1M5Q1

Crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIMYRYIVHIDSTERRIDMREFAKQAEKIFPGMVKYIEETNVVLIGDKVRVSEIGVEGVGPVAERAKRLFEEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords small nuclear ribonucleoprotein homolog
publication title Structure and assembly of an augmented Sm-like archaeal protein 14-mer
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 23
structure length 127
sequence length 127
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF14894 Lsm_C Lsm C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m5q101
3.30.310.60 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Like-Sm ribonucleoprotein, C-terminal domain 1m5q102
5GAMj 3L2ZA 1D3BA 2EJ9A 5GMKm 2DVEA 1I81A 5GAN5 2DJZA 3SWNC 5GAN8 1HK9A 4A53A 4PJOA 3SWNA 4F7UA 4C8QD 5GANe 1WQ7A 4MMKA 3BDUA 4HT9A 4M7AE 4PJOB 5GMKi 4M7DF 3SWNB 4F7UB 5GAOm 4M7AG 4C92C 2RM4A 3JCMd 2EJGA 5GANd 2CGHA 3JB9F 5I21A 4C92A 3QHSA 3RKXA 5LJ5e 2YLBA 2EAYA 4A54A 1HXDA 1JRIA 4C92B 3JCMQ 3QUIA 3RKYA 1KQ2A 4N0AC 4M77E 5GAMe 3JB9D 2DZ9A 2RD1A 4M77G 3RKWA 2HNIA 4M75E 3V7SA 2RB6A 3V7RA 5GAMd 4M7AD 2DXUA 1WNLA 4M75G 4M78E 5GAOp 3HFNA 4X9DA 2YLCA 2JN0A 4M78G 2EWNA 4C8QF 1LJOA 3HSBA 5GAN3 2QTXA 1BIAA 5LJ3j 4JRIA 1D3BB 4C8QC 4XTXA 4RCBA 4QVCA 4M77D 3JCMe 5GAOn 3HFOA 5GAOq 4RCCA 3JB9I 1M5Q1 3INZA 3AHUA 3JB9J 5GAN7 4M75D 4PNOA 4J6WA 4XU3A 4M78D 5GANf 4PJOE 1M8VA 2DZCA 4M7DC 1WQWA 4XU0A 3VU3C 4F7UE 4XTZA 4XTUA 4PJOG 5CAIA 5GMKe 4M7DA 4M7AF 4F7UG 2E10A 4XU2A 4M7DB 2DTHA 5LJ5f 4NL3A 4N0AA 3V8LA 4C92E 4M7AC 4XTWA 2YHTA 5LJ3e 4C92G 2DTIA 5GAMf 3RERA 3GIBA 3EFSA 5LJ3d 4M77F 4V2SA 5GANh 3JB9H 1TH7A 3RUXA 3V8KA 4PJOD 1Y96A 3QO3A 4M75F 4QVDA 4M77C 1Y96B 5GAN4 4M78F 5GAN6 4EMKC 4C8QA 4WF2A 1YCYA 3QSUA 4M75C 5LJ5h 2RA2A 3RESA 4JUVA 4C92D 4EMKA 4C8QB 5GANg 2K57A 1N9RA 4M78C 4J6XA 4EMKB 4EMGA 3BY7A 3JCMb 1U1SA 2VXFA 1MGQA 3JCMf 4J6YA 5GAMh 5GAOr 3FJPA 5LJ5g 1WPYA 4XTVA 1U1TA 5DY9A 3JCMP 4HT8A 2DXTA 4NOYA 4XQ3A 1LOJA 4NL2A 2FYKA 3FIFA 4XU1A 4HA8A 5GAMg 4PJOF 1BIBA 1I5LA 3SB2A 1H641 2DKGA 3L1AA 4F7UF 4M7AA 4XTYA 4M7DE 2E41A 4OP0A 4Y91A 4M7AB 4PJOC 4M7DG 3EFRA 3V7CA 1LNXA 5LJ3f 4JLIA 3JCMh 4C92F 3FB9A 3JB9G 1KQ1A 5GMKl 2EJFA 4X9CA 4EMHA 3M4GA 1B34A 2DTOA 2E1HA 2E64A 4M77A 3JCMg 1B34B 2E65A 4M77B 3JCMV 4JRKA 3PGGA 5GMKh 5GAOl 4M75A 2FB7A 3V8JA 5GANj 5GAN2 4M7DD 1JBMA 4M75B 4M78A 1X01A 5LJ5d 3JCMX 4C8QE 4M78B 2ZGWA 4J5YA 2VC8A 5LJ3h 4C8QG 4MMLA 3RIRA 2Y90A 5LJ5j 3JCMW 3JCMc 3BFMA 2I2LA 1N9SA 2VXEA 5GMKj 4DQ2A 3JCMJ 3BW1A 1I8FA 1I4K1 5LJ3g 2DEQA
chains in the Genus database with same CATH superfamily
4A4FA 1F1BB 2D0QB 4FL6A 3RMSA 2DKAA 2HKPA 4CC7A 1RAEB 2EPDA 1ZUKA 1GL5A 2R5MA 3UATA 4E47A 4M7AE 2KE9A 4KH0B 4KULA 1VYVA 1R4XA 3QUIA 1Q86R 4OMPA 3M4YA 2XDPA 3PDKA 2RJEA 4F17A 1NGMA 2RB6A 2L8DA 4JJBA 3HFNA 3S6WA 1D0YA 5CCAA 4RTWA 4ZGEB 3TCJA 1WA7A 4C8QC 1CSKA 5GAOn 2W0ZA 3LGLA 3INZA 1N8RR 4QW2A 5GAN7 3BKQX 1Z9ZA 5KCHA 1LXTA 2KBTA 1YJNT 2DZCA 1JFIC 5FU6B 1RLQC 4F7UG 3F70A 3M55A 4D8DA 2GGRA 2EHBD 4XTWA 2QK0A 2QLVA 1UE9A 2ZPIB 4GLKA 4PJOD 4M77C 1MNDA 4Q5WA 3P8DA 1ABQA 4ELYC 3URGA 1RI0A 1PWTA 2FUVA 2OTLQ 2NWVA 4L6V5 5DY9A 1VQ9T 1OQKA 1DJ7B 1AISA 4LDXA 3CQTA 4NL2A 5GAMg 4HA8A 2DXBA 2CSIA 5A2QE 3SB2A 4QVZA 3A8MB 1MP9A 2A0FB 3P8HA 1VA7A 4BY6C 2LDMA 1ZUUA 1MUZA 1D3UA 3E2UA 3IH7A 4F04B 2L5QA 4VUBA 1VTOA 3OCIA 2NOEA 1UGRB 5LL6S 4M78B 2QEXA 4DA4A 4C0FA 5LJ5j 1IGUA 4J8OA 3EGUA 1IHVA 5LJ3g 1M3HA 1KC8R 1BI0A 2GTJA 1W1FA 4OMNA 3CC4A 4PJOA 3CWAA 3I56Q 4C8QD 3BDUA 2KXCA 3A98A 4EALA 4HCBA 2KT1A 2EJGA 2L3SA 3JB9F 1UG1A 1YI2A 1CKBA 2DAQA 4RTYA 1R0CB 2IV8A 2VWFA 1YWOA 4QKUA 1HU0A 1E7OA 2FPFA 1LJOA 1K2YX 1B9KA 1PRMC 1QP2A 2KVQG 3G6EQ 4M77D 3MP8A 2HSEB 1VQMT 1M5Q1 1YHQT 2HDAA 4HXJA 4KBMB 3OMGA 3CCRT 1YJ9A 4J6WA 4XU3A 4ZN3A 4KRTA 4XTUA 2YUPA 1HSQA 3I55A 1VQKA 2IG0A 1P5GX 1Q9UA 2E4HA 3I9QA 2JJ9A 2RI5A 2CZ0B 1W70A 1N6AA 4CC3A 5GAN6 2IVWA 4EMKC 4C8QA 3QSUA 4M75C 5GANg 2JW4A 2GF7A 1T0HA 2GTOA 8AT1B 2KROA 1U1SA 4PJLA 2CP7A 1QVFP 1Q82U 4HVUA 3OW2P 3OGDA 4JLGA 4EAJA 1YTFA 1JJ2S 3VKIA 4DOVA 3CCSQ 1K8AR 1VQ5A 5KYYB 3PMIA 4A4KA 3H0FA 1LNXA 2CP0A 3MEUA 5HY6A 2KAFA 2COYA 2GNCA 1SSFA 2ZPHB 3OBWA 3ZFJA 1PCMX 4PKCC 2DTOA 4M77A 4JRKA 2HAXA 3VJPA 5A0GA 2K2MA 3CCJT 2CP5A 1X01A 3SNSA 2RJCA 1S1NA 3EGXA 3H0HA 2A28A 2VXEA 1I0CA 3QYGB 5HK0A 4OMFB 1PC0A 2RQWA 3CCEQ 2E70A 3OMCA 2CH4A 1I1JA 5GJWB 4Z02A 3VUZA 3ZBDA 1YITQ 4AFUC 1TUOA 1NE8A 5IXFA 1ZX6A 5FU6C 2LT1A 3H41A 3OYFA 1M2VA 4IUUA 2KXDA 1NEGA 3A8LB 2M0OA 4C92B 2M1HA 5KYUA 1VQ8A 2XD0A 3JB9D 3OBYA 3TVTA 1KD1C 3V7SA 3CWTA 2B86A 2LTOA 1TUCA 4ATOA 1HD3A 4XAXB 3HS8A 2X4XA 1Q86U 3JSCA 3G7ZA 3NA5A 3IQLA 2KGTA 1D09B 2DX1A 4M75D 3CCUQ 2V92A 2A36A 4ESRA 1KG1A 2QAZA 1TG0A 2QQAA 4PJOE 2JMAA 5CAIA 4M7AF 2HEQA 2E10A 2Y4YA 3TEEA 1X6GA 3QWYA 2AT1B 2VGMA 3H8ZA 1N8RU 1IRXA 2K5IA 3KBGA 4LN2A 4V2SA 2GFUA 2MWOA 4M4ZA 2QQBA 4L59A 1TBAB 2FG0A 4QQ6A 5AT1B 3RBBB 5FWCA 2K2VA 2MZ8A 3NFCA 1BK2A 5LJ5h 1K1ZA 2CZ1B 4M78C 3CD6A 2RJDA 2ATCB 1MMNA 3GLXA 2Z0WA 2E3IA 2DYIA 1OI1A 2EFIA 3KUFA 1LOJA 1QWEA 3NTIA 3L2VA 1I5LA 2OX7A 1WJWA 1BI1A 1GBQA 3JB9G 2DLPA 4OMMA 1O75A 1KJWA 4EMHA 2QI2A 2JS0A 3QDRB 3QXEB 2LAEA 3CPFA 2L3RA 1B34B 2YA3A 4AG2C 4M75A 1OOTA 1WHGA 3OH6A 1QNAA 1VQLA 4O6JA 4C8QE 2M16A 1ZBXA 4A4EA 1KQSP 1AVZC 2HL8A 2I2LA 4ELZC 1LWVA 3M53A 2QGFB 1T3SA 3BW1A 2RQRA 1X75C 1D3BA 5L8RE 5AYFA 3OYGA 1BU1A 2OTLT 1NBEB 1ZA1B 3ZL7C 2XMFA 3M58A 1NLPC 4I8OA 3MEWA 1XNIA 4LD6A 1KC8U 3QHSA 3H1ZA 2YLBA 4A54A 7AT1B 2ROLA 2JMCA 3RKYA 4OB2B 2D0BA 4M77E 1FMVA 3OSTA 3CCLA 1NJIR 2KRMA 4MZPA 3CCMQ 1K0SA 4B9XA 3TQ7P 3M9QA 2A08A 2KEAA 2NUTB 1ZSZC 3JCMe 2DBKA 3M59A 1QCFA 3X26B 4MDWA 2DILA 5M9OA 4PFOA 4M78D 2LJ0A 1TOVA 2AZVA 3VS0A 4AFZC 1K73U 5LJ5f 2L0AA 2RK2A 4DBHA 4NL3A 3I56T 1IO6A 4QG5A 1QN7A 3A1PA 1IGQA 1FMKA 3GIBA 1BCOA 3I5SA 5DM7R 1VOKA 1UECA 1VQ9Q 2DJQA 1PCXA 1ZUYA 2C0OA 4HVWA 1N3AA 5IYCP 1V29B 4EMGA 2VXFA 2QA4A 3G4SA 3T4NA 5IT9E 3I35A 2O31A 3GNFB 2DXTA 5IXBA 2HQXA 2A7YA 2Y8LA 4AT1B 4LDVA 3I3WA 3MJXA 3TDHA 2EJFA 1YQMA 2LX9A 2P0QA 2V9JA 1EIFA 3CMAA 1YIJQ 2FKFA 1RAAB 1A0NB 4M78A 1YJNA 3J7AF 3HP9A 4DBFA 1WLPB 1N5ZA 3DLMA 1W80A 2L3PA 4AG1C 1XJWB 1QNEA 1VQ7A 3OYBA 4XK8E 1EZZB 5FU7B 3OW2A 1P5DX 3OY9A 4MMKA 1SSHA 3MO8A 4M7AG 1NYFA 2VKNA 2RM4A 3JCMd 1KY6A 4OVAA 1H92A 1SHFA 4C7PA 2YRDA 4E7ZA 4BACA 4BDYA 3CCST 2K9GA 4OMLA 5KE2A 1CKAA 3PVQA 1Y0MA 3NPFA 1Y71A 2J6OA 4LNPA 1TU0B 1YCSB 2LQKA 4M75E 1YHQQ 3CCRQ 2AZSA 2YLCA 2EYYA 4MRQA 3U23A 2BE7D 3ULXA 1W2BS 2EGEA 4FYWB 1SF9A 3SHWA 2YUNA 5GAOq 3JB9J 4RTVA 5EC7A 4PLLA 4J9GA 4PNOA 4P5NA 3CCET 4UC4A 3LW5E 2MJ7A 1YITT 1VQNQ 2PVGB 4Y92A 2HKQB 1AT1B 1QN9A 3RMQA 1KD1R 4OB1B 3CXCS 4LDYA 3D7QA 1OU8A 2JVVA 3DB3A 4J9FA 3A5ZB 2V8QA 2LRQA 1Y96B 4QT7A 5IN1A 3PVLA 3OYJA 4RODB 6AT1B 4IURA 3MP6A 4C92D 1D1CA 4A4HA 1M90R 2HBPA 1UT4A 4J6YA 2CDTA 1AWWA 4LUDA 2C0IA 4PJOF 1JJ2P 5C0MA 2DKGA 2EYZA 1RAFB 2YRCA 1VQ6Q 5KYYA 2GBQA 3CCUT 4R56A 1K9MC 1UT7A 3EFRA 3FB9A 2MF2A 2QDLA 2XG8D 1OV3A 1VOMA 3M5AA 1M27C 2EYWA 2E1HA 4HCCA 2LT4A 5HK3A 3A8HB 4E7JA 4IL8A 2PNIA 5FLXE 2O3OA 2WSCE 2M9UA 2DE0X 2C0TA 2J6KA 2P4RA 1I8FA 1VQOA 1GCQA 2HBWA 2XIDA 3L2ZA 3UDCA 2HQHA 2XI9A 2DRMA 3UF4A 2OOYA 1JU5C 4QQGA 1WX6A 2JM9A 4HT9A 2KMTA 2LCSA 2JHJA 5IHIA 4FU6A 5IHNA 1K35A 4C92A 3QJ6A 1KQ2A 5GAMe 2G30A 2Z8UA 4ZNXA 4GY5A 4EPCA 3RKWA 1FX7A 3CW7A 1RAHB 3FEOA 4M78E 4X9DA 3O8VA 1Y57A 5CKBA 1YQRA 4C8QF 2EWNA 1TXQA 1PCJX 2QR1A 3G71A 1QKWA 1D3BB 3QZ9B 1H8KA 4BI8B 3DLLA 2JM8A 3AHUA 1NJIU 4D8KA 2OOXA 2V8KA 5I2MA 1VYTA 2X3XD 2Z0FA 1WYXA 3S3NA 3L2UA 2DTHA 2ZZDA 2FZCB 2K4YA 1EX4A 5LJ3e 1SKUB 2JUFA 4FSSA 2ABLA 2VJ0A 4M77F 1OU9A 2EGCA 2OTJA 3HRTA 1S72A 3I0WA 2CP3A 4HVVA 2DK3A 5GAN4 1VQ4A 2V26A 2D0AA 3RESA 3VS2A 4RG8A 3MPUB 3CCMT 2X35A 4EJYA 1VQPA 4HT8A 4NOYA 1M3BA 4A4GA 2I5WA 2FYKA 1RABB 3KRMA 2XK0A 1B7TA 3I0XA 5FU7C 2QEXQ 1YNZA 2E41A 4N4IA 4R55A 3CCVA 3LGFA 3M56A 4JLIA 1AZGB 1Y07A 2DVJA 1B3QA 1XSZA 1B34A 5BMPA 2E65A 1QVGP 3CC4Q 2VC8A 1YI2Q 1X43A 1M4ZA 2KYMA 1Q7YC 2X4YA 4KUIA 1C9BB 2RQVA 1Q95G 3HHTB 2LZ6B 3UA6A 3JV3A 4A53A 3OH9A 1WHHA 2SRCA 3JRZA 1ACMB 5CQYA 5GANe 4LDWA 5GAOm 2LCLA 2IPOB 4JPBW 5FWBA 2MI6A 4LXCA 1N3CA 4J83A 2EAYA 5HCKA 2DM1A 1WJSA 1ZQ1A 3C95A 2H8HA 5F9CA 1IZ6A 1YJ9Q 2E3HA 4D6WA 2H3EB 2NOFA 2AKLA 1OZ3A 2PQWA 3CCQA 2JN0A 3MKDA 2FPEA 1YIJT 2NUTA 1PD0A 5CO7A 2IIMA 3QG1A 2DEUA 1I5OB 1GBRA 2CYZB 2CT4A 1TUGB 4WX8A 1U8RA 4PJOG 3EFOA 3DPTA 2D0NA 4C92E 5I22A 1I07A 1MV3A 4D7QA 1OX9A 2KRSA 3EH1A 3V8KA 1KFIA 1PKSA 4M75F 4X34A 1PM3A 5ECAA 4PFZA 1X2QA 2E6NA 1QQJA 2LQ8A 1K76A 1MGQA 2F2WA 4XQ3A 1PNJA 1KFQA 3F0ZA 1BIBA 3QYHB 4JS4A 2OAUA 1GCPA 4BI4A 1M90U 1WXUA 2NLVA 3OQ5A 2FO0A 1G5VA 5KL0A 3BDLA 3VS3A 3CEYA 4IUTA 1VQNT 2L89A 3CMEA 2KYBA 2KNBB 5DLQE 1ZLMA 2KT8A 2ZGWA 4C8QG 1TWBA 1LVKA 1Z9QA 2YDLA 1N9SA 1K4US 1GFCA 1HJDA 2MIOA 2D9TA 4OGCA 3J80E 5GMKm 5GAN8 1OPLA 2KSSA 2CP2A 4E7IA 1KSWA 3SWNB 1LWWA 3RKXA 1VQ6T 1QN8A 3O5ZA 4TPSA 2VB6A 4M77G 3NTHA 2FZGB 4C0ZA 1H3ZA 2E12A 2DXUA 4FW2A 5FROA 5GAOp 3G6EA 1Q81U 2NOBA 2KI7A 2R57A 1WIEA 3HRSA 2QTXA 2YT6A 1WZOA 3CPWP 3OS5A 4N4GA 1M3QA 3OYNA 4JRPA 3VN5A 3QJYA 2F1LA 1M3AA 4OB0B 3M0RA 2DL8A 4C0DB 2HZMA 2HSPA 3E19A 2JTEA 2EKOA 4M7DB 3ENOC 3UWNA 3CD6Q 4DEXA 3H0IA 1QKXA 4EDUA 3QDFA 1M1KR 2AK5A 3CXCP 2LX7A 1Y96A 2Y8QA 2JZ2A 4M78F 2EQJA 1UGVA 4HJHA 4JUVA 4A63B 2YRVA 2X3WD 2F5TX 3M0UA 3FJPA 5EG2A 3CCSA 2BE9B 1VYUA 3KTUA 1H641 3FC3A 4Y91A 3JCMh 3PE0A 2FKMX 1SHGA 2E64A 1X27A 3RR6A 4E2FB 5JN5A 3FRNA 4CFFA 2NVMA 5GJVB 3VS5A 1YTBA 3RSMA 3G1JA 2O9SA 3N5BB 1YWPA 1WQAA 2BZXA 3BFMA 1AOJA 3C0CA 3JCMJ 3GPLA 1VIFA 1Q82C 3CC7A 2EQUA 2CUDA 5GAMj 1TBPA 1IHWA 3DKMA 3MEVA 3CCLQ 2RI3A 5IH2A 5EPCA 2H4LX 3LX7A 3PT9A 1V5SA 3RPJA 3PNWC 3EAEA 4F7UB 2NYSA 2V8JA 2ZPBB 4RTZA 2PTKA 2QEXT 1MV0B 2E6ZA 4N0AC 4MDXA 3M57A 5CQXA 5J3BA 2HNIA 3EH2A 3EHQA 4GLMA 3NMZC 1WNLA 4M75G 1M9SA 3OSSC 1QVGA 3CBPA 5CK9A 3CC4T 3J81E 3M0SA 4LE9A 5LJ3j 1YJWA 2DD5A 1T3LA 3OYAA 1PKTA 3FLGA 1RAIB 1YI2T 1YQLA 1U06A 4KGXB 4AFQC 3PMTA 2FVUA 1C4GA 3WVDB 1VKLA 2O01E 3R6NA 2QA4Q 3QWXX 3LWHA 3A8OB 5I2SA 3RERA 3E9FA 2NOLA 2ZPEB 2FL7A 2EYQA 4Y28E 1M1FA 1YJ9T 5CKEA 2RF0A 1Q86C 3CC2A 4RKUE 3JCMf 3I55T 1VQKT 2BUDA 3VRZA 2DD4A 4RMOA 3EFOB 3C12A 1UGSB 2RPNA 3T9NA 1P92A 4CC2A 2LMJA 4Z88A 4FCYA 5D7UA 9ATCB 4C92F 1N8RC 3HRUA 4X9CA 4PJNA 4C5IA 1VQ7Q 3VUBA 4JZ3A 2D6FA 4BE2A 2RHXA 1FWZA 5GANj 3UT1A 1JBMA 2XICA 3S3MA 1IREB 3ME9A 4MMLA 4FYXB 3RIRA 5GMKj 1MPGA 1GCQC 1UGPB 5KYNA 1VQ5T 1KO9A 4PLIA 2EQMA 3OYIA 3THKA 1EBMA 2R5AA 2KRNA 2FRYA 1GFDA 3EAYA 2J6FA 1EUVA 4C0DC 3SFMA 2YXYA 2DL7A 4C92C 5KYXB 4QQDA 2LJ3A 4DBRA 1QCNA 3QPHA 1NH2A 1K8AU 4EAGA 3VS1A 1CDWA 3V7RA 1TUDA 1UHCA 1NPPA 5I11A 4M78G 2K6DA 4E7SA 1WFWA 3OC3C 2WSEE 3N89A 4BE0A 4XTXA 4RCBA 4JS5A 2DL5A 1QVFA 1BCMA 3ULRB 1TSFA 2KY9A 1VQ8T 3LWIA 1WHJA 4XU0A 3VU3C 4CC4B 3OW2S 4EJZA 3HKSA 1KC8C 4N0AA 1VQ9A 2YHTA 4J9IA 3DPUA 4J9DA 1VTLE 2PUOB 3M0TA 3REAB 2HMAA 1YCYA 4OGEA 2ZAEA 2QREA 3ZEHA 3MCAB 4WTOB 2NUZA 1M1KU 5GAOr 1WHMA 5GAMh 3DB4A 5LJ5g 3VRYA 3EHRA 3CPWA 1B07A 2MPXC 2EKHA 3FIFA 4PJMA 2XHIA 3GOXA 1LCKA 3I5RA 4XTYA 2LQNA 1K73C 2K3BA 1JXOA 3EG9B 1T0JA 2QQRA 2LVMA 4J7IA 5D6WA 1VQOQ 2HL9A 3LH5A 1K0XA 5J39A 1WJQA 1WXBA 3CD6T 4CI0C 2D1XA 3EG3A 4KT0E 2FB7A 4LD9K 2XU8A 3CBOA 2DERA 1W6XA 4M7DD 1FMWA 1BI3A 2HD0A 3JCMX 2X51A 2QQ9A 1G3WA 3S3OA 2FPDA 2DKCA 5LJ3h 2X4JA 3JCMc 1UJYA 4AMCA 1I4K1 1TS9A 1EFNA 2ED0A 2BIVA 2XDDA 3LYIA 3VS7A 4LDUA 4EAIA 1M1GA 3SWNA 2RK1A 1WQ7A 1R0BG 1BI2A 5L23A 3HL8A 1XTDA 1VQMA 4HCZA 1VQLT 1YHQA 3CCRA 1W4SA 3PTAA 4L5GA 2E5QA 3QKJA 2YUOA 4IKFA 2QTVA 1OULA 1O9SA 2ZPGB 4B9WA 2VUBA 1OX8A 5GAN3 3OB9A 3PMGA 1QN3A 1FXXA 2ZPFB 3OS1A 2DO3A 4C0GA 3VS6A 2OTJQ 1S72Q 4J9BA 3TE5A 2K3XA 4ME7A 5IYBP 1VQ4Q 1WDXA 1YN8A 4M7DA 3NHNA 3CCLT 1PHTA 2PWWA 4C92G 1VQPQ 2DTIA 3GF5A 1NLOC 3NTKA 5GAMf 2AIRB 4IIMA 1AD5A 5GANh 1PZDA 2M0YA 4DBQA 4K11A 3OYDA 3M54A 1KQSA 3CCVQ 4RTTA 4FM4B 2RA2A 4C5HA 2FZKB 2YWWA 2K79A 4EMKB 2CSQA 2IV9A 3TREA 1WPYA 3WXMB 1KY7A 3CCJA 1J3MA 1X6BA 1RAGB 2RN8A 1QVPA 1YQKA 4JJCA 3Q1JA 1IB8A 4E7HA 2SEMA 3V7CA 5LJ3f 3OS0A 5CR2A 1UL7A 1QLYA 3M4GA 2RHIA 1X69A 3SD4A 2EIFA 1DIZA 1M3CA 2QA4T 3G4ST 2K3YA 4KGZB 3EIKA 2LQWA 3FJ5A 1PVSA 1U5SA 2QXFA 4BJUA 4RTUA 4ROEB 2FGTA 1G8XA 4IUQA 3ER0A 2DEQA 2QASA 4WXAA 1VOLB 1M8MA 2BKDN 2YUQA 2DJZA 1OEBA 2XHCA 3SDZA 1ABOA 1HK9A 3CCQQ 4F7UA 3CMAT 1PCZA 2GCXA 2J06A 2JT4A 1GXIE 4D7RA 1QN4A 4WCIA 2M02A 3LH0A 3JCMQ 2H3JA 1QN5A 1G3TA 3TSZA 1WI7A 3FDRA 1NYGA 2MCNA 2C06A 5GAMd 1VQ7T 1NEBA 5CKHA 4C5EA 1PRLC 1WGSA 5BMNA 4JRIA 4RUGA 4ZGJB 1SG5A 1QNBA 2A37A 2EBPA 2DIQA 3MHXA 5GANf 2DFUA 3EG2A 5GMKe 1QMCA 2HL3A 3V8LA 5A0LA 2O9VA 2D8HA 1AWXA 4ZGDB 2NUPB 4JJDA 3L2WA 2KDSA 1QCOA 5LJ3d 3I55Q 1VQKQ 1GRIA 4R0KA 1D0XA 2KQWA 5A0DA 1SPKA 1HYOA 2DBMA 1JDYA 1QTSA 1UTIA 4WF2A 4Q11A 1E6GA 2JXBA 1PSFA 1OYXA 2KR3A 1NJIC 2ECZA 2MMPA 4MZMA 3CMEQ 2K5LA 2R58A 2RQUA 4OMQA 4DULA 2NOIA 2D8JA 3L1AA 3L42A 4J7FA 4M7DE 3OSMA 4M7AB 2BZ8A 2GFAA 1UUEA 2QQSA 3X24B 3QZ5B 4ORZA 5HKCA 3EGDB 3QBYA 2OTLA 4IIOA 1QWFA 1RACB 1VQ5Q 1KYUA 2PVDB 2QG9B 2DYBA 1KD1U 5GAN2 3ASMA 3RNJA 3L2RA 1WXTA 3OYCA 5HSHA 1AHJB 2HZYA 1J3TA 2P0PA 1G83A 1FN7A 2LJ1A 2EJ9A 2V8IA 4KH1B 4TVRA 1I81A 5FRNA 5JMVD 1RL2A 3GNGA 1K73R 5KYXA 5GMKi 4YTLA 1KYDA 3HTRA 5GANd 1V76A 2F2VA 1TGHA 4FT4A 1JQQA 1MHNA 4E6RA 4KUDK 4BDZA 2DL4A 3META 1VQOT 3C04A 4PJJA 2YSQA 2HCKA 3M0QA 1FYNA 1VQ8Q 2LC4A 3I56A 1BIAA 1AWJA 4JDSA 3OYLA 1K9MR 3M0PA 2JOYA 1ZSZB 1JJ2A 1UFFA 4B0AA 1WQWA 4F7UE 4XTZA 2O4XB 2JS2A 4CRIA 2GQIA 1KFZA 3G71T 1X2KA 2QRCA 3QO3A 5IAYA 1UJ0A 1W2BP 4GBQA 2YH5A 4X1VA 4EIKA 3OS2A 1VIEA 1C47A 3UW2A 1R8OB 2PU9B 4ROCB 1YFNA 4FYYB 1U1TA 3A8GB 1E42A 3H9NA 2RJFA 1MMAA 2VGNA 3TU4K 1PD1A 3R6OA 3EG9A 2OTJT 1S72T 2Y4XA 3X28B 1V1CA 1VQ4T 4DOWA 3OYHA 2JNGA 2F69A 1KQ1A 2HKNA 3CC7Q 5KYWB 3HS9A 1QW1A 3VV0A 5CKDA 4HCKA 4LUEA 1VQPT 1YP5A 2QGGA 1ZA2B 2DF6A 3CWUA 4B6MA 1ZSGA 3CCVT 1BB9A 2NWMA 1VQLQ 3LLRA 2EW3A 1UB4A 2COWA 1IXDA 4OMOA 3EG1A 2COZA 1M90C 1SRMA 5CVIA 1KHCA 2DPPB 2L3QA 1G3YA 3PFSA 2CGHA 1YJWQ 3VYGA 2V1RA 2OAWA 4F16A 1NM7A 2PUKB 3CCEA 1NVPA 1WHKA 2L2PA 4BE1A 4PFPA 1YITA 2K5FA 3HSBA 2XKOC 1QP3A 1AEYA 4OF1A 5AN4A 1QTPA 2OI3A 2AKKA 1C1AA 2M51A 3P8BB 5D6XA 4Z89A 2KK4A 4C5GA 2NOZA 1SRLA 4XU2A 4N4HA 2DL3A 3CC2Q 4M7AC 3CCQT 2EYXA 1E6HA 1G3SA 3VS4A 1KHIA 3GP8A 2RHZA 1XOVA 1BKBA 3JB9H 1TH7A 1Q81C 3OYEA 3CCUA 4QVDA 1JB0E 3F10A 5DLOA 1Q7YR 1QVGS 1K9AA 1ZBJA 4EMKA 3PIOA 1YBYA 1WJRA 1N9RA 2FRWA 4J6XA 3BY7A 4RG2A 3PIPA 4JZ4A 2RO0A 1QN6A 2PVOB 1ARKA 1VUBA 4XU1A 3UA7A 3G4SQ 2I0NA 1AZEA 2WSFE 4ANJA 2ENMA 3E1SA 3C4SA 2GQVA 3JCMV 2DA9A 5GAOl 4IUPA 3REBB 2JOIA 1PSEA 1R77A 4J5YA 4J9EA 4HKEA 3KXTA 3CMAQ 2VV5A 2Y90A 3JCMW 2B8AA 2RNAA 2R5XA 3OSEA 4PL6A 1YJNQ 1RLPC 1RM1A 1D1BA 5CKFA 2ZFDB 2DVEA 1RADB 2CS7A 2E5KA 3SWNC 2G3RA 2JTFA 3CMET 2F7LA 4PJOB 4M7DF 2A3LA 2DXCA 5LJ5e 2X9HA 4PK4A 5C6SA 2CREA 2LNVA 1RI9A 2WACA 1BBZA 2VASA 2DZ9A 2RD1A 4F14A 3VYHB 4M7AD 1SEMA 2EVRA 2BZYA 2LP5A 1MMGA 1KYFA 4FYVB 2O88A 3MP1A 3AT1B 4QVCA 3CWSA 3HFOA 4WZSD 2DNUA 3QIIA 2PZ1A 1UGQB 3WVEB 1M8VA 4M7DC 4RTXA 2CP6A 3CCMA 2DETA 1MMDA 1NZ9A 3G6ET 3E9GA 4Z8AA 1K9MU 2BTTA 2NUPA 3CVTA 2CUBA 2ROTA 2VVKA 4FW1A 1M30A 2HZSA 4J9CA 1M2OA 2O2OA 3RDVA 2EQKA 3D7SB 1LPLA 4PY5A 4NS5A 2ED1A 2RHUA 3GBQA 4C8QB 4E7LA 5KCOA 2ZCFB 2RQTA 2MYSA 4BD3A 1N27A 4XTVA 1KIKA 1QVFS 3JCMP 1UDLA 4BB7A 4F7UF 4M7AA 3CBMA 1XQHA 1KK7A 5GMKl 2QDYB 2ESWA 2LCCA 3EGDA 4JJNK 1MNEA 1ZHIA 5FRMA 3OA6A 1NG2A 1OZ2A 2J7IA 3JCMg 4M77B 5D6YA 5KH6A 3V8JA 3JAME 3ENCA 2J05A 1OPKA 2CH4W 4FT2A 5LJ5d 2EQIA 2P0KA 1VQMQ 1W2BA 2AHJB 1TTHB 4ZTJA 3EGXB 1AWOA 2QYZA 2K7AA 5FW9A 5IYDP 1UEBA 1UHFA 3HPWA 3H6ZA 2CZ7B 1LWYA 2DRKA 1C6VX 5GAN5 3CPWS 3OLPA 3BE3A 1YIJA 1N39A 4BY6B 4MZTA 2F5KA 4E7KA 5I21A 1QNCA 4FSXA 2MOXA 1M2VB 1HXDA 1JRIA 2CZ6B 4JRQA 3OYYA 4AFSC 4ZN1A 3CXCA 1C0MA 5KYUB 1JO8A 4FIBA 3CC7T 2OJ2A 3SEMA 2D0CA 2RMOA 2FEIA 1D1AA 2W10A 5KE3A 3UPUA 2JTMA 2P84A 2G6FX 3KFVA 2MK5A 2DKDA 2LNHB 2XDBA 2VYTA 4RCCA 1ZSZA 3X25B 3JB9I 3G71Q 1H3HA 1G2BA 1BYMA 3X20B 2F2XA 2RH2A 2O4XA 3OYKA 3EG0A 2HQEA 2MWPA 1WHLA 2MAMA 1K8AC 3CCJQ 2JHNA 2H5AX 4KGVB 3EFSA 1YJWT 4II1A 4O5VA 3RUXA 3OSVA 1Q82R 5CIUA 1JEGA 3TSWA 3ASKA 1PG5B 1RUWA 4BUGA 2K57A 2DMOA 3JCMb 1VQNA 3L2QA 1U3OA 8ATCB 4IUVA 1Q7YU 3NGPA 4DEYA 4OB3B 2CT3A 4EAKA 4OP0A 3MEAA 2NLUA 2NOHA 4PJOC 4M7DG 1D0ZA 5KYWA 2JPIA 1JXMA 5J26A 1Y7XA 1Q81R 3CC2T 2FHDA 2DIGA 5GMKh 3PGGA 2RHYA 2V1QA 2CKKA 4M75B 3C94A 4BI3A 1KQSS 1VQ6A 4ZTFA 1T6AA 1X6OA 4J9HA 1M1KC 1NPRA 2X4WA 2QRDA 5IHKA 2EGAA 2RI2A 4DQ2A 3OYMA 2HL5C 2P4TA 3D4VA 3CVSA
chains in the Genus database with same CATH topology
5GAMj 2P0PA 2V8IA 2EJ9A 3DKMA 4TVRA 3MEVA 4A4FA 1I81A 2RI3A 4XK8E 2D0QB 1RL2A 4FL6A 3GNGA 3RMSA 5FRNA 5FU7B 3LX7A 3OW2A 3OY9A 3PT9A 4MMKA 2R5MA 3MO8A 4E47A 5GMKi 3PNWC 3EAEA 4YTLA 4F7UB 4M7AE 4M7AG 2RM4A 3JCMd 5GANd 4KULA 2V8JA 2ZPBB 4OVAA 4FT4A 2QEXT 1MHNA 4BACA 4BDYA 3CCST 5KE2A 3QUIA 2E6ZA 4KUDK 4N0AC 4MDXA 4BDZA 3M4YA 3M57A 2XDPA 1Y71A 3META 2RJEA 5CQXA 5J3BA 2HNIA 2LQKA 4M75E 1VQOT 2RB6A 2L8DA 1WNLA 4M75G 1M9SA 3OSSC 1QVGA 3HFNA 2LC4A 2YLCA 3I56A 3CBPA 3S6WA 5CK9A 3CC4T 3J81E 5CCAA 4ZGEB 1BIAA 3TCJA 5LJ3j 1YJWA 4C8QC 2DD5A 1W2BS 3OYAA 5GAOn 4JDSA 3OYLA 5GAOq 3FLGA 3LGLA 3INZA 1YI2T 3JB9J 2JOYA 4QW2A 5GAN7 3PMTA 4PLLA 2FVUA 4PNOA 5KCHA 1JJ2A 3WVDB 1YJNT 2DZCA 4P5NA 1WQWA 4F7UE 3CCET 4UC4A 4XTZA 5FU6B 4F7UG 2O01E 3F70A 3LW5E 2O4XB 3M55A 2PVGB 4CRIA 1YITT 4XTWA 3LWHA 3A8OB 3G71T 3RMQA 5I2SA 3RERA 2ZPIB 4OB1B 3E9FA 4GLKA 3CXCS 4LDYA 4PJOD 2ZPEB 2FL7A 2EYQA 2JVVA 3DB3A 3QO3A 3A5ZB 5IAYA 4M77C 2LRQA 1Y96B 4Y28E 5IN1A 3OYJA 1M1FA 1YJ9T 4Q5WA 3P8DA 4IURA 3MP6A 1VIEA 5CKEA 3OS2A 4C92D 1R8OB 4ELYC 1Q86C 4A4HA 2PU9B 2HBPA 3CC2A 4RKUE 3JCMf 4J6YA 3URGA 3I55T 1VQKT 1RI0A 2BUDA 4L6V5 1U1TA 5DY9A 3A8GB 1VQ9T 2DD4A 4RMOA 1DJ7B 2RJFA 2VGNA 4NL2A 5GAMg 4LDXA 4HA8A 2DXBA 3C12A 1UGSB 4PJOF 5A2QE 3TU4K 5C0MA 3SB2A 3R6OA 2DKGA 3T9NA 4QVZA 3A8MB 1P92A 2OTJT 1S72T 2Y4XA 3P8HA 3X28B 4R56A 3CCUT 4BY6C 3EFRA 2LDMA 1K9MC 1VQ4T 4DOWA 3OYHA 2JNGA 4C92F 3FB9A 2F69A 1KQ1A 2MF2A 2XG8D 1N8RC 3HRUA 3M5AA 1QW1A 4X9CA 3VV0A 5CKDA 4C5IA 3VUBA 2E1HA 2L5QA 4HCCA 2LT4A 4VUBA 5HK3A 3A8HB 4E7JA 2D6FA 4BE2A 2RHXA 1FWZA 5GANj 1VQPT 3UT1A 5FLXE 1JBMA 2XICA 1UGRB 5LL6S 4M78B 2QEXA 3S3MA 1VQNT 2WSCE 1IREB 2M9UA 3ME9A 4DA4A 4MMLA 3RIRA 4C0FA 5LJ5j 5GMKj 4J8OA 3CCVT 1UGPB 1VQ5T 1I8FA 1VQOA 3LLRA 4PLIA 2EQMA 5LJ3g 3OYIA 2XIDA 3L2ZA 1BI0A 3UDCA 1UB4A 2XI9A 2R5AA 4PJOA 3CC4A 4QQGA 4C8QD 1M90C 3BDUA 4HT9A 5CVIA 4C0DC 2KMTA 4HCBA 1KHCA 2DPPB 3SFMA 4C92C 4FU6A 1G3YA 2EJGA 3PFSA 2CGHA 4QQDA 3JB9F 4C92A 3VYGA 1YI2A 3QPHA 1K8AU 3QJ6A 1KQ2A 2DAQA 2PUKB 5GAMe 1Q82C 3CCEA 4GY5A 4EPCA 3RKWA 4BE1A 3V7RA 3OYBA 1FX7A 3FEOA 1YITA 1NPPA 4M78E 4X9DA 2K5FA 3O8VA 5CKBA 4M78G 2EWNA 2XKOC 1LJOA 4C8QF 3HSBA 3G71A 1QP2A 2WSEE 1QP3A 1D3BB 3QZ9B 4BE0A 4XTXA 2KVQG 4OF1A 4RCBA 4BI8B 3DLLA 4JS5A 1QVFA 4M77D 3MP8A 1VQMT 1M5Q1 1NJIU 1YHQT 3AHUA 4KBMB 2KY9A 3OMGA 3CCRT 1YJ9A 4J6WA 4XU3A 1VQ8T 2V8KA 3LWIA 3P8BB 5I2MA 5D6XA 4ZN3A 2KK4A 4XU0A 3VU3C 4XTUA 3OW2S 3S3NA 4C5GA 4XU2A 3I55A 1VQKA 2IG0A 2DTHA 3HKSA 3L2UA 1KC8C 2ZZDA 4N0AA 4N4HA 1VQ9A 3CCQT 4M7AC 2YHTA 2K4YA 5LJ3e 2JUFA 1G3SA 1KHIA 3GP8A 2RHZA 2RI5A 4M77F 1XOVA 1BKBA 2CZ0B 3JB9H 1TH7A 2PUOB 2OTJA 3HRTA 1S72A 1Q81C 3OYEA 3CCUA 4QVDA 1JB0E 1N6AA 5GAN4 2DK3A 5GAN6 5DLOA 1VQ4A 2IVWA 4EMKC 4C8QA 1YCYA 3QSUA 4M75C 4OGEA 3RESA 5GANg 2GF7A 3ZEHA 4EMKA 3PIOA 1YBYA 1WJRA 1N9RA 4J6XA 3MCAB 4RG8A 3BY7A 3CCMT 1U1SA 2X35A 4RG2A 3PIPA 5GAMh 5GAOr 3DB4A 1M1KU 5LJ5g 1Q82U 3CPWA 2RO0A 1VQPA 4HT8A 2PVOB 4NOYA 4A4GA 1VUBA 4JLGA 2FYKA 3FIFA 4XU1A 1VQ7A 2XK0A 3GOXA 3VKIA 1JJ2S 4DOVA 5FU7C 4XTYA 2E41A 4N4IA 4R55A 3CCVA 1K73C 3LGFA 1VQ5A 2WSFE 3M56A 3PMIA 4A4KA 2QQRA 1LNXA 2LVMA 3MEUA 4JLIA 5HY6A 2KAFA 3E1SA 3OBWA 2ZPHB 1SSFA 1Y07A 3C4SA 4J7IA 5D6WA 3ZFJA 4PKCC 1B34A 2DTOA 5J39A 4M77A 1WJQA 2GQVA 3CD6T 2E65A 4CI0C 3JCMV 4JRKA 2HAXA 5GAOl 4KT0E 2FB7A 4IUPA 2XU8A 3CBOA 3VJPA 5A0GA 3CCJT 4LD9K 4M7DD 1BI3A 2HD0A 1X01A 3JCMX 2QQ9A 1G3WA 3S3OA 1PSEA 4J5YA 3KXTA 2VC8A 2X4JA 2RJCA 4HKEA 5LJ3h 2VV5A 2Y90A 3JCMW 2B8AA 3JCMc 2VXEA 3QYGB 5HK0A 4OMFB 4PL6A 5CKFA 1I4K1 1M4ZA 2E70A 3OMCA 1Q7YC 2BIVA 2DVEA 2X4YA 4KUIA 2CS7A 4Z02A 3HHTB 3VUZA 3LYIA 3ZBDA 2XDDA 3SWNC 2G3RA 4LDUA 4A53A 1M1GA 2JTFA 3SWNA 3JRZA 2RK1A 1WQ7A 5CQYA 1NE8A 5GANe 1BI2A 3CMET 4LDWA 4M7DF 4PJOB 5GAOm 2LCLA 2A3LA 5FU6C 2LT1A 2DXCA 3OYFA 2MI6A 1XTDA 3HL8A 4IUUA 1VQMA 4HCZA 4J83A 1VQLT 1YHQA 5LJ5e 3A8LB 2EAYA 2M0OA 4C92B 3CCRA 1W4SA 2M1HA 3PTAA 4L5GA 1VQ8A 5C6SA 1WJSA 1ZQ1A 2E5QA 3C95A 2LNVA 2WACA 2XD0A 3QKJA 1IZ6A 4IKFA 3JB9D 2DZ9A 4D6WA 3OBYA 2RD1A 1KD1C 3VYHB 1O9SA 3V7SA 4M7AD 1OZ3A 2LTOA 2PQWA 2ZPGB 4B9WA 3CCQA 4ATOA 2JN0A 2VUBA 1YIJT 4XAXB 5GAN3 3OB9A 3MP1A 2X4XA 1Q86U 1FXXA 3JSCA 2ZPFB 3G7ZA 3OS1A 5CO7A 3QG1A 4QVCA 2DO3A 4C0GA 3HFOA 2CYZB 3QIIA 4M75D 1UGQB 2K3XA 4ME7A 3WVEB 1M8VA 4PJOE 1KG1A 2QQAA 4M7DC 1U8RA 4PJOG 5CAIA 4M7DA 4M7AF 3CCMA 3CCLT 2E10A 1NZ9A 2Y4YA 3G6ET 3E9GA 3TEEA 4C92E 1K9MU 3H8ZA 2VGMA 4C92G 1N8RU 2DTIA 3GF5A 3NTKA 2K5IA 5GAMf 3KBGA 2EQKA 4V2SA 2GFUA 2MWOA 5GANh 3V8KA 2QQBA 3OYDA 4M75F 4L59A 4NS5A 3M54A 4QQ6A 4X34A 1KQSA 2K2VA 3NFCA 4FM4B 5LJ5h 2RA2A 2E6NA 2RHUA 2CZ1B 4C5HA 4C8QB 4M78C 4E7LA 2LQ8A 4EMKB 5KCOA 3CD6A 1MGQA 2ZCFB 4BD3A 3TREA 1N27A 2RJDA 1WPYA 4XTVA 3WXMB 1QVFS 3GLXA 3CCJA 3JCMP 4XQ3A 1OI1A 2EFIA 3KUFA 1LOJA 3NTIA 3L2VA 1BIBA 1I5LA 4BB7A 3QYHB 4F7UF 4JS4A 1QVPA 2OAUA 4M7AA 3CBMA 1XQHA 4BI4A 1M90U 3Q1JA 4E7HA 3OQ5A 1BI1A 3V7CA 5LJ3f 3OS0A 5CR2A 3JB9G 5GMKl 2QDYB 2LCCA 1O75A 1G5VA 3BDLA 4EMHA 4JJNK 2QI2A 3M4GA 2RHIA 1ZHIA 3QDRB 3QXEB 3CEYA 2EIFA 2L3RA 3CPFA 2L89A 1OZ2A 1B34B 4IUTA 3SD4A 3JCMg 3G4ST 3CMEA 2QA4T 2K3YA 4M77B 4M75A 5D6YA 5KH6A 3V8JA 3JAME 1QVGS 4FT2A 5DLQE 5LJ5d 1VQLA 4O6JA 4C8QE 2M16A 1ZBXA 2ZGWA 4A4EA 2P0KA 1W2BA 4C8QG 2AHJB 2QXFA 2I2LA 1N9SA 4ELZC 4ZTJA 3M53A 3BW1A 4IUQA 3ER0A 1X75C 2DEQA 1UEBA 3HPWA 2D9TA 1D3BA 2CZ7B 3H6ZA 4OGCA 2BKDN 5GMKm 5L8RE 3J80E 5AYFA 5GAN5 3OYGA 3CPWS 2DJZA 2XHCA 3SDZA 5GAN8 1HK9A 1YIJA 2KSSA 2OTLT 4F7UA 3CMAT 3M58A 4E7IA 2GCXA 4BY6B 4MZTA 3SWNB 1GXIE 2F5KA 4E7KA 5I21A 3MEWA 1XNIA 4LD6A 1KC8U 3QHSA 4FSXA 3RKXA 2YLBA 4A54A 3LH0A 1HXDA 1JRIA 2CZ6B 2H3JA 3JCMQ 4JRQA 5FRMA 1VQ6T 3RKYA 1G3TA 3OYYA 3OA6A 4ZN1A 4OB2B 3CXCA 4M77E 3FDRA 4FIBA 4M77G 3NTHA 3CC7T 3CCLA 2C06A 4C0ZA 4MZPA 5GAMd 1H3ZA 2E12A 2DXUA 5FROA 5GAOp 3G6EA 5CKHA 4B9XA 4C5EA 1Q81U 1VQ7T 5KE3A 2R57A 3M9QA 3UPUA 2JTMA 3HRSA 1WGSA 2QTXA 4JRIA 4ZGJB 3OS5A 4N4GA 3JCMe 2XDBA 3OYNA 4JRPA 2VYTA 3M59A 4RCCA 3X25B 3JB9I 3X26B 3QJYA 4MDWA 5M9OA 2DIQA 3MHXA 4OB0B 4M78D 5GANf 1BYMA 4C0DB 3X20B 5GMKe 2RH2A 3E19A 2O4XA 3OYKA 2EKOA 4M7DB 3UWNA 2HQEA 5LJ5f 1K73U 2MWPA 2RK2A 3V8LA 5A0LA 4NL3A 2MAMA 3I56T 4ZGDB 1K8AC 4EDUA 3L2WA 3GIBA 2KDSA 3EFSA 1YJWT 5LJ3d 5DM7R 4II1A 2KQWA 4O5VA 3RUXA 3OSVA 1Y96A 5A0DA 2JZ2A 5CIUA 4M78F 3ASKA 2EQJA 4WF2A 4JUVA 4BUGA 2K57A 1V29B 2YRVA 2F5TX 4EMGA 3JCMb 1VQNA 2VXFA 2QA4A 3G4SA 1PSFA 3L2QA 1OYXA 3FJPA 5EG2A 5IT9E 1NJIC 2MMPA 4MZMA 3CCSA 3GNFB 2DXTA 4IUVA 2K5LA 2R58A 1Q7YU 2HQXA 4OB3B 1H641 2A7YA 3L1AA 3L42A 4J7FA 3FC3A 4M7DE 4OP0A 3MEAA 2NLUA 4Y91A 4M7AB 4PJOC 4M7DG 4LDVA 2GFAA 3JCMh 2QQSA 3X24B 5J26A 2EJFA 2LX9A 2P0QA 3QZ5B 5HKCA 1Y7XA 3QBYA 1EIFA 2E64A 2OTLA 3CC2T 3CMAA 2PVDB 2FHDA 2DIGA 3FRNA 3PGGA 5GMKh 2RHYA 1KD1U 5GAN2 2CKKA 4M78A 4M75B 1YJNA 3J7AF 3HP9A 3C94A 4BI3A 1KQSS 1VQ6A 3N5BB 3L2RA 4ZTFA 1X6OA 1M1KC 1NPRA 2X4WA 3DLMA 3BFMA 3JCMJ 2RI2A 4DQ2A 3OYMA 3OYCA 2P4TA 3GPLA 1VIFA 1AHJB 3CC7A 2EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM j;  3L2Z A;  1D3B A;  2EJ9 A;  5GMK m;  2DVE A;  1I81 A;  5GAN 5;  2DJZ A;  3SWN C;  5GAN 8;  1HK9 A;  4A53 A;  4PJO A;  3SWN A;  4F7U A;  4C8Q D;  5GAN e;  1WQ7 A;  4MMK A;  3BDU A;  4HT9 A;  4M7A E;  4PJO B;  5GMK i;  4M7D F;  3SWN B;  4F7U B;  5GAO m;  4M7A G;  4C92 C;  2RM4 A;  3JCM d;  2EJG A;  5GAN d;  2CGH A;  3JB9 F;  5I21 A;  4C92 A;  3QHS A;  3RKX A;  5LJ5 e;  2YLB A;  2EAY A;  4A54 A;  1HXD A;  1JRI A;  4C92 B;  3JCM Q;  3QUI A;  3RKY A;  1KQ2 A;  4N0A C;  4M77 E;  5GAM e;  3JB9 D;  2DZ9 A;  2RD1 A;  4M77 G;  3RKW A;  2HNI A;  4M75 E;  3V7S A;  2RB6 A;  3V7R A;  5GAM d;  4M7A D;  2DXU A;  1WNL A;  4M75 G;  4M78 E;  5GAO p;  3HFN A;  4X9D A;  2YLC A;  2JN0 A;  4M78 G;  2EWN A;  4C8Q F;  1LJO A;  3HSB A;  5GAN 3;  2QTX A;  1BIA A;  5LJ3 j;  4JRI A;  1D3B B;  4C8Q C;  4XTX A;  4RCB A;  4QVC A;  4M77 D;  3JCM e;  5GAO n;  3HFO A;  5GAO q;  4RCC A;  3JB9 I;  1M5Q 1;  3INZ A;  3AHU A;  3JB9 J;  5GAN 7;  4M75 D;  4PNO A;  4J6W A;  4XU3 A;  4M78 D;  5GAN f;  4PJO E;  1M8V A;  2DZC A;  4M7D C;  1WQW A;  4XU0 A;  3VU3 C;  4F7U E;  4XTZ A;  4XTU A;  4PJO G;  5CAI A;  5GMK e;  4M7D A;  4M7A F;  4F7U G;  2E10 A;  4XU2 A;  4M7D B;  2DTH A;  5LJ5 f;  4NL3 A;  4N0A A;  3V8L A;  4C92 E;  4M7A C;  4XTW A;  2YHT A;  5LJ3 e;  4C92 G;  2DTI A;  5GAM f;  3RER A;  3GIB A;  3EFS A;  5LJ3 d;  4M77 F;  4V2S A;  5GAN h;  3JB9 H;  1TH7 A;  3RUX A;  3V8K A;  4PJO D;  1Y96 A;  3QO3 A;  4M75 F;  4QVD A;  4M77 C;  1Y96 B;  5GAN 4;  4M78 F;  5GAN 6;  4EMK C;  4C8Q A;  4WF2 A;  1YCY A;  3QSU A;  4M75 C;  5LJ5 h;  2RA2 A;  3RES A;  4JUV A;  4C92 D;  4EMK A;  4C8Q B;  5GAN g;  2K57 A;  1N9R A;  4M78 C;  4J6X A;  4EMK B;  4EMG A;  3BY7 A;  3JCM b;  1U1S A;  2VXF A;  1MGQ A;  3JCM f;  4J6Y A;  5GAM h;  5GAO r;  3FJP A;  5LJ5 g;  1WPY A;  4XTV A;  1U1T A;  5DY9 A;  3JCM P;  4HT8 A;  2DXT A;  4NOY A;  4XQ3 A;  1LOJ A;  4NL2 A;  2FYK A;  3FIF A;  4XU1 A;  4HA8 A;  5GAM g;  4PJO F;  1BIB A;  1I5L A;  3SB2 A;  1H64 1;  2DKG A;  3L1A A;  4F7U F;  4M7A A;  4XTY A;  4M7D E;  2E41 A;  4OP0 A;  4Y91 A;  4M7A B;  4PJO C;  4M7D G;  3EFR A;  3V7C A;  1LNX A;  5LJ3 f;  4JLI A;  3JCM h;  4C92 F;  3FB9 A;  3JB9 G;  1KQ1 A;  5GMK l;  2EJF A;  4X9C A;  4EMH A;  3M4G A;  1B34 A;  2DTO A;  2E1H A;  2E64 A;  4M77 A;  3JCM g;  1B34 B;  2E65 A;  4M77 B;  3JCM V;  4JRK A;  3PGG A;  5GMK h;  5GAO l;  4M75 A;  2FB7 A;  3V8J A;  5GAN j;  5GAN 2;  4M7D D;  1JBM A;  4M75 B;  4M78 A;  1X01 A;  5LJ5 d;  3JCM X;  4C8Q E;  4M78 B;  2ZGW A;  4J5Y A;  2VC8 A;  5LJ3 h;  4C8Q G;  4MML A;  3RIR A;  2Y90 A;  5LJ5 j;  3JCM W;  3JCM c;  3BFM A;  2I2L A;  1N9S A;  2VXE A;  5GMK j;  4DQ2 A;  3JCM J;  3BW1 A;  1I8F A;  1I4K 1;  5LJ3 g;  2DEQ A; 
#chains in the Genus database with same CATH topology
 4A4F A;  1F1B B;  2D0Q B;  4FL6 A;  3RMS A;  2DKA A;  2HKP A;  4CC7 A;  1RAE B;  2EPD A;  1ZUK A;  1GL5 A;  2R5M A;  3UAT A;  4E47 A;  4M7A E;  2KE9 A;  4KH0 B;  4KUL A;  1VYV A;  1R4X A;  3QUI A;  1Q86 R;  4OMP A;  3M4Y A;  2XDP A;  3PDK A;  2RJE A;  4F17 A;  1NGM A;  2RB6 A;  2L8D A;  4JJB A;  3HFN A;  3S6W A;  1D0Y A;  5CCA A;  4RTW A;  4ZGE B;  3TCJ A;  1WA7 A;  4C8Q C;  1CSK A;  5GAO n;  2W0Z A;  3LGL A;  3INZ A;  1N8R R;  4QW2 A;  5GAN 7;  3BKQ X;  1Z9Z A;  5KCH A;  1LXT A;  2KBT A;  1YJN T;  2DZC A;  1JFI C;  5FU6 B;  1RLQ C;  4F7U G;  3F70 A;  3M55 A;  4D8D A;  2GGR A;  2EHB D;  4XTW A;  2QK0 A;  2QLV A;  1UE9 A;  2ZPI B;  4GLK A;  4PJO D;  4M77 C;  1MND A;  4Q5W A;  3P8D A;  1ABQ A;  4ELY C;  3URG A;  1RI0 A;  1PWT A;  2FUV A;  2OTL Q;  2NWV A;  4L6V 5;  5DY9 A;  1VQ9 T;  1OQK A;  1DJ7 B;  1AIS A;  4LDX A;  3CQT A;  4NL2 A;  5GAM g;  4HA8 A;  2DXB A;  2CSI A;  5A2Q E;  3SB2 A;  4QVZ A;  3A8M B;  1MP9 A;  2A0F B;  3P8H A;  1VA7 A;  4BY6 C;  2LDM A;  1ZUU A;  1MUZ A;  1D3U A;  3E2U A;  3IH7 A;  4F04 B;  2L5Q A;  4VUB A;  1VTO A;  3OCI A;  2NOE A;  1UGR B;  5LL6 S;  4M78 B;  2QEX A;  4DA4 A;  4C0F A;  5LJ5 j;  1IGU A;  4J8O A;  3EGU A;  1IHV A;  5LJ3 g;  1M3H A;  1KC8 R;  1BI0 A;  2GTJ A;  1W1F A;  4OMN A;  3CC4 A;  4PJO A;  3CWA A;  3I56 Q;  4C8Q D;  3BDU A;  2KXC A;  3A98 A;  4EAL A;  4HCB A;  2KT1 A;  2EJG A;  2L3S A;  3JB9 F;  1UG1 A;  1YI2 A;  1CKB A;  2DAQ A;  4RTY A;  1R0C B;  2IV8 A;  2VWF A;  1YWO A;  4QKU A;  1HU0 A;  1E7O A;  2FPF A;  1LJO A;  1K2Y X;  1B9K A;  1PRM C;  1QP2 A;  2KVQ G;  3G6E Q;  4M77 D;  3MP8 A;  2HSE B;  1VQM T;  1M5Q 1;  1YHQ T;  2HDA A;  4HXJ A;  4KBM B;  3OMG A;  3CCR T;  1YJ9 A;  4J6W A;  4XU3 A;  4ZN3 A;  4KRT A;  4XTU A;  2YUP A;  1HSQ A;  3I55 A;  1VQK A;  2IG0 A;  1P5G X;  1Q9U A;  2E4H A;  3I9Q A;  2JJ9 A;  2RI5 A;  2CZ0 B;  1W70 A;  1N6A A;  4CC3 A;  5GAN 6;  2IVW A;  4EMK C;  4C8Q A;  3QSU A;  4M75 C;  5GAN g;  2JW4 A;  2GF7 A;  1T0H A;  2GTO A;  8AT1 B;  2KRO A;  1U1S A;  4PJL A;  2CP7 A;  1QVF P;  1Q82 U;  4HVU A;  3OW2 P;  3OGD A;  4JLG A;  4EAJ A;  1YTF A;  1JJ2 S;  3VKI A;  4DOV A;  3CCS Q;  1K8A R;  1VQ5 A;  5KYY B;  3PMI A;  4A4K A;  3H0F A;  1LNX A;  2CP0 A;  3MEU A;  5HY6 A;  2KAF A;  2COY A;  2GNC A;  1SSF A;  2ZPH B;  3OBW A;  3ZFJ A;  1PCM X;  4PKC C;  2DTO A;  4M77 A;  4JRK A;  2HAX A;  3VJP A;  5A0G A;  2K2M A;  3CCJ T;  2CP5 A;  1X01 A;  3SNS A;  2RJC A;  1S1N A;  3EGX A;  3H0H A;  2A28 A;  2VXE A;  1I0C A;  3QYG B;  5HK0 A;  4OMF B;  1PC0 A;  2RQW A;  3CCE Q;  2E70 A;  3OMC A;  2CH4 A;  1I1J A;  5GJW B;  4Z02 A;  3VUZ A;  3ZBD A;  1YIT Q;  4AFU C;  1TUO A;  1NE8 A;  5IXF A;  1ZX6 A;  5FU6 C;  2LT1 A;  3H41 A;  3OYF A;  1M2V A;  4IUU A;  2KXD A;  1NEG A;  3A8L B;  2M0O A;  4C92 B;  2M1H A;  5KYU A;  1VQ8 A;  2XD0 A;  3JB9 D;  3OBY A;  3TVT A;  1KD1 C;  3V7S A;  3CWT A;  2B86 A;  2LTO A;  1TUC A;  4ATO A;  1HD3 A;  4XAX B;  3HS8 A;  2X4X A;  1Q86 U;  3JSC A;  3G7Z A;  3NA5 A;  3IQL A;  2KGT A;  1D09 B;  2DX1 A;  4M75 D;  3CCU Q;  2V92 A;  2A36 A;  4ESR A;  1KG1 A;  2QAZ A;  1TG0 A;  2QQA A;  4PJO E;  2JMA A;  5CAI A;  4M7A F;  2HEQ A;  2E10 A;  2Y4Y A;  3TEE A;  1X6G A;  3QWY A;  2AT1 B;  2VGM A;  3H8Z A;  1N8R U;  1IRX A;  2K5I A;  3KBG A;  4LN2 A;  4V2S A;  2GFU A;  2MWO A;  4M4Z A;  2QQB A;  4L59 A;  1TBA B;  2FG0 A;  4QQ6 A;  5AT1 B;  3RBB B;  5FWC A;  2K2V A;  2MZ8 A;  3NFC A;  1BK2 A;  5LJ5 h;  1K1Z A;  2CZ1 B;  4M78 C;  3CD6 A;  2RJD A;  2ATC B;  1MMN A;  3GLX A;  2Z0W A;  2E3I A;  2DYI A;  1OI1 A;  2EFI A;  3KUF A;  1LOJ A;  1QWE A;  3NTI A;  3L2V A;  1I5L A;  2OX7 A;  1WJW A;  1BI1 A;  1GBQ A;  3JB9 G;  2DLP A;  4OMM A;  1O75 A;  1KJW A;  4EMH A;  2QI2 A;  2JS0 A;  3QDR B;  3QXE B;  2LAE A;  3CPF A;  2L3R A;  1B34 B;  2YA3 A;  4AG2 C;  4M75 A;  1OOT A;  1WHG A;  3OH6 A;  1QNA A;  1VQL A;  4O6J A;  4C8Q E;  2M16 A;  1ZBX A;  4A4E A;  1KQS P;  1AVZ C;  2HL8 A;  2I2L A;  4ELZ C;  1LWV A;  3M53 A;  2QGF B;  1T3S A;  3BW1 A;  2RQR A;  1X75 C;  1D3B A;  5L8R E;  5AYF A;  3OYG A;  1BU1 A;  2OTL T;  1NBE B;  1ZA1 B;  3ZL7 C;  2XMF A;  3M58 A;  1NLP C;  4I8O A;  3MEW A;  1XNI A;  4LD6 A;  1KC8 U;  3QHS A;  3H1Z A;  2YLB A;  4A54 A;  7AT1 B;  2ROL A;  2JMC A;  3RKY A;  4OB2 B;  2D0B A;  4M77 E;  1FMV A;  3OST A;  3CCL A;  1NJI R;  2KRM A;  4MZP A;  3CCM Q;  1K0S A;  4B9X A;  3TQ7 P;  3M9Q A;  2A08 A;  2KEA A;  2NUT B;  1ZSZ C;  3JCM e;  2DBK A;  3M59 A;  1QCF A;  3X26 B;  4MDW A;  2DIL A;  5M9O A;  4PFO A;  4M78 D;  2LJ0 A;  1TOV A;  2AZV A;  3VS0 A;  4AFZ C;  1K73 U;  5LJ5 f;  2L0A A;  2RK2 A;  4DBH A;  4NL3 A;  3I56 T;  1IO6 A;  4QG5 A;  1QN7 A;  3A1P A;  1IGQ A;  1FMK A;  3GIB A;  1BCO A;  3I5S A;  5DM7 R;  1VOK A;  1UEC A;  1VQ9 Q;  2DJQ A;  1PCX A;  1ZUY A;  2C0O A;  4HVW A;  1N3A A;  5IYC P;  1V29 B;  4EMG A;  2VXF A;  2QA4 A;  3G4S A;  3T4N A;  5IT9 E;  3I35 A;  2O31 A;  3GNF B;  2DXT A;  5IXB A;  2HQX A;  2A7Y A;  2Y8L A;  4AT1 B;  4LDV A;  3I3W A;  3MJX A;  3TDH A;  2EJF A;  1YQM A;  2LX9 A;  2P0Q A;  2V9J A;  1EIF A;  3CMA A;  1YIJ Q;  2FKF A;  1RAA B;  1A0N B;  4M78 A;  1YJN A;  3J7A F;  3HP9 A;  4DBF A;  1WLP B;  1N5Z A;  3DLM A;  1W80 A;  2L3P A;  4AG1 C;  1XJW B;  1QNE A;  1VQ7 A;  3OYB A;  4XK8 E;  1EZZ B;  5FU7 B;  3OW2 A;  1P5D X;  3OY9 A;  4MMK A;  1SSH A;  3MO8 A;  4M7A G;  1NYF A;  2VKN A;  2RM4 A;  3JCM d;  1KY6 A;  4OVA A;  1H92 A;  1SHF A;  4C7P A;  2YRD A;  4E7Z A;  4BAC A;  4BDY A;  3CCS T;  2K9G A;  4OML A;  5KE2 A;  1CKA A;  3PVQ A;  1Y0M A;  3NPF A;  1Y71 A;  2J6O A;  4LNP A;  1TU0 B;  1YCS B;  2LQK A;  4M75 E;  1YHQ Q;  3CCR Q;  2AZS A;  2YLC A;  2EYY A;  4MRQ A;  3U23 A;  2BE7 D;  3ULX A;  1W2B S;  2EGE A;  4FYW B;  1SF9 A;  3SHW A;  2YUN A;  5GAO q;  3JB9 J;  4RTV A;  5EC7 A;  4PLL A;  4J9G A;  4PNO A;  4P5N A;  3CCE T;  4UC4 A;  3LW5 E;  2MJ7 A;  1YIT T;  1VQN Q;  2PVG B;  4Y92 A;  2HKQ B;  1AT1 B;  1QN9 A;  3RMQ A;  1KD1 R;  4OB1 B;  3CXC S;  4LDY A;  3D7Q A;  1OU8 A;  2JVV A;  3DB3 A;  4J9F A;  3A5Z B;  2V8Q A;  2LRQ A;  1Y96 B;  4QT7 A;  5IN1 A;  3PVL A;  3OYJ A;  4ROD B;  6AT1 B;  4IUR A;  3MP6 A;  4C92 D;  1D1C A;  4A4H A;  1M90 R;  2HBP A;  1UT4 A;  4J6Y A;  2CDT A;  1AWW A;  4LUD A;  2C0I A;  4PJO F;  1JJ2 P;  5C0M A;  2DKG A;  2EYZ A;  1RAF B;  2YRC A;  1VQ6 Q;  5KYY A;  2GBQ A;  3CCU T;  4R56 A;  1K9M C;  1UT7 A;  3EFR A;  3FB9 A;  2MF2 A;  2QDL A;  2XG8 D;  1OV3 A;  1VOM A;  3M5A A;  1M27 C;  2EYW A;  2E1H A;  4HCC A;  2LT4 A;  5HK3 A;  3A8H B;  4E7J A;  4IL8 A;  2PNI A;  5FLX E;  2O3O A;  2WSC E;  2M9U A;  2DE0 X;  2C0T A;  2J6K A;  2P4R A;  1I8F A;  1VQO A;  1GCQ A;  2HBW A;  2XID A;  3L2Z A;  3UDC A;  2HQH A;  2XI9 A;  2DRM A;  3UF4 A;  2OOY A;  1JU5 C;  4QQG A;  1WX6 A;  2JM9 A;  4HT9 A;  2KMT A;  2LCS A;  2JHJ A;  5IHI A;  4FU6 A;  5IHN A;  1K35 A;  4C92 A;  3QJ6 A;  1KQ2 A;  5GAM e;  2G30 A;  2Z8U A;  4ZNX A;  4GY5 A;  4EPC A;  3RKW A;  1FX7 A;  3CW7 A;  1RAH B;  3FEO A;  4M78 E;  4X9D A;  3O8V A;  1Y57 A;  5CKB A;  1YQR A;  4C8Q F;  2EWN A;  1TXQ A;  1PCJ X;  2QR1 A;  3G71 A;  1QKW A;  1D3B B;  3QZ9 B;  1H8K A;  4BI8 B;  3DLL A;  2JM8 A;  3AHU A;  1NJI U;  4D8K A;  2OOX A;  2V8K A;  5I2M A;  1VYT A;  2X3X D;  2Z0F A;  1WYX A;  3S3N A;  3L2U A;  2DTH A;  2ZZD A;  2FZC B;  2K4Y A;  1EX4 A;  5LJ3 e;  1SKU B;  2JUF A;  4FSS A;  2ABL A;  2VJ0 A;  4M77 F;  1OU9 A;  2EGC A;  2OTJ A;  3HRT A;  1S72 A;  3I0W A;  2CP3 A;  4HVV A;  2DK3 A;  5GAN 4;  1VQ4 A;  2V26 A;  2D0A A;  3RES A;  3VS2 A;  4RG8 A;  3MPU B;  3CCM T;  2X35 A;  4EJY A;  1VQP A;  4HT8 A;  4NOY A;  1M3B A;  4A4G A;  2I5W A;  2FYK A;  1RAB B;  3KRM A;  2XK0 A;  1B7T A;  3I0X A;  5FU7 C;  2QEX Q;  1YNZ A;  2E41 A;  4N4I A;  4R55 A;  3CCV A;  3LGF A;  3M56 A;  4JLI A;  1AZG B;  1Y07 A;  2DVJ A;  1B3Q A;  1XSZ A;  1B34 A;  5BMP A;  2E65 A;  1QVG P;  3CC4 Q;  2VC8 A;  1YI2 Q;  1X43 A;  1M4Z A;  2KYM A;  1Q7Y C;  2X4Y A;  4KUI A;  1C9B B;  2RQV A;  1Q95 G;  3HHT B;  2LZ6 B;  3UA6 A;  3JV3 A;  4A53 A;  3OH9 A;  1WHH A;  2SRC A;  3JRZ A;  1ACM B;  5CQY A;  5GAN e;  4LDW A;  5GAO m;  2LCL A;  2IPO B;  4JPB W;  5FWB A;  2MI6 A;  4LXC A;  1N3C A;  4J83 A;  2EAY A;  5HCK A;  2DM1 A;  1WJS A;  1ZQ1 A;  3C95 A;  2H8H A;  5F9C A;  1IZ6 A;  1YJ9 Q;  2E3H A;  4D6W A;  2H3E B;  2NOF A;  2AKL A;  1OZ3 A;  2PQW A;  3CCQ A;  2JN0 A;  3MKD A;  2FPE A;  1YIJ T;  2NUT A;  1PD0 A;  5CO7 A;  2IIM A;  3QG1 A;  2DEU A;  1I5O B;  1GBR A;  2CYZ B;  2CT4 A;  1TUG B;  4WX8 A;  1U8R A;  4PJO G;  3EFO A;  3DPT A;  2D0N A;  4C92 E;  5I22 A;  1I07 A;  1MV3 A;  4D7Q A;  1OX9 A;  2KRS A;  3EH1 A;  3V8K A;  1KFI A;  1PKS A;  4M75 F;  4X34 A;  1PM3 A;  5ECA A;  4PFZ A;  1X2Q A;  2E6N A;  1QQJ A;  2LQ8 A;  1K76 A;  1MGQ A;  2F2W A;  4XQ3 A;  1PNJ A;  1KFQ A;  3F0Z A;  1BIB A;  3QYH B;  4JS4 A;  2OAU A;  1GCP A;  4BI4 A;  1M90 U;  1WXU A;  2NLV A;  3OQ5 A;  2FO0 A;  1G5V A;  5KL0 A;  3BDL A;  3VS3 A;  3CEY A;  4IUT A;  1VQN T;  2L89 A;  3CME A;  2KYB A;  2KNB B;  5DLQ E;  1ZLM A;  2KT8 A;  2ZGW A;  4C8Q G;  1TWB A;  1LVK A;  1Z9Q A;  2YDL A;  1N9S A;  1K4U S;  1GFC A;  1HJD A;  2MIO A;  2D9T A;  4OGC A;  3J80 E;  5GMK m;  5GAN 8;  1OPL A;  2KSS A;  2CP2 A;  4E7I A;  1KSW A;  3SWN B;  1LWW A;  3RKX A;  1VQ6 T;  1QN8 A;  3O5Z A;  4TPS A;  2VB6 A;  4M77 G;  3NTH A;  2FZG B;  4C0Z A;  1H3Z A;  2E12 A;  2DXU A;  4FW2 A;  5FRO A;  5GAO p;  3G6E A;  1Q81 U;  2NOB A;  2KI7 A;  2R57 A;  1WIE A;  3HRS A;  2QTX A;  2YT6 A;  1WZO A;  3CPW P;  3OS5 A;  4N4G A;  1M3Q A;  3OYN A;  4JRP A;  3VN5 A;  3QJY A;  2F1L A;  1M3A A;  4OB0 B;  3M0R A;  2DL8 A;  4C0D B;  2HZM A;  2HSP A;  3E19 A;  2JTE A;  2EKO A;  4M7D B;  3ENO C;  3UWN A;  3CD6 Q;  4DEX A;  3H0I A;  1QKX A;  4EDU A;  3QDF A;  1M1K R;  2AK5 A;  3CXC P;  2LX7 A;  1Y96 A;  2Y8Q A;  2JZ2 A;  4M78 F;  2EQJ A;  1UGV A;  4HJH A;  4JUV A;  4A63 B;  2YRV A;  2X3W D;  2F5T X;  3M0U A;  3FJP A;  5EG2 A;  3CCS A;  2BE9 B;  1VYU A;  3KTU A;  1H64 1;  3FC3 A;  4Y91 A;  3JCM h;  3PE0 A;  2FKM X;  1SHG A;  2E64 A;  1X27 A;  3RR6 A;  4E2F B;  5JN5 A;  3FRN A;  4CFF A;  2NVM A;  5GJV B;  3VS5 A;  1YTB A;  3RSM A;  3G1J A;  2O9S A;  3N5B B;  1YWP A;  1WQA A;  2BZX A;  3BFM A;  1AOJ A;  3C0C A;  3JCM J;  3GPL A;  1VIF A;  1Q82 C;  3CC7 A;  2EQU A;  2CUD A;  5GAM j;  1TBP A;  1IHW A;  3DKM A;  3MEV A;  3CCL Q;  2RI3 A;  5IH2 A;  5EPC A;  2H4L X;  3LX7 A;  3PT9 A;  1V5S A;  3RPJ A;  3PNW C;  3EAE A;  4F7U B;  2NYS A;  2V8J A;  2ZPB B;  4RTZ A;  2PTK A;  2QEX T;  1MV0 B;  2E6Z A;  4N0A C;  4MDX A;  3M57 A;  5CQX A;  5J3B A;  2HNI A;  3EH2 A;  3EHQ A;  4GLM A;  3NMZ C;  1WNL A;  4M75 G;  1M9S A;  3OSS C;  1QVG A;  3CBP A;  5CK9 A;  3CC4 T;  3J81 E;  3M0S A;  4LE9 A;  5LJ3 j;  1YJW A;  2DD5 A;  1T3L A;  3OYA A;  1PKT A;  3FLG A;  1RAI B;  1YI2 T;  1YQL A;  1U06 A;  4KGX B;  4AFQ C;  3PMT A;  2FVU A;  1C4G A;  3WVD B;  1VKL A;  2O01 E;  3R6N A;  2QA4 Q;  3QWX X;  3LWH A;  3A8O B;  5I2S A;  3RER A;  3E9F A;  2NOL A;  2ZPE B;  2FL7 A;  2EYQ A;  4Y28 E;  1M1F A;  1YJ9 T;  5CKE A;  2RF0 A;  1Q86 C;  3CC2 A;  4RKU E;  3JCM f;  3I55 T;  1VQK T;  2BUD A;  3VRZ A;  2DD4 A;  4RMO A;  3EFO B;  3C12 A;  1UGS B;  2RPN A;  3T9N A;  1P92 A;  4CC2 A;  2LMJ A;  4Z88 A;  4FCY A;  5D7U A;  9ATC B;  4C92 F;  1N8R C;  3HRU A;  4X9C A;  4PJN A;  4C5I A;  1VQ7 Q;  3VUB A;  4JZ3 A;  2D6F A;  4BE2 A;  2RHX A;  1FWZ A;  5GAN j;  3UT1 A;  1JBM A;  2XIC A;  3S3M A;  1IRE B;  3ME9 A;  4MML A;  4FYX B;  3RIR A;  5GMK j;  1MPG A;  1GCQ C;  1UGP B;  5KYN A;  1VQ5 T;  1KO9 A;  4PLI A;  2EQM A;  3OYI A;  3THK A;  1EBM A;  2R5A A;  2KRN A;  2FRY A;  1GFD A;  3EAY A;  2J6F A;  1EUV A;  4C0D C;  3SFM A;  2YXY A;  2DL7 A;  4C92 C;  5KYX B;  4QQD A;  2LJ3 A;  4DBR A;  1QCN A;  3QPH A;  1NH2 A;  1K8A U;  4EAG A;  3VS1 A;  1CDW A;  3V7R A;  1TUD A;  1UHC A;  1NPP A;  5I11 A;  4M78 G;  2K6D A;  4E7S A;  1WFW A;  3OC3 C;  2WSE E;  3N89 A;  4BE0 A;  4XTX A;  4RCB A;  4JS5 A;  2DL5 A;  1QVF A;  1BCM A;  3ULR B;  1TSF A;  2KY9 A;  1VQ8 T;  3LWI A;  1WHJ A;  4XU0 A;  3VU3 C;  4CC4 B;  3OW2 S;  4EJZ A;  3HKS A;  1KC8 C;  4N0A A;  1VQ9 A;  2YHT A;  4J9I A;  3DPU A;  4J9D A;  1VTL E;  2PUO B;  3M0T A;  3REA B;  2HMA A;  1YCY A;  4OGE A;  2ZAE A;  2QRE A;  3ZEH A;  3MCA B;  4WTO B;  2NUZ A;  1M1K U;  5GAO r;  1WHM A;  5GAM h;  3DB4 A;  5LJ5 g;  3VRY A;  3EHR A;  3CPW A;  1B07 A;  2MPX C;  2EKH A;  3FIF A;  4PJM A;  2XHI A;  3GOX A;  1LCK A;  3I5R A;  4XTY A;  2LQN A;  1K73 C;  2K3B A;  1JXO A;  3EG9 B;  1T0J A;  2QQR A;  2LVM A;  4J7I A;  5D6W A;  1VQO Q;  2HL9 A;  3LH5 A;  1K0X A;  5J39 A;  1WJQ A;  1WXB A;  3CD6 T;  4CI0 C;  2D1X A;  3EG3 A;  4KT0 E;  2FB7 A;  4LD9 K;  2XU8 A;  3CBO A;  2DER A;  1W6X A;  4M7D D;  1FMW A;  1BI3 A;  2HD0 A;  3JCM X;  2X51 A;  2QQ9 A;  1G3W A;  3S3O A;  2FPD A;  2DKC A;  5LJ3 h;  2X4J A;  3JCM c;  1UJY A;  4AMC A;  1I4K 1;  1TS9 A;  1EFN A;  2ED0 A;  2BIV A;  2XDD A;  3LYI A;  3VS7 A;  4LDU A;  4EAI A;  1M1G A;  3SWN A;  2RK1 A;  1WQ7 A;  1R0B G;  1BI2 A;  5L23 A;  3HL8 A;  1XTD A;  1VQM A;  4HCZ A;  1VQL T;  1YHQ A;  3CCR A;  1W4S A;  3PTA A;  4L5G A;  2E5Q A;  3QKJ A;  2YUO A;  4IKF A;  2QTV A;  1OUL A;  1O9S A;  2ZPG B;  4B9W A;  2VUB A;  1OX8 A;  5GAN 3;  3OB9 A;  3PMG A;  1QN3 A;  1FXX A;  2ZPF B;  3OS1 A;  2DO3 A;  4C0G A;  3VS6 A;  2OTJ Q;  1S72 Q;  4J9B A;  3TE5 A;  2K3X A;  4ME7 A;  5IYB P;  1VQ4 Q;  1WDX A;  1YN8 A;  4M7D A;  3NHN A;  3CCL T;  1PHT A;  2PWW A;  4C92 G;  1VQP Q;  2DTI A;  3GF5 A;  1NLO C;  3NTK A;  5GAM f;  2AIR B;  4IIM A;  1AD5 A;  5GAN h;  1PZD A;  2M0Y A;  4DBQ A;  4K11 A;  3OYD A;  3M54 A;  1KQS A;  3CCV Q;  4RTT A;  4FM4 B;  2RA2 A;  4C5H A;  2FZK B;  2YWW A;  2K79 A;  4EMK B;  2CSQ A;  2IV9 A;  3TRE A;  1WPY A;  3WXM B;  1KY7 A;  3CCJ A;  1J3M A;  1X6B A;  1RAG B;  2RN8 A;  1QVP A;  1YQK A;  4JJC A;  3Q1J A;  1IB8 A;  4E7H A;  2SEM A;  3V7C A;  5LJ3 f;  3OS0 A;  5CR2 A;  1UL7 A;  1QLY A;  3M4G A;  2RHI A;  1X69 A;  3SD4 A;  2EIF A;  1DIZ A;  1M3C A;  2QA4 T;  3G4S T;  2K3Y A;  4KGZ B;  3EIK A;  2LQW A;  3FJ5 A;  1PVS A;  1U5S A;  2QXF A;  4BJU A;  4RTU A;  4ROE B;  2FGT A;  1G8X A;  4IUQ A;  3ER0 A;  2DEQ A;  2QAS A;  4WXA A;  1VOL B;  1M8M A;  2BKD N;  2YUQ A;  2DJZ A;  1OEB A;  2XHC A;  3SDZ A;  1ABO A;  1HK9 A;  3CCQ Q;  4F7U A;  3CMA T;  1PCZ A;  2GCX A;  2J06 A;  2JT4 A;  1GXI E;  4D7R A;  1QN4 A;  4WCI A;  2M02 A;  3LH0 A;  3JCM Q;  2H3J A;  1QN5 A;  1G3T A;  3TSZ A;  1WI7 A;  3FDR A;  1NYG A;  2MCN A;  2C06 A;  5GAM d;  1VQ7 T;  1NEB A;  5CKH A;  4C5E A;  1PRL C;  1WGS A;  5BMN A;  4JRI A;  4RUG A;  4ZGJ B;  1SG5 A;  1QNB A;  2A37 A;  2EBP A;  2DIQ A;  3MHX A;  5GAN f;  2DFU A;  3EG2 A;  5GMK e;  1QMC A;  2HL3 A;  3V8L A;  5A0L A;  2O9V A;  2D8H A;  1AWX A;  4ZGD B;  2NUP B;  4JJD A;  3L2W A;  2KDS A;  1QCO A;  5LJ3 d;  3I55 Q;  1VQK Q;  1GRI A;  4R0K A;  1D0X A;  2KQW A;  5A0D A;  1SPK A;  1HYO A;  2DBM A;  1JDY A;  1QTS A;  1UTI A;  4WF2 A;  4Q11 A;  1E6G A;  2JXB A;  1PSF A;  1OYX A;  2KR3 A;  1NJI C;  2ECZ A;  2MMP A;  4MZM A;  3CME Q;  2K5L A;  2R58 A;  2RQU A;  4OMQ A;  4DUL A;  2NOI A;  2D8J A;  3L1A A;  3L42 A;  4J7F A;  4M7D E;  3OSM A;  4M7A B;  2BZ8 A;  2GFA A;  1UUE A;  2QQS A;  3X24 B;  3QZ5 B;  4ORZ A;  5HKC A;  3EGD B;  3QBY A;  2OTL A;  4IIO A;  1QWF A;  1RAC B;  1VQ5 Q;  1KYU A;  2PVD B;  2QG9 B;  2DYB A;  1KD1 U;  5GAN 2;  3ASM A;  3RNJ A;  3L2R A;  1WXT A;  3OYC A;  5HSH A;  1AHJ B;  2HZY A;  1J3T A;  2P0P A;  1G83 A;  1FN7 A;  2LJ1 A;  2EJ9 A;  2V8I A;  4KH1 B;  4TVR A;  1I81 A;  5FRN A;  5JMV D;  1RL2 A;  3GNG A;  1K73 R;  5KYX A;  5GMK i;  4YTL A;  1KYD A;  3HTR A;  5GAN d;  1V76 A;  2F2V A;  1TGH A;  4FT4 A;  1JQQ A;  1MHN A;  4E6R A;  4KUD K;  4BDZ A;  2DL4 A;  3MET A;  1VQO T;  3C04 A;  4PJJ A;  2YSQ A;  2HCK A;  3M0Q A;  1FYN A;  1VQ8 Q;  2LC4 A;  3I56 A;  1BIA A;  1AWJ A;  4JDS A;  3OYL A;  1K9M R;  3M0P A;  2JOY A;  1ZSZ B;  1JJ2 A;  1UFF A;  4B0A A;  1WQW A;  4F7U E;  4XTZ A;  2O4X B;  2JS2 A;  4CRI A;  2GQI A;  1KFZ A;  3G71 T;  1X2K A;  2QRC A;  3QO3 A;  5IAY A;  1UJ0 A;  1W2B P;  4GBQ A;  2YH5 A;  4X1V A;  4EIK A;  3OS2 A;  1VIE A;  1C47 A;  3UW2 A;  1R8O B;  2PU9 B;  4ROC B;  1YFN A;  4FYY B;  1U1T A;  3A8G B;  1E42 A;  3H9N A;  2RJF A;  1MMA A;  2VGN A;  3TU4 K;  1PD1 A;  3R6O A;  3EG9 A;  2OTJ T;  1S72 T;  2Y4X A;  3X28 B;  1V1C A;  1VQ4 T;  4DOW A;  3OYH A;  2JNG A;  2F69 A;  1KQ1 A;  2HKN A;  3CC7 Q;  5KYW B;  3HS9 A;  1QW1 A;  3VV0 A;  5CKD A;  4HCK A;  4LUE A;  1VQP T;  1YP5 A;  2QGG A;  1ZA2 B;  2DF6 A;  3CWU A;  4B6M A;  1ZSG A;  3CCV T;  1BB9 A;  2NWM A;  1VQL Q;  3LLR A;  2EW3 A;  1UB4 A;  2COW A;  1IXD A;  4OMO A;  3EG1 A;  2COZ A;  1M90 C;  1SRM A;  5CVI A;  1KHC A;  2DPP B;  2L3Q A;  1G3Y A;  3PFS A;  2CGH A;  1YJW Q;  3VYG A;  2V1R A;  2OAW A;  4F16 A;  1NM7 A;  2PUK B;  3CCE A;  1NVP A;  1WHK A;  2L2P A;  4BE1 A;  4PFP A;  1YIT A;  2K5F A;  3HSB A;  2XKO C;  1QP3 A;  1AEY A;  4OF1 A;  5AN4 A;  1QTP A;  2OI3 A;  2AKK A;  1C1A A;  2M51 A;  3P8B B;  5D6X A;  4Z89 A;  2KK4 A;  4C5G A;  2NOZ A;  1SRL A;  4XU2 A;  4N4H A;  2DL3 A;  3CC2 Q;  4M7A C;  3CCQ T;  2EYX A;  1E6H A;  1G3S A;  3VS4 A;  1KHI A;  3GP8 A;  2RHZ A;  1XOV A;  1BKB A;  3JB9 H;  1TH7 A;  1Q81 C;  3OYE A;  3CCU A;  4QVD A;  1JB0 E;  3F10 A;  5DLO A;  1Q7Y R;  1QVG S;  1K9A A;  1ZBJ A;  4EMK A;  3PIO A;  1YBY A;  1WJR A;  1N9R A;  2FRW A;  4J6X A;  3BY7 A;  4RG2 A;  3PIP A;  4JZ4 A;  2RO0 A;  1QN6 A;  2PVO B;  1ARK A;  1VUB A;  4XU1 A;  3UA7 A;  3G4S Q;  2I0N A;  1AZE A;  2WSF E;  4ANJ A;  2ENM A;  3E1S A;  3C4S A;  2GQV A;  3JCM V;  2DA9 A;  5GAO l;  4IUP A;  3REB B;  2JOI A;  1PSE A;  1R77 A;  4J5Y A;  4J9E A;  4HKE A;  3KXT A;  3CMA Q;  2VV5 A;  2Y90 A;  3JCM W;  2B8A A;  2RNA A;  2R5X A;  3OSE A;  4PL6 A;  1YJN Q;  1RLP C;  1RM1 A;  1D1B A;  5CKF A;  2ZFD B;  2DVE A;  1RAD B;  2CS7 A;  2E5K A;  3SWN C;  2G3R A;  2JTF A;  3CME T;  2F7L A;  4PJO B;  4M7D F;  2A3L A;  2DXC A;  5LJ5 e;  2X9H A;  4PK4 A;  5C6S A;  2CRE A;  2LNV A;  1RI9 A;  2WAC A;  1BBZ A;  2VAS A;  2DZ9 A;  2RD1 A;  4F14 A;  3VYH B;  4M7A D;  1SEM A;  2EVR A;  2BZY A;  2LP5 A;  1MMG A;  1KYF A;  4FYV B;  2O88 A;  3MP1 A;  3AT1 B;  4QVC A;  3CWS A;  3HFO A;  4WZS D;  2DNU A;  3QII A;  2PZ1 A;  1UGQ B;  3WVE B;  1M8V A;  4M7D C;  4RTX A;  2CP6 A;  3CCM A;  2DET A;  1MMD A;  1NZ9 A;  3G6E T;  3E9G A;  4Z8A A;  1K9M U;  2BTT A;  2NUP A;  3CVT A;  2CUB A;  2ROT A;  2VVK A;  4FW1 A;  1M30 A;  2HZS A;  4J9C A;  1M2O A;  2O2O A;  3RDV A;  2EQK A;  3D7S B;  1LPL A;  4PY5 A;  4NS5 A;  2ED1 A;  2RHU A;  3GBQ A;  4C8Q B;  4E7L A;  5KCO A;  2ZCF B;  2RQT A;  2MYS A;  4BD3 A;  1N27 A;  4XTV A;  1KIK A;  1QVF S;  3JCM P;  1UDL A;  4BB7 A;  4F7U F;  4M7A A;  3CBM A;  1XQH A;  1KK7 A;  5GMK l;  2QDY B;  2ESW A;  2LCC A;  3EGD A;  4JJN K;  1MNE A;  1ZHI A;  5FRM A;  3OA6 A;  1NG2 A;  1OZ2 A;  2J7I A;  3JCM g;  4M77 B;  5D6Y A;  5KH6 A;  3V8J A;  3JAM E;  3ENC A;  2J05 A;  1OPK A;  2CH4 W;  4FT2 A;  5LJ5 d;  2EQI A;  2P0K A;  1VQM Q;  1W2B A;  2AHJ B;  1TTH B;  4ZTJ A;  3EGX B;  1AWO A;  2QYZ A;  2K7A A;  5FW9 A;  5IYD P;  1UEB A;  1UHF A;  3HPW A;  3H6Z A;  2CZ7 B;  1LWY A;  2DRK A;  1C6V X;  5GAN 5;  3CPW S;  3OLP A;  3BE3 A;  1YIJ A;  1N39 A;  4BY6 B;  4MZT A;  2F5K A;  4E7K A;  5I21 A;  1QNC A;  4FSX A;  2MOX A;  1M2V B;  1HXD A;  1JRI A;  2CZ6 B;  4JRQ A;  3OYY A;  4AFS C;  4ZN1 A;  3CXC A;  1C0M A;  5KYU B;  1JO8 A;  4FIB A;  3CC7 T;  2OJ2 A;  3SEM A;  2D0C A;  2RMO A;  2FEI A;  1D1A A;  2W10 A;  5KE3 A;  3UPU A;  2JTM A;  2P84 A;  2G6F X;  3KFV A;  2MK5 A;  2DKD A;  2LNH B;  2XDB A;  2VYT A;  4RCC A;  1ZSZ A;  3X25 B;  3JB9 I;  3G71 Q;  1H3H A;  1G2B A;  1BYM A;  3X20 B;  2F2X A;  2RH2 A;  2O4X A;  3OYK A;  3EG0 A;  2HQE A;  2MWP A;  1WHL A;  2MAM A;  1K8A C;  3CCJ Q;  2JHN A;  2H5A X;  4KGV B;  3EFS A;  1YJW T;  4II1 A;  4O5V A;  3RUX A;  3OSV A;  1Q82 R;  5CIU A;  1JEG A;  3TSW A;  3ASK A;  1PG5 B;  1RUW A;  4BUG A;  2K57 A;  2DMO A;  3JCM b;  1VQN A;  3L2Q A;  1U3O A;  8ATC B;  4IUV A;  1Q7Y U;  3NGP A;  4DEY A;  4OB3 B;  2CT3 A;  4EAK A;  4OP0 A;  3MEA A;  2NLU A;  2NOH A;  4PJO C;  4M7D G;  1D0Z A;  5KYW A;  2JPI A;  1JXM A;  5J26 A;  1Y7X A;  1Q81 R;  3CC2 T;  2FHD A;  2DIG A;  5GMK h;  3PGG A;  2RHY A;  2V1Q A;  2CKK A;  4M75 B;  3C94 A;  4BI3 A;  1KQS S;  1VQ6 A;  4ZTF A;  1T6A A;  1X6O A;  4J9H A;  1M1K C;  1NPR A;  2X4W A;  2QRD A;  5IHK A;  2EGA A;  2RI2 A;  4DQ2 A;  3OYM A;  2HL5 C;  2P4T A;  3D4V A;  3CVS A; 
#chains in the Genus database with same CATH homology
 5GAM j;  2P0P A;  2V8I A;  2EJ9 A;  3DKM A;  4TVR A;  3MEV A;  4A4F A;  1I81 A;  2RI3 A;  4XK8 E;  2D0Q B;  1RL2 A;  4FL6 A;  3GNG A;  3RMS A;  5FRN A;  5FU7 B;  3LX7 A;  3OW2 A;  3OY9 A;  3PT9 A;  4MMK A;  2R5M A;  3MO8 A;  4E47 A;  5GMK i;  3PNW C;  3EAE A;  4YTL A;  4F7U B;  4M7A E;  4M7A G;  2RM4 A;  3JCM d;  5GAN d;  4KUL A;  2V8J A;  2ZPB B;  4OVA A;  4FT4 A;  2QEX T;  1MHN A;  4BAC A;  4BDY A;  3CCS T;  5KE2 A;  3QUI A;  2E6Z A;  4KUD K;  4N0A C;  4MDX A;  4BDZ A;  3M4Y A;  3M57 A;  2XDP A;  1Y71 A;  3MET A;  2RJE A;  5CQX A;  5J3B A;  2HNI A;  2LQK A;  4M75 E;  1VQO T;  2RB6 A;  2L8D A;  1WNL A;  4M75 G;  1M9S A;  3OSS C;  1QVG A;  3HFN A;  2LC4 A;  2YLC A;  3I56 A;  3CBP A;  3S6W A;  5CK9 A;  3CC4 T;  3J81 E;  5CCA A;  4ZGE B;  1BIA A;  3TCJ A;  5LJ3 j;  1YJW A;  4C8Q C;  2DD5 A;  1W2B S;  3OYA A;  5GAO n;  4JDS A;  3OYL A;  5GAO q;  3FLG A;  3LGL A;  3INZ A;  1YI2 T;  3JB9 J;  2JOY A;  4QW2 A;  5GAN 7;  3PMT A;  4PLL A;  2FVU A;  4PNO A;  5KCH A;  1JJ2 A;  3WVD B;  1YJN T;  2DZC A;  4P5N A;  1WQW A;  4F7U E;  3CCE T;  4UC4 A;  4XTZ A;  5FU6 B;  4F7U G;  2O01 E;  3F70 A;  3LW5 E;  2O4X B;  3M55 A;  2PVG B;  4CRI A;  1YIT T;  4XTW A;  3LWH A;  3A8O B;  3G71 T;  3RMQ A;  5I2S A;  3RER A;  2ZPI B;  4OB1 B;  3E9F A;  4GLK A;  3CXC S;  4LDY A;  4PJO D;  2ZPE B;  2FL7 A;  2EYQ A;  2JVV A;  3DB3 A;  3QO3 A;  3A5Z B;  5IAY A;  4M77 C;  2LRQ A;  1Y96 B;  4Y28 E;  5IN1 A;  3OYJ A;  1M1F A;  1YJ9 T;  4Q5W A;  3P8D A;  4IUR A;  3MP6 A;  1VIE A;  5CKE A;  3OS2 A;  4C92 D;  1R8O B;  4ELY C;  1Q86 C;  4A4H A;  2PU9 B;  2HBP A;  3CC2 A;  4RKU E;  3JCM f;  4J6Y A;  3URG A;  3I55 T;  1VQK T;  1RI0 A;  2BUD A;  4L6V 5;  1U1T A;  5DY9 A;  3A8G B;  1VQ9 T;  2DD4 A;  4RMO A;  1DJ7 B;  2RJF A;  2VGN A;  4NL2 A;  5GAM g;  4LDX A;  4HA8 A;  2DXB A;  3C12 A;  1UGS B;  4PJO F;  5A2Q E;  3TU4 K;  5C0M A;  3SB2 A;  3R6O A;  2DKG A;  3T9N A;  4QVZ A;  3A8M B;  1P92 A;  2OTJ T;  1S72 T;  2Y4X A;  3P8H A;  3X28 B;  4R56 A;  3CCU T;  4BY6 C;  3EFR A;  2LDM A;  1K9M C;  1VQ4 T;  4DOW A;  3OYH A;  2JNG A;  4C92 F;  3FB9 A;  2F69 A;  1KQ1 A;  2MF2 A;  2XG8 D;  1N8R C;  3HRU A;  3M5A A;  1QW1 A;  4X9C A;  3VV0 A;  5CKD A;  4C5I A;  3VUB A;  2E1H A;  2L5Q A;  4HCC A;  2LT4 A;  4VUB A;  5HK3 A;  3A8H B;  4E7J A;  2D6F A;  4BE2 A;  2RHX A;  1FWZ A;  5GAN j;  1VQP T;  3UT1 A;  5FLX E;  1JBM A;  2XIC A;  1UGR B;  5LL6 S;  4M78 B;  2QEX A;  3S3M A;  1VQN T;  2WSC E;  1IRE B;  2M9U A;  3ME9 A;  4DA4 A;  4MML A;  3RIR A;  4C0F A;  5LJ5 j;  5GMK j;  4J8O A;  3CCV T;  1UGP B;  1VQ5 T;  1I8F A;  1VQO A;  3LLR A;  4PLI A;  2EQM A;  5LJ3 g;  3OYI A;  2XID A;  3L2Z A;  1BI0 A;  3UDC A;  1UB4 A;  2XI9 A;  2R5A A;  4PJO A;  3CC4 A;  4QQG A;  4C8Q D;  1M90 C;  3BDU A;  4HT9 A;  5CVI A;  4C0D C;  2KMT A;  4HCB A;  1KHC A;  2DPP B;  3SFM A;  4C92 C;  4FU6 A;  1G3Y A;  2EJG A;  3PFS A;  2CGH A;  4QQD A;  3JB9 F;  4C92 A;  3VYG A;  1YI2 A;  3QPH A;  1K8A U;  3QJ6 A;  1KQ2 A;  2DAQ A;  2PUK B;  5GAM e;  1Q82 C;  3CCE A;  4GY5 A;  4EPC A;  3RKW A;  4BE1 A;  3V7R A;  3OYB A;  1FX7 A;  3FEO A;  1YIT A;  1NPP A;  4M78 E;  4X9D A;  2K5F A;  3O8V A;  5CKB A;  4M78 G;  2EWN A;  2XKO C;  1LJO A;  4C8Q F;  3HSB A;  3G71 A;  1QP2 A;  2WSE E;  1QP3 A;  1D3B B;  3QZ9 B;  4BE0 A;  4XTX A;  2KVQ G;  4OF1 A;  4RCB A;  4BI8 B;  3DLL A;  4JS5 A;  1QVF A;  4M77 D;  3MP8 A;  1VQM T;  1M5Q 1;  1NJI U;  1YHQ T;  3AHU A;  4KBM B;  2KY9 A;  3OMG A;  3CCR T;  1YJ9 A;  4J6W A;  4XU3 A;  1VQ8 T;  2V8K A;  3LWI A;  3P8B B;  5I2M A;  5D6X A;  4ZN3 A;  2KK4 A;  4XU0 A;  3VU3 C;  4XTU A;  3OW2 S;  3S3N A;  4C5G A;  4XU2 A;  3I55 A;  1VQK A;  2IG0 A;  2DTH A;  3HKS A;  3L2U A;  1KC8 C;  2ZZD A;  4N0A A;  4N4H A;  1VQ9 A;  3CCQ T;  4M7A C;  2YHT A;  2K4Y A;  5LJ3 e;  2JUF A;  1G3S A;  1KHI A;  3GP8 A;  2RHZ A;  2RI5 A;  4M77 F;  1XOV A;  1BKB A;  2CZ0 B;  3JB9 H;  1TH7 A;  2PUO B;  2OTJ A;  3HRT A;  1S72 A;  1Q81 C;  3OYE A;  3CCU A;  4QVD A;  1JB0 E;  1N6A A;  5GAN 4;  2DK3 A;  5GAN 6;  5DLO A;  1VQ4 A;  2IVW A;  4EMK C;  4C8Q A;  1YCY A;  3QSU A;  4M75 C;  4OGE A;  3RES A;  5GAN g;  2GF7 A;  3ZEH A;  4EMK A;  3PIO A;  1YBY A;  1WJR A;  1N9R A;  4J6X A;  3MCA B;  4RG8 A;  3BY7 A;  3CCM T;  1U1S A;  2X35 A;  4RG2 A;  3PIP A;  5GAM h;  5GAO r;  3DB4 A;  1M1K U;  5LJ5 g;  1Q82 U;  3CPW A;  2RO0 A;  1VQP A;  4HT8 A;  2PVO B;  4NOY A;  4A4G A;  1VUB A;  4JLG A;  2FYK A;  3FIF A;  4XU1 A;  1VQ7 A;  2XK0 A;  3GOX A;  3VKI A;  1JJ2 S;  4DOV A;  5FU7 C;  4XTY A;  2E41 A;  4N4I A;  4R55 A;  3CCV A;  1K73 C;  3LGF A;  1VQ5 A;  2WSF E;  3M56 A;  3PMI A;  4A4K A;  2QQR A;  1LNX A;  2LVM A;  3MEU A;  4JLI A;  5HY6 A;  2KAF A;  3E1S A;  3OBW A;  2ZPH B;  1SSF A;  1Y07 A;  3C4S A;  4J7I A;  5D6W A;  3ZFJ A;  4PKC C;  1B34 A;  2DTO A;  5J39 A;  4M77 A;  1WJQ A;  2GQV A;  3CD6 T;  2E65 A;  4CI0 C;  3JCM V;  4JRK A;  2HAX A;  5GAO l;  4KT0 E;  2FB7 A;  4IUP A;  2XU8 A;  3CBO A;  3VJP A;  5A0G A;  3CCJ T;  4LD9 K;  4M7D D;  1BI3 A;  2HD0 A;  1X01 A;  3JCM X;  2QQ9 A;  1G3W A;  3S3O A;  1PSE A;  4J5Y A;  3KXT A;  2VC8 A;  2X4J A;  2RJC A;  4HKE A;  5LJ3 h;  2VV5 A;  2Y90 A;  3JCM W;  2B8A A;  3JCM c;  2VXE A;  3QYG B;  5HK0 A;  4OMF B;  4PL6 A;  5CKF A;  1I4K 1;  1M4Z A;  2E70 A;  3OMC A;  1Q7Y C;  2BIV A;  2DVE A;  2X4Y A;  4KUI A;  2CS7 A;  4Z02 A;  3HHT B;  3VUZ A;  3LYI A;  3ZBD A;  2XDD A;  3SWN C;  2G3R A;  4LDU A;  4A53 A;  1M1G A;  2JTF A;  3SWN A;  3JRZ A;  2RK1 A;  1WQ7 A;  5CQY A;  1NE8 A;  5GAN e;  1BI2 A;  3CME T;  4LDW A;  4M7D F;  4PJO B;  5GAO m;  2LCL A;  2A3L A;  5FU6 C;  2LT1 A;  2DXC A;  3OYF A;  2MI6 A;  1XTD A;  3HL8 A;  4IUU A;  1VQM A;  4HCZ A;  4J83 A;  1VQL T;  1YHQ A;  5LJ5 e;  3A8L B;  2EAY A;  2M0O A;  4C92 B;  3CCR A;  1W4S A;  2M1H A;  3PTA A;  4L5G A;  1VQ8 A;  5C6S A;  1WJS A;  1ZQ1 A;  2E5Q A;  3C95 A;  2LNV A;  2WAC A;  2XD0 A;  3QKJ A;  1IZ6 A;  4IKF A;  3JB9 D;  2DZ9 A;  4D6W A;  3OBY A;  2RD1 A;  1KD1 C;  3VYH B;  1O9S A;  3V7S A;  4M7A D;  1OZ3 A;  2LTO A;  2PQW A;  2ZPG B;  4B9W A;  3CCQ A;  4ATO A;  2JN0 A;  2VUB A;  1YIJ T;  4XAX B;  5GAN 3;  3OB9 A;  3MP1 A;  2X4X A;  1Q86 U;  1FXX A;  3JSC A;  2ZPF B;  3G7Z A;  3OS1 A;  5CO7 A;  3QG1 A;  4QVC A;  2DO3 A;  4C0G A;  3HFO A;  2CYZ B;  3QII A;  4M75 D;  1UGQ B;  2K3X A;  4ME7 A;  3WVE B;  1M8V A;  4PJO E;  1KG1 A;  2QQA A;  4M7D C;  1U8R A;  4PJO G;  5CAI A;  4M7D A;  4M7A F;  3CCM A;  3CCL T;  2E10 A;  1NZ9 A;  2Y4Y A;  3G6E T;  3E9G A;  3TEE A;  4C92 E;  1K9M U;  3H8Z A;  2VGM A;  4C92 G;  1N8R U;  2DTI A;  3GF5 A;  3NTK A;  2K5I A;  5GAM f;  3KBG A;  2EQK A;  4V2S A;  2GFU A;  2MWO A;  5GAN h;  3V8K A;  2QQB A;  3OYD A;  4M75 F;  4L59 A;  4NS5 A;  3M54 A;  4QQ6 A;  4X34 A;  1KQS A;  2K2V A;  3NFC A;  4FM4 B;  5LJ5 h;  2RA2 A;  2E6N A;  2RHU A;  2CZ1 B;  4C5H A;  4C8Q B;  4M78 C;  4E7L A;  2LQ8 A;  4EMK B;  5KCO A;  3CD6 A;  1MGQ A;  2ZCF B;  4BD3 A;  3TRE A;  1N27 A;  2RJD A;  1WPY A;  4XTV A;  3WXM B;  1QVF S;  3GLX A;  3CCJ A;  3JCM P;  4XQ3 A;  1OI1 A;  2EFI A;  3KUF A;  1LOJ A;  3NTI A;  3L2V A;  1BIB A;  1I5L A;  4BB7 A;  3QYH B;  4F7U F;  4JS4 A;  1QVP A;  2OAU A;  4M7A A;  3CBM A;  1XQH A;  4BI4 A;  1M90 U;  3Q1J A;  4E7H A;  3OQ5 A;  1BI1 A;  3V7C A;  5LJ3 f;  3OS0 A;  5CR2 A;  3JB9 G;  5GMK l;  2QDY B;  2LCC A;  1O75 A;  1G5V A;  3BDL A;  4EMH A;  4JJN K;  2QI2 A;  3M4G A;  2RHI A;  1ZHI A;  3QDR B;  3QXE B;  3CEY A;  2EIF A;  2L3R A;  3CPF A;  2L89 A;  1OZ2 A;  1B34 B;  4IUT A;  3SD4 A;  3JCM g;  3G4S T;  3CME A;  2QA4 T;  2K3Y A;  4M77 B;  4M75 A;  5D6Y A;  5KH6 A;  3V8J A;  3JAM E;  1QVG S;  4FT2 A;  5DLQ E;  5LJ5 d;  1VQL A;  4O6J A;  4C8Q E;  2M16 A;  1ZBX A;  2ZGW A;  4A4E A;  2P0K A;  1W2B A;  4C8Q G;  2AHJ B;  2QXF A;  2I2L A;  1N9S A;  4ELZ C;  4ZTJ A;  3M53 A;  3BW1 A;  4IUQ A;  3ER0 A;  1X75 C;  2DEQ A;  1UEB A;  3HPW A;  2D9T A;  1D3B A;  2CZ7 B;  3H6Z A;  4OGC A;  2BKD N;  5GMK m;  5L8R E;  3J80 E;  5AYF A;  5GAN 5;  3OYG A;  3CPW S;  2DJZ A;  2XHC A;  3SDZ A;  5GAN 8;  1HK9 A;  1YIJ A;  2KSS A;  2OTL T;  4F7U A;  3CMA T;  3M58 A;  4E7I A;  2GCX A;  4BY6 B;  4MZT A;  3SWN B;  1GXI E;  2F5K A;  4E7K A;  5I21 A;  3MEW A;  1XNI A;  4LD6 A;  1KC8 U;  3QHS A;  4FSX A;  3RKX A;  2YLB A;  4A54 A;  3LH0 A;  1HXD A;  1JRI A;  2CZ6 B;  2H3J A;  3JCM Q;  4JRQ A;  5FRM A;  1VQ6 T;  3RKY A;  1G3T A;  3OYY A;  3OA6 A;  4ZN1 A;  4OB2 B;  3CXC A;  4M77 E;  3FDR A;  4FIB A;  4M77 G;  3NTH A;  3CC7 T;  3CCL A;  2C06 A;  4C0Z A;  4MZP A;  5GAM d;  1H3Z A;  2E12 A;  2DXU A;  5FRO A;  5GAO p;  3G6E A;  5CKH A;  4B9X A;  4C5E A;  1Q81 U;  1VQ7 T;  5KE3 A;  2R57 A;  3M9Q A;  3UPU A;  2JTM A;  3HRS A;  1WGS A;  2QTX A;  4JRI A;  4ZGJ B;  3OS5 A;  4N4G A;  3JCM e;  2XDB A;  3OYN A;  4JRP A;  2VYT A;  3M59 A;  4RCC A;  3X25 B;  3JB9 I;  3X26 B;  3QJY A;  4MDW A;  5M9O A;  2DIQ A;  3MHX A;  4OB0 B;  4M78 D;  5GAN f;  1BYM A;  4C0D B;  3X20 B;  5GMK e;  2RH2 A;  3E19 A;  2O4X A;  3OYK A;  2EKO A;  4M7D B;  3UWN A;  2HQE A;  5LJ5 f;  1K73 U;  2MWP A;  2RK2 A;  3V8L A;  5A0L A;  4NL3 A;  2MAM A;  3I56 T;  4ZGD B;  1K8A C;  4EDU A;  3L2W A;  3GIB A;  2KDS A;  3EFS A;  1YJW T;  5LJ3 d;  5DM7 R;  4II1 A;  2KQW A;  4O5V A;  3RUX A;  3OSV A;  1Y96 A;  5A0D A;  2JZ2 A;  5CIU A;  4M78 F;  3ASK A;  2EQJ A;  4WF2 A;  4JUV A;  4BUG A;  2K57 A;  1V29 B;  2YRV A;  2F5T X;  4EMG A;  3JCM b;  1VQN A;  2VXF A;  2QA4 A;  3G4S A;  1PSF A;  3L2Q A;  1OYX A;  3FJP A;  5EG2 A;  5IT9 E;  1NJI C;  2MMP A;  4MZM A;  3CCS A;  3GNF B;  2DXT A;  4IUV A;  2K5L A;  2R58 A;  1Q7Y U;  2HQX A;  4OB3 B;  1H64 1;  2A7Y A;  3L1A A;  3L42 A;  4J7F A;  3FC3 A;  4M7D E;  4OP0 A;  3MEA A;  2NLU A;  4Y91 A;  4M7A B;  4PJO C;  4M7D G;  4LDV A;  2GFA A;  3JCM h;  2QQS A;  3X24 B;  5J26 A;  2EJF A;  2LX9 A;  2P0Q A;  3QZ5 B;  5HKC A;  1Y7X A;  3QBY A;  1EIF A;  2E64 A;  2OTL A;  3CC2 T;  3CMA A;  2PVD B;  2FHD A;  2DIG A;  3FRN A;  3PGG A;  5GMK h;  2RHY A;  1KD1 U;  5GAN 2;  2CKK A;  4M78 A;  4M75 B;  1YJN A;  3J7A F;  3HP9 A;  3C94 A;  4BI3 A;  1KQS S;  1VQ6 A;  3N5B B;  3L2R A;  4ZTF A;  1X6O A;  1M1K C;  1NPR A;  2X4W A;  3DLM A;  3BFM A;  3JCM J;  2RI2 A;  4DQ2 A;  3OYM A;  3OYC A;  2P4T A;  3GPL A;  1VIF A;  1AHJ B;  3CC7 A;  2EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...