2V9JA

Crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
156
structure length
102
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 23
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2v9jA01
2Y8QA 2QRDA 4CFFA 3OSEA 1UL7A 4EAIA 2OOYA 2V9JA 2QRCA 1V5SA 2QREA 2ZFDB 2EHBD 2V8QA 4EAGA 3TE5A 2QR1A 2OOXA 2YA3A 2QLVA 3TDHA 4EAKA 3T4NA 4EAJA 2V92A 4EALA 2Y8LA
chains in the Genus database with same CATH superfamily
3C04A 2O3OA 2VJ0A 1M3QA 3OSEA 1QN3A 1QNBA 3KTUA 1N39A 5F9CA 1RM1A 3CWTA 1LWWA 4MRQA 5JN5A 1C4GA 1J3MA 3CVSA 2ZFDB 1N3CA 1PCJX 2HL9A 3I0XA 1MPGA 2MJ7A 1TBPA 1XSZA 1AISA 5IYDP 4RODB 1KY7A 1YTBA 1UT4A 2HL8A 1KO9A 2YH5A 5KL0A 1K35A 2JOIA 2QR1A 1PZDA 3RPJA 1DIZA 3ENOC 2HZMA 1K2YX 1VOKA 4EAJA 3ASMA 4WZSD 1TBAB 1QTPA 3OGDA 4ROCB 2R5XA 3OCIA 2QRDA 2DKCA 1VTOA 3I0WA 1VOLB 3D7QA 1KYFA 4TPSA 1TUOA 4WX8A 4C7PA 1CDWA 1QTSA 1YQKA 1UL7A 2PWWA 2D0CA 4EAIA 1EBMA 1TGHA 2JHNA 1NGMA 3CWAA 3CVTA 3CWSA 2QRCA 2NOIA 2Z8UA 4B0AA 4EJZA 4D7QA 2Z0FA 2V8QA 2IV8A 2NLVA 1Q9UA 4QG5A 1M3HA 1KY6A 5BMNA 1C9BB 1QN7A 4EJYA 1C47A 1VTLE 2H5AX 3OC3C 5BMPA 1LWVA 1KFQA 3VN5A 4BJUA 3DPTA 3PDKA 3IH7A 1B9KA 5EPCA 3ULXA 2DKDA 1NVPA 2YA3A 1QN5A 1QNCA 3TDHA 4EAKA 3OSMA 1QNAA 1T6AA 1KYDA 2MZ8A 1P5DX 1EUVA 2FGTA 1E42A 5HSHA 2HKPA 1KYUA 4CFFA 4D7RA 2NOFA 3PMGA 3OSTA 3OH6A 3RSMA 2HZSA 1WQAA 1QNEA 2OOYA 2V9JA 5IYCP 1V5SA 2JPIA 1MP9A 1P5GX 2H4LX 3DPUA 2EHBD 2FKFA 4ROEB 4PY5A 1D3UA 2D0AA 4EAGA 1LWYA 3EIKA 3HS8A 4HJHA 1R4XA 3TE5A 2NWVA 2OOXA 2NOZA 2F7LA 2LAEA 1QN9A 5JMVD 4DULA 2DKAA 3CW7A 3KRMA 1UT7A 1W80A 1YQMA 2Y8LA 2NOBA 2FUVA 2Y8QA 1HU0A 2NOHA 1YTFA 3F0ZA 4WXAA 3H1ZA 1QN6A 3F10A 2IV9A 3HS9A 2XHIA 3D4VA 3OLPA 2QREA 1N3AA 4Q11A 1QN4A 4I8OA 2NOLA 4IL8A 2G30A 2NVMA 1LXTA 1KFIA 3UW2A 1PCZA 3NA5A 1WJWA 3BKQX 1YQRA 1PVSA 2JHJA 3OH9A 3CWUA 1FN7A 2NOEA 1PCMX 3I3WA 1NH2A 2D0BA 3ENCA 3N89A 1VKLA 2FKMX 1YQLA 1M5Q1 5IYBP 2QLVA 1JFIC 3T4NA 2V92A 5AN4A 3SNSA 1QN8A 3EAYA 4EALA 1JDYA 2I5WA
chains in the Genus database with same CATH topology
2Y8QA 2QRDA 4CFFA 3OSEA 1UL7A 4EAIA 2OOYA 2V9JA 2QRCA 1V5SA 2QREA 2ZFDB 2EHBD 2V8QA 4EAGA 3TE5A 2QR1A 2OOXA 2YA3A 2QLVA 3TDHA 4EAKA 3T4NA 4EAJA 2V92A 4EALA 2Y8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8Q A;  2QRD A;  4CFF A;  3OSE A;  1UL7 A;  4EAI A;  2OOY A;  2V9J A;  2QRC A;  1V5S A;  2QRE A;  2ZFD B;  2EHB D;  2V8Q A;  4EAG A;  3TE5 A;  2QR1 A;  2OOX A;  2YA3 A;  2QLV A;  3TDH A;  4EAK A;  3T4N A;  4EAJ A;  2V92 A;  4EAL A;  2Y8L A; 
#chains in the Genus database with same CATH topology
 3C04 A;  2O3O A;  2VJ0 A;  1M3Q A;  3OSE A;  1QN3 A;  1QNB A;  3KTU A;  1N39 A;  5F9C A;  1RM1 A;  3CWT A;  1LWW A;  4MRQ A;  5JN5 A;  1C4G A;  1J3M A;  3CVS A;  2ZFD B;  1N3C A;  1PCJ X;  2HL9 A;  3I0X A;  1MPG A;  2MJ7 A;  1TBP A;  1XSZ A;  1AIS A;  5IYD P;  4ROD B;  1KY7 A;  1YTB A;  1UT4 A;  2HL8 A;  1KO9 A;  2YH5 A;  5KL0 A;  1K35 A;  2JOI A;  2QR1 A;  1PZD A;  3RPJ A;  1DIZ A;  3ENO C;  2HZM A;  1K2Y X;  1VOK A;  4EAJ A;  3ASM A;  4WZS D;  1TBA B;  1QTP A;  3OGD A;  4ROC B;  2R5X A;  3OCI A;  2QRD A;  2DKC A;  1VTO A;  3I0W A;  1VOL B;  3D7Q A;  1KYF A;  4TPS A;  1TUO A;  4WX8 A;  4C7P A;  1CDW A;  1QTS A;  1YQK A;  1UL7 A;  2PWW A;  2D0C A;  4EAI A;  1EBM A;  1TGH A;  2JHN A;  1NGM A;  3CWA A;  3CVT A;  3CWS A;  2QRC A;  2NOI A;  2Z8U A;  4B0A A;  4EJZ A;  4D7Q A;  2Z0F A;  2V8Q A;  2IV8 A;  2NLV A;  1Q9U A;  4QG5 A;  1M3H A;  1KY6 A;  5BMN A;  1C9B B;  1QN7 A;  4EJY A;  1C47 A;  1VTL E;  2H5A X;  3OC3 C;  5BMP A;  1LWV A;  1KFQ A;  3VN5 A;  4BJU A;  3DPT A;  3PDK A;  3IH7 A;  1B9K A;  5EPC A;  3ULX A;  2DKD A;  1NVP A;  2YA3 A;  1QN5 A;  1QNC A;  3TDH A;  4EAK A;  3OSM A;  1QNA A;  1T6A A;  1KYD A;  2MZ8 A;  1P5D X;  1EUV A;  2FGT A;  1E42 A;  5HSH A;  2HKP A;  1KYU A;  4CFF A;  4D7R A;  2NOF A;  3PMG A;  3OST A;  3OH6 A;  3RSM A;  2HZS A;  1WQA A;  1QNE A;  2OOY A;  2V9J A;  5IYC P;  1V5S A;  2JPI A;  1MP9 A;  1P5G X;  2H4L X;  3DPU A;  2EHB D;  2FKF A;  4ROE B;  4PY5 A;  1D3U A;  2D0A A;  4EAG A;  1LWY A;  3EIK A;  3HS8 A;  4HJH A;  1R4X A;  3TE5 A;  2NWV A;  2OOX A;  2NOZ A;  2F7L A;  2LAE A;  1QN9 A;  5JMV D;  4DUL A;  2DKA A;  3CW7 A;  3KRM A;  1UT7 A;  1W80 A;  1YQM A;  2Y8L A;  2NOB A;  2FUV A;  2Y8Q A;  1HU0 A;  2NOH A;  1YTF A;  3F0Z A;  4WXA A;  3H1Z A;  1QN6 A;  3F10 A;  2IV9 A;  3HS9 A;  2XHI A;  3D4V A;  3OLP A;  2QRE A;  1N3A A;  4Q11 A;  1QN4 A;  4I8O A;  2NOL A;  4IL8 A;  2G30 A;  2NVM A;  1LXT A;  1KFI A;  3UW2 A;  1PCZ A;  3NA5 A;  1WJW A;  3BKQ X;  1YQR A;  1PVS A;  2JHJ A;  3OH9 A;  3CWU A;  1FN7 A;  2NOE A;  1PCM X;  3I3W A;  1NH2 A;  2D0B A;  3ENC A;  3N89 A;  1VKL A;  2FKM X;  1YQL A;  1M5Q 1;  5IYB P;  2QLV A;  1JFI C;  3T4N A;  2V92 A;  5AN4 A;  3SNS A;  1QN8 A;  3EAY A;  4EAL A;  1JDY A;  2I5W A; 
#chains in the Genus database with same CATH homology
 2Y8Q A;  2QRD A;  4CFF A;  3OSE A;  1UL7 A;  4EAI A;  2OOY A;  2V9J A;  2QRC A;  1V5S A;  2QRE A;  2ZFD B;  2EHB D;  2V8Q A;  4EAG A;  3TE5 A;  2QR1 A;  2OOX A;  2YA3 A;  2QLV A;  3TDH A;  4EAK A;  3T4N A;  4EAJ A;  2V92 A;  4EAL A;  2Y8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...