2EHBD

The structure of the c-terminal domain of the protein kinase atsos2 bound to the calcium sensor atsos3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
EGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcineurin B-like protein 4
publication title The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium sensor AtSOS3
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signalling protein/transferase
total genus 33
structure length 126
sequence length 126
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03822 NAF NAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2ehbD00
2YA3A 1UL7A 2ZFDB 2QLVA 2V9JA 2V92A 1V5SA 4CFFA 2QREA 4EAIA 3TDHA 2OOYA 2Y8QA 4EAJA 2QR1A 2Y8LA 4EAKA 3T4NA 4EALA 3TE5A 2QRDA 2OOXA 2QRCA 4EAGA 3OSEA 2EHBD 2V8QA
chains in the Genus database with same CATH superfamily
1JDYA 1FN7A 2YA3A 4WXAA 3C04A 2NOFA 1LWWA 4C7PA 3N89A 2D0AA 2DKDA 2NOHA 3RPJA 3SNSA 4D7RA 1TUOA 1QN9A 1V5SA 2R5XA 1T6AA 2YH5A 1LWYA 1TBAB 3D7QA 1M3HA 3EAYA 3D4VA 2FKMX 3OCIA 4IL8A 1M3QA 3RSMA 3TDHA 1RM1A 1P5DX 3I3WA 1C47A 1WJWA 2JHJA 1KFQA 3DPTA 1N3CA 1QNCA 1QN6A 1CDWA 3CVTA 4EJZA 1VTLE 1R4XA 2Y8LA 1KYUA 1KO9A 5AN4A 2I5WA 2NVMA 4WX8A 3CWUA 2HKPA 4B0AA 2QRDA 5IYDP 2OOXA 1PZDA 1VTOA 2QRCA 1QN8A 4Q11A 3OSEA 3IH7A 1HU0A 1VOKA 2F7LA 2HZSA 2NOIA 3DPUA 3ASMA 3CVSA 2QLVA 1N3AA 1UT7A 1KYDA 5JMVD 2V92A 1E42A 4WZSD 3CWSA 1WQAA 2IV9A 5BMNA 1TBPA 1NVPA 1MP9A 2LAEA 2QREA 3CWTA 1Q9UA 3F10A 1QTPA 3BKQX 4QG5A 3PMGA 3OSTA 1YQMA 2QR1A 2IV8A 2NLVA 5EPCA 1AISA 2FGTA 4EAKA 4RODB 4EALA 1LXTA 2VJ0A 2XHIA 2NOZA 3UW2A 1PVSA 3PDKA 1TGHA 1M5Q1 1QN5A 2HL9A 1QN4A 2D0BA 2DKAA 1VKLA 4EAGA 3OH6A 2FUVA 2V8QA 1EBMA 1YQKA 3OLPA 4TPSA 1QNBA 4ROCB 1UL7A 1NH2A 2DKCA 2JOIA 1C9BB 1QNEA 1YTFA 3CWAA 2NOLA 3KRMA 4DULA 2V9JA 1P5GX 1J3MA 1PCJX 1XSZA 1W80A 4HJHA 1EUVA 1K35A 3ENOC 1YQLA 1YQRA 5KL0A 4EAIA 4MRQA 2D0CA 2MJ7A 5BMPA 2NOBA 2OOYA 2Y8QA 2G30A 4D7QA 3OC3C 1YTBA 3OGDA 2NOEA 3I0WA 1JFIC 2FKFA 4ROEB 2JHNA 1QTSA 5IYCP 4BJUA 3OH9A 1MPGA 4PY5A 5JN5A 3KTUA 2O3OA 1PCMX 2ZFDB 1B9KA 5F9CA 2H4LX 1LWVA 3ULXA 1QNAA 1K2YX 3H1ZA 3OSMA 1KFIA 2Z0FA 1KY6A 4CFFA 3HS8A 1UT4A 3VN5A 2HL8A 3I0XA 3CW7A 3EIKA 4EJYA 2H5AX 3NA5A 2JPIA 4EAJA 3F0ZA 1VOLB 4I8OA 1DIZA 1QN7A 3T4NA 1KYFA 2NWVA 3HS9A 2PWWA 3TE5A 1PCZA 2HZMA 1NGMA 1N39A 5HSHA 2Z8UA 1D3UA 1C4GA 1QN3A 1KY7A 3ENCA 5IYBP 2EHBD 2MZ8A
chains in the Genus database with same CATH topology
2YA3A 1UL7A 2ZFDB 2QLVA 2V9JA 2V92A 1V5SA 4CFFA 2QREA 4EAIA 3TDHA 2OOYA 2Y8QA 4EAJA 2QR1A 2Y8LA 4EAKA 3T4NA 4EALA 3TE5A 2QRDA 2OOXA 2QRCA 4EAGA 3OSEA 2EHBD 2V8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YA3 A;  1UL7 A;  2ZFD B;  2QLV A;  2V9J A;  2V92 A;  1V5S A;  4CFF A;  2QRE A;  4EAI A;  3TDH A;  2OOY A;  2Y8Q A;  4EAJ A;  2QR1 A;  2Y8L A;  4EAK A;  3T4N A;  4EAL A;  3TE5 A;  2QRD A;  2OOX A;  2QRC A;  4EAG A;  3OSE A;  2EHB D;  2V8Q A; 
#chains in the Genus database with same CATH topology
 1JDY A;  1FN7 A;  2YA3 A;  4WXA A;  3C04 A;  2NOF A;  1LWW A;  4C7P A;  3N89 A;  2D0A A;  2DKD A;  2NOH A;  3RPJ A;  3SNS A;  4D7R A;  1TUO A;  1QN9 A;  1V5S A;  2R5X A;  1T6A A;  2YH5 A;  1LWY A;  1TBA B;  3D7Q A;  1M3H A;  3EAY A;  3D4V A;  2FKM X;  3OCI A;  4IL8 A;  1M3Q A;  3RSM A;  3TDH A;  1RM1 A;  1P5D X;  3I3W A;  1C47 A;  1WJW A;  2JHJ A;  1KFQ A;  3DPT A;  1N3C A;  1QNC A;  1QN6 A;  1CDW A;  3CVT A;  4EJZ A;  1VTL E;  1R4X A;  2Y8L A;  1KYU A;  1KO9 A;  5AN4 A;  2I5W A;  2NVM A;  4WX8 A;  3CWU A;  2HKP A;  4B0A A;  2QRD A;  5IYD P;  2OOX A;  1PZD A;  1VTO A;  2QRC A;  1QN8 A;  4Q11 A;  3OSE A;  3IH7 A;  1HU0 A;  1VOK A;  2F7L A;  2HZS A;  2NOI A;  3DPU A;  3ASM A;  3CVS A;  2QLV A;  1N3A A;  1UT7 A;  1KYD A;  5JMV D;  2V92 A;  1E42 A;  4WZS D;  3CWS A;  1WQA A;  2IV9 A;  5BMN A;  1TBP A;  1NVP A;  1MP9 A;  2LAE A;  2QRE A;  3CWT A;  1Q9U A;  3F10 A;  1QTP A;  3BKQ X;  4QG5 A;  3PMG A;  3OST A;  1YQM A;  2QR1 A;  2IV8 A;  2NLV A;  5EPC A;  1AIS A;  2FGT A;  4EAK A;  4ROD B;  4EAL A;  1LXT A;  2VJ0 A;  2XHI A;  2NOZ A;  3UW2 A;  1PVS A;  3PDK A;  1TGH A;  1M5Q 1;  1QN5 A;  2HL9 A;  1QN4 A;  2D0B A;  2DKA A;  1VKL A;  4EAG A;  3OH6 A;  2FUV A;  2V8Q A;  1EBM A;  1YQK A;  3OLP A;  4TPS A;  1QNB A;  4ROC B;  1UL7 A;  1NH2 A;  2DKC A;  2JOI A;  1C9B B;  1QNE A;  1YTF A;  3CWA A;  2NOL A;  3KRM A;  4DUL A;  2V9J A;  1P5G X;  1J3M A;  1PCJ X;  1XSZ A;  1W80 A;  4HJH A;  1EUV A;  1K35 A;  3ENO C;  1YQL A;  1YQR A;  5KL0 A;  4EAI A;  4MRQ A;  2D0C A;  2MJ7 A;  5BMP A;  2NOB A;  2OOY A;  2Y8Q A;  2G30 A;  4D7Q A;  3OC3 C;  1YTB A;  3OGD A;  2NOE A;  3I0W A;  1JFI C;  2FKF A;  4ROE B;  2JHN A;  1QTS A;  5IYC P;  4BJU A;  3OH9 A;  1MPG A;  4PY5 A;  5JN5 A;  3KTU A;  2O3O A;  1PCM X;  2ZFD B;  1B9K A;  5F9C A;  2H4L X;  1LWV A;  3ULX A;  1QNA A;  1K2Y X;  3H1Z A;  3OSM A;  1KFI A;  2Z0F A;  1KY6 A;  4CFF A;  3HS8 A;  1UT4 A;  3VN5 A;  2HL8 A;  3I0X A;  3CW7 A;  3EIK A;  4EJY A;  2H5A X;  3NA5 A;  2JPI A;  4EAJ A;  3F0Z A;  1VOL B;  4I8O A;  1DIZ A;  1QN7 A;  3T4N A;  1KYF A;  2NWV A;  3HS9 A;  2PWW A;  3TE5 A;  1PCZ A;  2HZM A;  1NGM A;  1N39 A;  5HSH A;  2Z8U A;  1D3U A;  1C4G A;  1QN3 A;  1KY7 A;  3ENC A;  5IYB P;  2EHB D;  2MZ8 A; 
#chains in the Genus database with same CATH homology
 2YA3 A;  1UL7 A;  2ZFD B;  2QLV A;  2V9J A;  2V92 A;  1V5S A;  4CFF A;  2QRE A;  4EAI A;  3TDH A;  2OOY A;  2Y8Q A;  4EAJ A;  2QR1 A;  2Y8L A;  4EAK A;  3T4N A;  4EAL A;  3TE5 A;  2QRD A;  2OOX A;  2QRC A;  4EAG A;  3OSE A;  2EHB D;  2V8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...