 2MZ8A 4Q11A 5EPCA 1T6AA 1TBPA 1CDWA 1QN8A 2NOLA 4ROCB 1JDYA 2JHJA 5KL0A 3N89A 4MRQA 1QN9A 1VOLB 1XSZA 1P5GX 2G30A 1KFQA 2XHIA 3PMGA 1QNEA 1V5SA 1UT7A 1QN4A 2LAEA 1WQAA 2F7LA 3PDKA 1Q9UA 1AISA 2I5WA 1UL7A 3NA5A 3CWTA 3ASMA 2ZFDB 1KYDA 2H5AX 4CFFA 5IYBP 2V9JA 1N3CA 3ENCA 3T4NA 1QN7A 4EAJA 1HU0A 3DPUA 4HJHA 4EAGA 4DULA 1PZDA 2NOHA 2Y8LA 4D7RA
chains in the Genus database with same CATH topology
3TDHA 2V8QA 4EAIA 2OOYA 2QREA 2OOXA 2QRDA 3OSEA 4EAKA 2V92A 3TE5A 4EAGA 2YA3A 1V5SA 2EHBD 1UL7A 2QR1A 2ZFDB 2Y8QA 4CFFA 2V9JA 3T4NA 4EAJA 4EALA 2QRCA 2Y8LA 2QLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDH A;  2V8Q A;  4EAI A;  2OOY A;  2QRE A;  2OOX A;  2QRD A;  3OSE A;  4EAK A;  2V92 A;  3TE5 A;  4EAG A;  2YA3 A;  1V5S A;  2EHB D;  1UL7 A;  2QR1 A;  2ZFD B;  2Y8Q A;  4CFF A;  2V9J A;  3T4N A;  4EAJ A;  4EAL A;  2QRC A;  2Y8L A;  2QLV A; 
#chains in the Genus database with same CATH topology
 2FKF A;  3TDH A;  3RSM A;  3CWU A;  1KYF A;  2OOY A;  1K35 A;  3EAY A;  2JPI A;  5BMN A;  1RM1 A;  1NGM A;  2HKP A;  3HS8 A;  4EAK A;  1QN3 A;  3D4V A;  2DKA A;  2V92 A;  4D7Q A;  2MJ7 A;  2PWW A;  5JN5 A;  4IL8 A;  1YTB A;  3SNS A;  2IV8 A;  1R4X A;  3CWS A;  1J3M A;  3F0Z A;  1LWY A;  2QR1 A;  2FKM X;  3ULX A;  2HZM A;  1QN5 A;  4EJZ A;  2H4L X;  1VOK A;  2FUV A;  1QNB A;  2NWV A;  2QRC A;  2O3O A;  5IYC P;  1LWW A;  1DIZ A;  2QLV A;  1W80 A;  2IV9 A;  2QRE A;  3VN5 A;  1PCJ X;  4C7P A;  3DPT A;  1NVP A;  2JOI A;  1PCM X;  1QN6 A;  1MP9 A;  3EIK A;  1FN7 A;  1UT4 A;  2HZS A;  1PVS A;  1QTP A;  5IYD P;  1YTF A;  5BMP A;  3TE5 A;  1VKL A;  1QNC A;  4EJY A;  2YA3 A;  1QTS A;  1WJW A;  4B0A A;  2VJ0 A;  4ROD B;  3F10 A;  1N3A A;  2D0A A;  1C4G A;  2EHB D;  3H1Z A;  4TPS A;  3I0W A;  1C9B B;  5HSH A;  2Y8Q A;  1EBM A;  3OCI A;  1N39 A;  1JFI C;  3I3W A;  1P5D X;  3OST A;  1EUV A;  3CW7 A;  2YH5 A;  1TUO A;  4WX8 A;  2NOF A;  4EAL A;  1M3H A;  2D0C A;  2NOI A;  1KYU A;  3OGD A;  3OSM A;  2V8Q A;  1MPG A;  3KRM A;  1KY7 A;  3I0X A;  2DKC A;  2OOX A;  1B9K A;  4I8O A;  4WXA A;  4BJU A;  2FGT A;  3OLP A;  3RPJ A;  1YQK A;  2Z8U A;  4PY5 A;  2JHN A;  5JMV D;  1TBA B;  3CVS A;  3CVT A;  4WZS D;  3OH9 A;  1LWV A;  1E42 A;  4ROE B;  2NOE A;  3ENO C;  3IH7 A;  1M5Q 1;  3D7Q A;  2DKD A;  2HL9 A;  3C04 A;  1KO9 A;  4QG5 A;  3OH6 A;  2NOB A;  5AN4 A;  2Z0F A;  2D0B A;  3KTU A;  1VTL E;  1KY6 A;  3HS9 A;  3OC3 C;  2HL8 A;  1KFI A;  3CWA A;  3UW2 A;  2NOZ A;  3BKQ X;  1VTO A;  1LXT A;  1NH2 A;  1YQM A;  1M3Q A;  2NLV A;  5F9C A;  1K2Y X;  1D3U A;  1TGH A;  2R5X A;  1YQL A;  2NVM A;  4EAI A;  1YQR A;  1C47 A;  1PCZ A;  2QRD A;  3OSE A;  1QNA A;  2MZ8 A;  4Q11 A;  5EPC A;  1T6A A;  1TBP A;  1CDW A;  1QN8 A;  2NOL A;  4ROC B;  1JDY A;  2JHJ A;  5KL0 A;  3N89 A;  4MRQ A;  1QN9 A;  1VOL B;  1XSZ A;  1P5G X;  2G30 A;  1KFQ A;  2XHI A;  3PMG A;  1QNE A;  1V5S A;  1UT7 A;  1QN4 A;  2LAE A;  1WQA A;  2F7L A;  3PDK A;  1Q9U A;  1AIS A;  2I5W A;  1UL7 A;  3NA5 A;  3CWT A;  3ASM A;  2ZFD B;  1KYD A;  2H5A X;  4CFF A;  5IYB P;  2V9J A;  1N3C A;  3ENC A;  3T4N A;  1QN7 A;  4EAJ A;  1HU0 A;  3DPU A;  4HJH A;  4EAG A;  4DUL A;  1PZD A;  2NOH A;  2Y8L A;  4D7R A; 
#chains in the Genus database with same CATH homology
 3TDH A;  2V8Q A;  4EAI A;  2OOY A;  2QRE A;  2OOX A;  2QRD A;  3OSE A;  4EAK A;  2V92 A;  3TE5 A;  4EAG A;  2YA3 A;  1V5S A;  2EHB D;  1UL7 A;  2QR1 A;  2ZFD B;  2Y8Q A;  4CFF A;  2V9J A;  3T4N A;  4EAJ A;  4EAL A;  2QRC A;  2Y8L A;  2QLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...