2V9JA

Crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
156
structure length
102
Chain Sequence
SMAWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDEVAPRPGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC SUBUNIT ALPHA-1
publication title Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 23
structure length 102
sequence length 156
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2v9jA01
4EALA 2OOYA 4EAKA 2V8QA 1V5SA 2QR1A 4EAIA 3OSEA 3T4NA 1UL7A 2ZFDB 4CFFA 2QREA 2Y8QA 2QRDA 3TDHA 4EAJA 2Y8LA 2YA3A 2OOXA 2QLVA 2V9JA 2EHBD 4EAGA 3TE5A 2QRCA 2V92A
chains in the Genus database with same CATH superfamily
4QG5A 2G30A 4EJYA 4Q11A 4PY5A 3NA5A 3F0ZA 1V5SA 1PCJX 3HS9A 1QN8A 2DKDA 2QR1A 1TUOA 4EAIA 1LWYA 1YTBA 1LWWA 1M5Q1 2H5AX 3BKQX 2HZMA 3OH9A 2ZFDB 1KYDA 1WJWA 1QN6A 1KY6A 4TPSA 1N3CA 1PCMX 1VKLA 4D7RA 1QNEA 1J3MA 3TDHA 5IYDP 1M3QA 1C4GA 2JPIA 1XSZA 3ULXA 2NOEA 2VJ0A 4C7PA 1UT7A 4EAGA 1PCZA 2FUVA 3C04A 1YQRA 2EHBD 1LXTA 2H4LX 3D7QA 1Q9UA 4EALA 2JHJA 2NOBA 1YTFA 3D4VA 2NOHA 1P5DX 1JDYA 1QN4A 3OSEA 3T4NA 3CWAA 2F7LA 2IV9A 2Z0FA 2FKMX 3EIKA 1EUVA 1UL7A 5BMPA 1C9BB 1KYUA 2QREA 1TBAB 4BJUA 3IH7A 1W80A 2O3OA 1NGMA 5IYCP 1YQLA 3HS8A 1PVSA 2I5WA 2D0CA 4EAJA 2R5XA 2NOLA 3CVTA 1WQAA 1P5GX 4DULA 2QLVA 3PMGA 1QN7A 3CWSA 1M3HA 1HU0A 4HJHA 3ENOC 2JOIA 4MRQA 2JHNA 2PWWA 3F10A 3OSTA 2D0BA 2NLVA 1NH2A 2NWVA 3OGDA 1MPGA 5HSHA 4B0AA 1EBMA 3CW7A 3UW2A 1UT4A 5BMNA 3OSMA 1K2YX 2IV8A 4D7QA 2FKFA 1FN7A 1TGHA 3OLPA 3DPTA 1PZDA 2YH5A 3VN5A 1C47A 3CWUA 1B9KA 4CFFA 1QTSA 1KFIA 4WZSD 1QTPA 2NOFA 2LAEA 2DKCA 1KY7A 4IL8A 2YA3A 3KRMA 2NVMA 3ENCA 3PDKA 1E42A 1T6AA 1QN5A 3CWTA 2HZSA 3TE5A 2MJ7A 2QRCA 5EPCA 5F9CA 3OH6A 3H1ZA 5IYBP 5JN5A 1KYFA 2NOZA 1NVPA 2DKAA 1JFIC 1R4XA 1VTOA 1AISA 2OOYA 1QNAA 4WX8A 4EAKA 4EJZA 2V8QA 4WXAA 3RPJA 3SNSA 1QN9A 1K35A 1YQKA 1LWVA 3CVSA 1YQMA 2MZ8A 5AN4A 1VTLE 3ASMA 1RM1A 2XHIA 1QNCA 3RSMA 3I0XA 2FGTA 2Z8UA 4RODB 3EAYA 3I0WA 1CDWA 3KTUA 3N89A 2Y8QA 3OCIA 4ROCB 5KL0A 3DPUA 5JMVD 4ROEB 1VOLB 2QRDA 2HL8A 1N3AA 2Y8LA 3OC3C 1D3UA 2D0AA 1VOKA 1KFQA 2OOXA 1TBPA 2HKPA 4I8OA 2V9JA 2HL9A 3I3WA 2NOIA 1DIZA 1MP9A 1QNBA 1QN3A 2V92A 1N39A 1KO9A
chains in the Genus database with same CATH topology
4EALA 2OOYA 4EAKA 2V8QA 1V5SA 2QR1A 4EAIA 3OSEA 3T4NA 1UL7A 2ZFDB 4CFFA 2QREA 2Y8QA 2QRDA 3TDHA 4EAJA 2Y8LA 2YA3A 2OOXA 2QLVA 2V9JA 2EHBD 4EAGA 3TE5A 2QRCA 2V92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAL A;  2OOY A;  4EAK A;  2V8Q A;  1V5S A;  2QR1 A;  4EAI A;  3OSE A;  3T4N A;  1UL7 A;  2ZFD B;  4CFF A;  2QRE A;  2Y8Q A;  2QRD A;  3TDH A;  4EAJ A;  2Y8L A;  2YA3 A;  2OOX A;  2QLV A;  2V9J A;  2EHB D;  4EAG A;  3TE5 A;  2QRC A;  2V92 A; 
#chains in the Genus database with same CATH topology
 4QG5 A;  2G30 A;  4EJY A;  4Q11 A;  4PY5 A;  3NA5 A;  3F0Z A;  1V5S A;  1PCJ X;  3HS9 A;  1QN8 A;  2DKD A;  2QR1 A;  1TUO A;  4EAI A;  1LWY A;  1YTB A;  1LWW A;  1M5Q 1;  2H5A X;  3BKQ X;  2HZM A;  3OH9 A;  2ZFD B;  1KYD A;  1WJW A;  1QN6 A;  1KY6 A;  4TPS A;  1N3C A;  1PCM X;  1VKL A;  4D7R A;  1QNE A;  1J3M A;  3TDH A;  5IYD P;  1M3Q A;  1C4G A;  2JPI A;  1XSZ A;  3ULX A;  2NOE A;  2VJ0 A;  4C7P A;  1UT7 A;  4EAG A;  1PCZ A;  2FUV A;  3C04 A;  1YQR A;  2EHB D;  1LXT A;  2H4L X;  3D7Q A;  1Q9U A;  4EAL A;  2JHJ A;  2NOB A;  1YTF A;  3D4V A;  2NOH A;  1P5D X;  1JDY A;  1QN4 A;  3OSE A;  3T4N A;  3CWA A;  2F7L A;  2IV9 A;  2Z0F A;  2FKM X;  3EIK A;  1EUV A;  1UL7 A;  5BMP A;  1C9B B;  1KYU A;  2QRE A;  1TBA B;  4BJU A;  3IH7 A;  1W80 A;  2O3O A;  1NGM A;  5IYC P;  1YQL A;  3HS8 A;  1PVS A;  2I5W A;  2D0C A;  4EAJ A;  2R5X A;  2NOL A;  3CVT A;  1WQA A;  1P5G X;  4DUL A;  2QLV A;  3PMG A;  1QN7 A;  3CWS A;  1M3H A;  1HU0 A;  4HJH A;  3ENO C;  2JOI A;  4MRQ A;  2JHN A;  2PWW A;  3F10 A;  3OST A;  2D0B A;  2NLV A;  1NH2 A;  2NWV A;  3OGD A;  1MPG A;  5HSH A;  4B0A A;  1EBM A;  3CW7 A;  3UW2 A;  1UT4 A;  5BMN A;  3OSM A;  1K2Y X;  2IV8 A;  4D7Q A;  2FKF A;  1FN7 A;  1TGH A;  3OLP A;  3DPT A;  1PZD A;  2YH5 A;  3VN5 A;  1C47 A;  3CWU A;  1B9K A;  4CFF A;  1QTS A;  1KFI A;  4WZS D;  1QTP A;  2NOF A;  2LAE A;  2DKC A;  1KY7 A;  4IL8 A;  2YA3 A;  3KRM A;  2NVM A;  3ENC A;  3PDK A;  1E42 A;  1T6A A;  1QN5 A;  3CWT A;  2HZS A;  3TE5 A;  2MJ7 A;  2QRC A;  5EPC A;  5F9C A;  3OH6 A;  3H1Z A;  5IYB P;  5JN5 A;  1KYF A;  2NOZ A;  1NVP A;  2DKA A;  1JFI C;  1R4X A;  1VTO A;  1AIS A;  2OOY A;  1QNA A;  4WX8 A;  4EAK A;  4EJZ A;  2V8Q A;  4WXA A;  3RPJ A;  3SNS A;  1QN9 A;  1K35 A;  1YQK A;  1LWV A;  3CVS A;  1YQM A;  2MZ8 A;  5AN4 A;  1VTL E;  3ASM A;  1RM1 A;  2XHI A;  1QNC A;  3RSM A;  3I0X A;  2FGT A;  2Z8U A;  4ROD B;  3EAY A;  3I0W A;  1CDW A;  3KTU A;  3N89 A;  2Y8Q A;  3OCI A;  4ROC B;  5KL0 A;  3DPU A;  5JMV D;  4ROE B;  1VOL B;  2QRD A;  2HL8 A;  1N3A A;  2Y8L A;  3OC3 C;  1D3U A;  2D0A A;  1VOK A;  1KFQ A;  2OOX A;  1TBP A;  2HKP A;  4I8O A;  2V9J A;  2HL9 A;  3I3W A;  2NOI A;  1DIZ A;  1MP9 A;  1QNB A;  1QN3 A;  2V92 A;  1N39 A;  1KO9 A; 
#chains in the Genus database with same CATH homology
 4EAL A;  2OOY A;  4EAK A;  2V8Q A;  1V5S A;  2QR1 A;  4EAI A;  3OSE A;  3T4N A;  1UL7 A;  2ZFD B;  4CFF A;  2QRE A;  2Y8Q A;  2QRD A;  3TDH A;  4EAJ A;  2Y8L A;  2YA3 A;  2OOX A;  2QLV A;  2V9J A;  2EHB D;  4EAG A;  3TE5 A;  2QRC A;  2V92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...