1M5Q1

Crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIMYRYIVHIDSTERRIDMREFAKQAEKIFPGMVKYIEETNVVLIGDKVRVSEIGVEGVGPVAERAKRLFEEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small nuclear ribonucleoprotein homolog
publication title Structure and assembly of an augmented Sm-like archaeal protein 14-mer
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Translation
total genus 23
structure length 127
sequence length 127
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF14894 Lsm_C Lsm C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m5q101
3.30.310.60 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Like-Sm ribonucleoprotein, C-terminal domain 1m5q102
4PJOF 4XTUA 3L2ZA 4OP0A 5GAMg 4M7DB 4C8QC 2RM4A 4C92A 3JCMQ 4EMHA 5GANj 3JB9H 4EMKA 1I81A 5LJ3d 4F7UG 5LJ5f 4M7DE 4M75G 4XU1A 5GAOm 3INZA 2DXTA 4M77C 4A53A 2K57A 2RB6A 1TH7A 4J6WA 2DTOA 4XTXA 5I21A 5GAOn 4HA8A 4M78A 4NL2A 2VC8A 4M78D 3JB9G 3QSUA 1M8VA 2DKGA 4C8QG 1HXDA 4M7DA 3FJPA 4N0AC 2DVEA 4A54A 4C92F 4C92B 2ZGWA 2HNIA 1WNLA 2YLBA 2DEQA 2EJFA 4F7UA 4M75D 4M77G 1LNXA 2Y90A 4C92E 4XTZA 4HT8A 4M7AC 1I8FA 4XTVA 3VU3C 4QVCA 1KQ1A 3HFOA 1BIAA 4M78B 4RCCA 3RIRA 2DZCA 2EWNA 3JB9D 2VXFA 4JUVA 5LJ3h 1MGQA 3BDUA 4C8QA 5GAMf 4M7DF 4C8QD 4XU0A 4M78E 3JCMb 2QTXA 4PNOA 5CAIA 3JCMh 4F7UB 4M75B 3SWNC 1H641 4M77A 4M7AG 2VXEA 4M77D 5GAOq 2YLCA 2DXUA 4PJOC 4F7UE 4XU2A 3SB2A 4M75E 5LJ3e 2RA2A 1B34B 3FB9A 3QO3A 5LJ5h 3JCMd 1JBMA 4N0AA 5GMKh 1YCYA 4MMKA 2DZ9A 4C8QB 5LJ3g 1KQ2A 1JRIA 3RKWA 3JCMe 4X9DA 3JCMc 5LJ5d 5GAN5 4DQ2A 5LJ3j 5GAN8 4C8QE 3V8JA 4M75A 3JB9J 3RERA 4NL3A 4M7AA 4M77B 4X9CA 4M7AD 4PJOG 4EMGA 5GANf 3HSBA 3FIFA 5LJ5e 2E41A 1D3BA 1LOJA 2E1HA 1B34A 4M78F 5GMKe 4M77E 2FB7A 3RKYA 1I5LA 4NOYA 1M5Q1 3AHUA 4EMKC 4QVDA 1BIBA 1I4K1 4JLIA 5GAN3 3V8KA 2E64A 4XTWA 2DTHA 3BFMA 5LJ5j 4V2SA 1U1SA 1N9SA 2CGHA 4F7UF 5GMKj 4M75F 4M7AB 5GANd 4HT9A 3QUIA 5DY9A 4PJOD 2E65A 4Y91A 1D3BB 2E10A 3JCMJ 1LJOA 1U1TA 2DTIA 4JRKA 3V7CA 3V8LA 5GAMd 5GAN2 3JB9F 4M7AE 5GMKl 4C8QF 1X01A 3BW1A 3PGGA 4RCBA 5GAMe 3RUXA 2RD1A 4J5YA 4WF2A 3SWNB 1N9RA 5GAOp 2JN0A 3RESA 4M77F 3JCMg 2DJZA 4PJOB 1WQ7A 2YHTA 4M7DG 1HK9A 3JCMX 3V7SA 4XTYA 4C92D 5GAMj 2EJ9A 3JCMV 4C92C 4PJOE 5LJ5g 3L1AA 3BY7A 3EFRA 5GANh 4XQ3A 5GMKm 1Y96A 4XU3A 3RKXA 1WQWA 3GIBA 3QHSA 3SWNA 4JRIA 1WPYA 3HFNA 5GAMh 5GAN6 4M7AF 4M78C 3JCMW 4PJOA 3EFSA 4M7DD 4M7DC 4MMLA 4C92G 5GMKi 3JCMP 4EMKB 2FYKA 3V7RA 5GANe 2EAYA 5GAOl 2I2LA 5LJ3f 5GAOr 1Y96B 4M75C 5GAN4 4J6YA 4J6XA 5GANg 2EJGA 3JB9I 5GAN7 4M78G 3M4GA 3JCMf
chains in the Genus database with same CATH superfamily
2BZXA 1PWTA 2XK0A 4LXCA 1AOJA 3UF4A 4EMHA 3HS8A 5DLQE 1NYFA 1VOMA 3H9NA 1VYTA 2A08A 2QREA 1RADB 1IREB 3M59A 3OYEA 1QP3A 4BE2A 4PLLA 3QSUA 1OQKA 4GLMA 1HXDA 2RHZA 4M7DA 2HNIA 1VQ7A 1B07A 1VQLQ 1QVGP 1G3SA 1NLOC 3HRUA 1VIEA 1ZUUA 4M75D 4EAIA 4C0FA 2DYIA 3REBB 1YTBA 4ZN3A 3G6ET 4HCZA 1KY7A 1KC8U 3THKA 4C5EA 4N0AA 1MMDA 5GMKh 2DVJA 2GQIA 3MO8A 3N89A 2GQVA 1QWEA 5GAN8 1IZ6A 3LGFA 2MJ7A 2KEAA 2E41A 2E1HA 3H6ZA 5FRMA 1HJDA 4M77E 1VQMA 1MP9A 3EHQA 2R5XA 5HY6A 1VQNQ 1U06A 2BZ8A 1C47A 2RJFA 2CGHA 4JRQA 4LNPA 4CRIA 1W2BP 3KBGA 3S3NA 3EGXB 5DY9A 4Y91A 3EGDA 4BD3A 4PJNA 1VQ9A 1ZX6A 3EH1A 4OMQA 3N5BB 1OU9A 1X6BA 2DMOA 1KYFA 1BI0A 2MF2A 4LD9K 1E6HA 3EFOA 3BDLA 3OYFA 1KY6A 1R77A 3OW2S 1WXBA 1Q7YR 1B9KA 4BE1A 3HFNA 5GAN6 4Z89A 3S3MA 4M7DC 3BKQX 1KHIA 1LXTA 2DKDA 2Z8UA 1VQ5A 5GAOr 2W10A 3G6EA 3G7ZA 4J9HA 3CD6Q 2EYYA 3ER0A 2KMTA 3RPJA 2HD0A 1FWZA 3I55T 1Z9QA 5IXFA 1LWWA 1N8RU 1WYXA 4RMOA 4M78D 2ATCB 2CP7A 2P0KA 2XU8A 4N0AC 2LQNA 3AT1B 4BY6B 2V8QA 1KHCA 1M1KU 4M77G 2KK4A 4RTYA 4XTVA 2I0NA 1NGMA 1LCKA 4FIBA 3HFOA 3CWUA 3RIRA 3R6NA 3JB9D 4RODB 1QVPA 3EG9A 1ZUKA 1RLPC 3EAEA 4ROEB 5KCOA 4AG2C 2XDBA 1CKAA 5CKBA 3OYAA 3NFCA 2QA4T 3C04A 1VQ4Q 1UE9A 3URGA 2PVOB 1IXDA 3CMAT 1K9MC 3JCMd 2IVWA 1GCPA 1JXMA 1YCYA 2NUPA 4JPBW 4MMKA 3C94A 1JRIA 2NOEA 5EC7A 3I56Q 2FZKB 1JXOA 3FDRA 3JB9J 5GJVB 2EIFA 2KXDA 3CCMQ 1GL5A 1N6AA 4CC7A 3ZBDA 1QN4A 3CCVT 2ZPIB 4C5GA 1QVFA 4XAXB 1VTLE 3L2UA 4R55A 4BDZA 1DJ7B 5J3BA 4AMCA 3PIOA 1JB0E 1NYGA 1QQJA 5L23A 3PFSA 2XHIA 3QDRB 3RUXA 5FU6B 3RESA 2ZFDB 4PJOB 3NPFA 3V7SA 3M5AA 1LWYA 4XTYA 4KGZB 2EQKA 3QZ9B 5GMKm 1K0XA 1OV3A 1T6AA 5IT9E 4PFPA 5GAMh 3GOXA 2DLPA 4M7DD 3RMSA 3JCMP 2F2WA 3I5RA 1JJ2P 2DKCA 3E9GA 3M57A 2QA4A 1LVKA 2M0YA 2M02A 5GANj 1FXXA 2CKKA 3A98A 4A4GA 2DILA 3JCMQ 4EMKA 1W4SA 2YT6A 4QVZA 4F17A 3I9QA 4IUTA 2ROLA 2LT4A 1W70A 3CCVA 3TSWA 3FJPA 1N3CA 3I35A 1UGRB 1YJNT 1UB4A 2D8HA 2EJFA 2P4RA 1JDYA 2KQWA 4PLIA 4PY5A 3VYHB 4QVCA 1JFIC 4C8QD 3OBYA 3NTHA 3CPWS 3H1ZA 3VJPA 3U23A 4ESRA 1YIJA 4F7UE 4C0ZA 4FSSA 1OX8A 4N4HA 3JCMe 3ZFJA 3MEAA 4FM4B 1I07A 3EGXA 2ZPFB 5J39A 1M3CA 1PG5B 2L0AA 1S1NA 3AHUA 4K11A 3HHTB 4Q5WA 1EBMA 2EGCA 2GGRA 3KUFA 3CCRQ 1VQ6A 1GBQA 2QXFA 3MEWA 1BCMA 3NHNA 3ASKA 1OU8A 3TQ7P 4KGVB 2D0BA 4J5YA 1N9RA 4IL8A 3TDHA 4DBFA 1YJNA 2VYTA 5GAMj 1VQ7Q 2JT4A 4KGXB 1GCQC 2X4YA 3E1SA 2D0NA 1C4GA 3EG2A 2DERA 4FT4A 1XOVA 5GMKi 2MCNA 4OVAA 4FSXA 2KDSA 1BB9A 2YDLA 2LMJA 4C0DB 1IRXA 1ZUYA 1KQSS 4J6XA 3CCQT 2JOIA 2EJGA 5GAN7 1G2BA 2PUOB 5HK0A 3D7SB 4J9BA 5GAMg 5KYUA 2WSCE 1OOTA 3TU4K 1JEGA 4HVUA 3META 1TUDA 4F7UG 4E7IA 2V1RA 5GAOm 4XTXA 1ZHIA 2BE9B 3CVSA 2P0PA 3KRMA 1D0YA 4KUDK 2RQUA 4PFZA 5KYXA 1PKTA 1QLYA 5A0GA 2E70A 4D8DA 1QCNA 2VASA 1VQ9Q 1WJQA 3H0HA 3OYMA 3CBMA 3TSZA 3UPUA 2O9VA 3EAYA 1ZQ1A 2JS2A 4RG8A 2LJ1A 2GBQA 1MUZA 1TTHB 1XTDA 1K0SA 3OSTA 2YLCA 1WQAA 4E7ZA 2YH5A 3FB9A 1PHTA 4ELZC 1AISA 1RAIB 1VQOT 1Z9ZA 4Z02A 2FKMX 2GTOA 1AVZC 2YSQA 1YJ9T 4M77B 5A0LA 1EX4A 3RKYA 1I5LA 1N8RC 2O3OA 1VQ5Q 3CCET 1M30A 1NEBA 3OB9A 3CCQA 4OB1B 5GANd 3QKJA 1YITA 2CP5A 1QNAA 3CXCA 2FRWA 4LDUA 2QG9B 1M1KC 4WXAA 4EAKA 1BBZA 4CC3A 1LWVA 2SEMA 2PNIA 4UC4A 5KE3A 3PGGA 4WF2A 5FROA 2RF0A 1Q82U 4YTLA 3HRSA 3PE0A 4BY6C 3CWTA 3NMZC 1BK2A 2KYBA 1KO9A 2MIOA 2M1HA 4JRIA 1LPLA 2HDAA 5D6WA 2OTLT 4KH1B 3ENOC 4Y92A 2MAMA 1RUWA 2RJEA 3PDKA 3VRYA 1Q81U 1TOVA 2YRVA 1J3MA 3DPUA 3EG0A 1D0ZA 2JM8A 9ATCB 1VQOA 4FT2A 1QVFP 3LH0A 2DM1A 2RM4A 3MCAB 4FYVB 2DO3A 2CZ6B 3SHWA 3REAB 1YJ9A 2DXTA 3OYBA 1RABB 4HA8A 4NL2A 4J8OA 4QG5A 2DL7A 3CCEA 2D8JA 2AKKA 3KXTA 2E5QA 4E7JA 4MDXA 1SSHA 1CKBA 2J6KA 3VU3C 2LX7A 1D0XA 2RMOA 3HPWA 2K3BA 3JCMh 1H3HA 3TE5A 5CO7A 3HRTA 5CKFA 5FU6C 3C4SA 3WVEB 5CQXA 4PJOC 3VUZA 3X28B 4M75E 4MZMA 2PUKB 3CC2Q 2KXCA 5CKHA 4JJBA 1OI1A 4BUGA 2EYXA 1WHMA 3JCMc 2K79A 4D7RA 5LJ3j 1D1BA 4RTZA 4M7AD 2L3QA 2GTJA 4A4HA 1NZ9A 2KBTA 2EFIA 2FB7A 1BU1A 2QA4Q 2HKPA 3CVTA 4HT9A 2ECZA 5F9CA 4R56A 1I0CA 2E65A 1RI0A 2DIQA 3M4YA 2CDTA 2DTIA 2VUBA 5CQYA 5GMKl 2QASA 4J7FA 3QIIA 5I2MA 2V9JA 3SWNB 3A8OB 1UL7A 3M9QA 3EH2A 1TXQA 4FL6A 2NUZA 1YHQT 3G4ST 2X3XD 4N4IA 3H0IA 2H5AX 3PVLA 1RLQC 1FN7A 2KE9A 2MZ8A 3FRNA 2FPDA 4AT1B 3G71T 1QWFA 2OAWA 5CCAA 4J9FA 4KBMB 5A0DA 2P0QA 3A5ZB 3OA6A 2FUVA 4II1A 2Y4XA 4EAJA 3JB9I 2K7AA 1YIJQ 2LJ3A 1QN6A 1Q86R 1TWBA 4OP0A 1PD1A 4ORZA 2MYSA 2DIGA 2K3YA 3OSVA 5LJ5f 4M75G 2JPIA 2L2PA 3VRZA 3OYCA 4J6WA 1UJ0A 5GAOn 2DTOA 2F7LA 1UUEA 4RTVA 1TUOA 3MHXA 1Y71A 5FLXE 5I11A 5L8RE 1RAAB 3OBWA 1ZLMA 4OGEA 3CCJT 2JM9A 1NLPC 1H8KA 1B7TA 1VQ6Q 1KYUA 1YI2T 1JU5C 4M78E 4F7UB 3QXEB 4M77A 1YHQA 2F1LA 4QT7A 3G4SA 2RA2A 1GBRA 1PSFA 3CPFA 3QDFA 2KSSA 3CC4T 5GAN5 1Y7XA 3G71A 3CBOA 2DD5A 5IHIA 4ZGEB 1B34A 2E4HA 2OTJT 4WX8A 1RAHB 1BIBA 3EHRA 4JLIA 2FZCB 4C0DC 1QKWA 4JDSA 1WZOA 2BKDN 3D4VA 3PIPA 2DAQA 3M56A 2FL7A 1VQPT 2HZMA 1QVGS 4BDYA 4JRKA 1T3LA 3CCLT 2DL4A 1TS9A 5BMPA 1CSKA 5IHNA 1OYXA 1X01A 1SPKA 2WSEE 3BE3A 3H0FA 4ZN1A 2A7YA 4FW2A 1GXIE 1HU0A 2EGEA 1VYUA 3DLMA 5GAOp 3GBQA 2OAUA 5JN5A 5HSHA 1V5SA 2LNVA 2OOXA 4EDUA 2JW4A 2JUFA 1W6XA 5FU7B 2XDDA 4E6RA 4IIMA 1PD0A 1YI2A 2ESWA 2FPFA 1Q7YU 5EG2A 4E7SA 1K8AR 5GAOl 4E7HA 1P5GX 2GNCA 5JMVD 2I2LA 1NH2A 2P84A 3MJXA 4DOVA 2QLVA 4B9WA 3CMET 4M78G 4OB0B 2PTKA 4PJOF 1D1AA 4RG2A 3S6WA 2YA3A 1NE8A 1Y57A 1JQQA 1W2BS 1I81A 2RK1A 5LJ3d 4HCBA 2JTEA 4M7DE 3CEYA 3GLXA 1ZBJA 4M77C 2K57A 1G5VA 3JB9G 2OTJA 1H3ZA 3CXCP 3PTAA 2FEIA 1BYMA 5LL6S 3NA5A 4AFQC 2RHUA 2C0IA 1Q82C 1ARKA 3MP8A 3CCQQ 5D6YA 4R0KA 2K2MA 2Y90A 2DA9A 1I8FA 4IKFA 1YITQ 2NOBA 3CCLA 4BE0A 3OH9A 3OS0A 2QTXA 2M0OA 3S3OA 2ZZDA 2RH2A 1Q81C 4BI8B 1JBMA 1VA7A 2H3EB 2ROTA 4AFUC 4HXJA 2MPXC 3D7QA 1PCZA 1QCFA 3M0QA 2OI3A 5LJ5d 3RERA 4C8QE 3VYGA 1D09B 3E2UA 3L2RA 4QVDA 4QQ6A 3V8KA 3MEVA 2DTHA 1N9SA 2MWOA 3C12A 2D9TA 4LDWA 4RKUE 3SDZA 2VGMA 1U5SA 2EKHA 5GMKj 1VQKQ 2JHNA 4WZSD 1RM1A 4FCYA 4P5NA 1HYOA 1K9AA 1M2VB 3JCMJ 2RI2A 2FG0A 3WXMB 3BW1A 8ATCB 1YJ9Q 3X25B 2CSQA 2JN0A 5KYYB 1WXUA 3HKSA 4M7DG 3JCMX 3F70A 2PVDB 3E19A 4N4GA 3JCMV 1TUCA 1IHWA 1OULA 3EFRA 2XMFA 3MP6A 3I0XA 2O4XB 1WQWA 1PCXA 2CP3A 1K73R 4OMOA 3LWHA 2QGFB 3KTUA 2LP5A 3LYIA 3PMTA 1OZ2A 1MNEA 2LC4A 2KT8A 4RTUA 3OYYA 3L42A 3I55A 1P92A 1NPPA 2ZPBB 1K4US 4JZ4A 3L2ZA 2MMPA 5CIUA 1C1AA 1KSWA 3PMGA 4LN2A 2HBWA 3OSMA 1K2YX 1WHHA 3HS9A 4OMPA 1S72T 2DKGA 1AT1B 4C8QG 3ULRB 4A54A 2D0QB 4LUEA 4F7UA 5KH6A 1QKXA 1V76A 2EKOA 4C92E 3CMAA 2DZCA 2XG8D 4HVVA 2LT1A 1YQRA 4FU6A 1BKBA 2RHXA 2LCSA 4M75B 3SWNC 3DPTA 1GCQA 1MMAA 5GAOq 4PKCC 1TUGB 3OYNA 1YCSB 3FEOA 3SB2A 1JJ2S 1PRLC 2JS0A 4OMLA 3I0WA 4QQDA 1H92A 3OMCA 4X9DA 1NPRA 2H3JA 2LJ0A 1KD1R 4DQ2A 3OS1A 1WDXA 1PCJX 3F0ZA 4LD6A 1NJIU 1KK7A 5GANf 2A3LA 5LJ5e 2JTMA 2WSFE 4WTOB 4X1VA 5FW9A 4FYWB 4FYYB 2HQXA 2KRSA 5DLOA 3J80E 4RUGA 2QK0A 2RHIA 3CCST 3QUIA 2QTVA 2EQMA 3V7CA 1NJIR 3TVTA 5IH2A 4M77F 2HZSA 2DX1A 2EGAA 3EGUA 1S72A 1RACB 4EAGA 2JXBA 2DRKA 4D6WA 4IUUA 1UGPB 2HSEB 1UFFA 1K35A 2NOFA 2MI6A 2ZPGB 4E7KA 2DEUA 4C92G 1M8MA 3E9FA 3OS5A 1YJWT 2CP6A 3OMGA 2OOYA 2Y8LA 1OPLA 5FWCA 3TEEA 1YHQQ 3G4SQ 2JMAA 4PJLA 4A4FA 1M1GA 1VYVA 2NOLA 4TPSA 1ACMB 4HJHA 4JLGA 1VOLB 1VQNT 2HKQB 3C95A 3HTRA 1KC8C 2O01E 4A53A 3G71Q 2EYWA 4J9IA 4KULA 1SSFA 2DBKA 1BCOA 1X75C 2ZGWA 3QZ5B 3CCSA 2RJDA 4D7QA 3QJ6A 1KJWA 4M78B 1M2OA 1SHFA 5GAMf 2DXCA 4F04B 2XD0A 1YWPA 4CI0C 1KG1A 2QGGA 1M3QA 1UT7A 1RAFB 1PKSA 3PVQA 2AZSA 2NLVA 2XICA 1VQMQ 1M90R 2F5KA 2M16A 2Z0WA 1QN7A 5FU7C 1OPKA 2L3PA 2X51A 2DRMA 5CKDA 2FHDA 2CUBA 2KAFA 3FIFA 5HCKA 1YI2Q 1M2VA 4LDVA 2NYSA 1TG0A 3VS5A 1YJWA 2ENMA 2W0ZA 1KYDA 1BI1A 2NUTB 4EIKA 2E64A 4EJZA 2YWWA 3OGDA 4E2FB 5KYYA 3IH7A 3LWIA 4MZTA 1LJOA 4M7AE 2A28A 4MZPA 4DULA 2NOHA 4B6MA 1AEYA 2EHBD 4GLKA 2NOIA 3GNGA 2DE0X 2F2XA 2QDYB 2PVGB 3NTIA 2L3SA 1QP2A 3LW5E 2DBMA 2HEQA 3DLLA 3RMQA 3QJYA 3X20B 3G6EQ 1VQ4T 4BJUA 3OW2A 1OEBA 1UEBA 4PJOA 3CCLQ 1UT4A 2JMCA 2LCCA 2RJCA 4J9EA 3I56T 2D0CA 4DBHA 3UWNA 1Q95G 2QQBA 3H41A 3OCIA 3CCMT 3H8ZA 4XTUA 1UGQB 4M7DB 2D0AA 2MK5A 2CSIA 5CVIA 2A37A 1TGHA 2KROA 2DPPB 4DA4A 4C92F 2IV9A 2A0FB 2DEQA 2F2VA 1LNXA 1TSFA 4DOWA 2DL3A 5HK3A 2O31A 4LUDA 3R6OA 3OYKA 1MV0B 2RQTA 5CKEA 1WA7A 2BZYA 1M9SA 2L89A 1KFIA 2K5LA 4M7AG 3JAME 2RHYA 4GY5A 5LJ5h 3QO3A 1XJWB 2FO0A 4C8QB 1PM3A 4J83A 2YUQA 5D7UA 4MDWA 4M4ZA 3SNSA 4J9DA 4JZ3A 1QVFS 2FZGB 1YWOA 3CWSA 4HCKA 4CC4B 1AWXA 5KCHA 3I55Q 4JRPA 2MOXA 3MEUA 1AWOA 1U1SA 4F7UF 3CW7A 2RNAA 1KFZA 2K9GA 4OMMA 1WJRA 5C0MA 1U1TA 1X27A 5GAMd 2QEXT 2XDPA 3MKDA 1AD5A 2HQHA 2OTLA 3SD4A 2DL8A 4J7IA 2ED1A 2KI7A 3VKIA 2V26A 2KGTA 2EJ9A 2C0TA 5GJWB 2X4JA 1K9MR 4OGCA 3CMAQ 4JS4A 2X35A 2AZVA 2RI3A 3ZL7C 4FYXB 1VQ8T 4DEYA 2V8KA 4O6JA 5GANe 3UW2A 3VV0A 5LJ3f 1Y96B 4M75C 1ZBXA 5GAN4 1WLPB 1AZEA 5FWBA 4DBQA 1RAGB 2CS7A 2RI5A 3CCVQ 1PVSA 2CZ1B 2RK2A 2LQWA 4Z8AA 3JB9H 1P5DX 1GRIA 1G83A 4ZTJA 4XU1A 1QW1A 2L5QA 1O75A 4MRQA 1Q86U 5I21A 2RB6A 4M78A 2VC8A 2H4LX 2JNGA 3JRZA 4OB2B 2KY9A 1KIKA 3LX7A 1W80A 1M3BA 2HL5C 2DVEA 4C92B 3J81E 1QNBA 4ME7A 2R57A 2M51A 3TREA 2Y8QA 5IYBP 2X4WA 3RNJA 2EPDA 3QBYA 4PJJA 1MGQA 3TCJA 2QEXA 1O9SA 1WHJA 2BIVA 1D1CA 1IO6A 1VQ7T 3CC7T 5CAIA 2EYZA 1H641 2VXEA 1S72Q 2DXUA 3CPWA 4F16A 3CCUT 4L59A 4ZTFA 3UATA 1UJYA 2QI2A 2K5IA 1XNIA 3HSBA 2F5TX 1VOKA 1VQ8A 2EVRA 3QYHB 2YUOA 2I5WA 1SHGA 2C0OA 2DXBA 4JJNK 3M54A 4AFZC 3VUBA 1X2KA 2JOYA 4PJOD 1E7OA 2E10A 2ED0A 3GNFB 1K1ZA 2HBPA 3C0CA 3UA7A 5GAN2 1YJNQ 4EALA 2PWWA 3M0UA 3P8DA 2CH4W 2KT1A 2LX9A 5GAMe 1UGVA 6AT1B 3JCMg 1D3UA 1QTPA 2J7IA 1WQ7A 3GP8A 3SEMA 1VQ9T 2VVKA 2AT1B 1Y07A 5AYFA 3RKXA 4BI3A 4A63B 3CCSQ 1G3TA 1M27C 1WX6A 2DYBA 3GIBA 1BI2A 2KVQG 1MV3A 4A4EA 1YQKA 4M78C 2IPOB 2LQKA 1R0BG 3T4NA 3I5SA 3EFSA 1G3WA 2K3XA 4MMLA 3CC7A 1WI7A 2E3IA 1WIEA 4EMKB 2FYKA 1C6VX 1XSZA 3M4GA 3T9NA 4CC2A 3CCUA 1X6GA 1K8AU 1KQSA 4E7LA 2R5AA 1EZZB 1YNZA 1VQ5T 1HSQA 3EG1A 3CCJA 1QNCA 2GF7A 3ENCA 2HKNA 1YJWQ 1ZA1B 3NTKA 3VS2A 1OZ3A 5AN4A 2IV8A 4EPCA 2FGTA 4OMNA 4CFFA 2RO0A 3UT1A 4B0AA 1X2QA 2EQJA 4IUQA 1M3AA 5M9OA 2R5MA 2O2OA 4C8QA 2K5FA 1KC8R 3JCMb 4DBRA 3CC4A 2KYMA 2LZ6B 2GCXA 3OW2P 5C6SA 2OX7A 1IGQA 4D8KA 2DZ9A 2M9UA 1CDWA 3A8GB 3Q1JA 2FVUA 2DF6A 4BACA 1VQPA 4PK4A 3QWXX 4X9CA 2DL5A 1I5OB 1QCOA 3OLPA 1QTSA 1X43A 4PFOA 1M5Q1 1WJSA 2EQIA 2D1XA 3M55A 4XTWA 1PCMX 1UGSB 3BFMA 3CXCS 3CWAA 4M75F 4M7AB 4J9CA 1TBPA 2JHJA 3NGPA 2HL3A 1AWWA 1PSEA 4ZNXA 4J9GA 4BI4A 4DEXA 2GFAA 2OJ2A 2KR3A 1PZDA 3EG3A 3OSSC 1YQMA 2RD1A 2E6ZA 1SG5A 3L2QA 4QKUA 3KFVA 1HK9A 2YXYA 4KUIA 2GFUA 3ULXA 2QQAA 4L6V5 1M3HA 3A8MB 5GANh 4XQ3A 1Y96A 2VGNA 3SWNA 1MMGA 4ZGDB 1E42A 2V92A 2R58A 3VN5A 2RQRA 1C9BB 5KYUB 5CR2A 1VQOQ 2COZA 2XHCA 1B3QA 3CC2T 2HZYA 2RN8A 1FYNA 1K73U 3OY9A 1NG2A 1PRMC 1V1CA 4RTWA 4L5GA 1N8RR 1MMNA 3X24B 4IUVA 5KYXB 4C8QC 1YBYA 1FMWA 4C92A 3CCEQ 3ZEHA 2PU9B 3OYGA 4ELYC 2VV5A 3HP9A 1YTFA 3P8BB 4BB7A 1M1KR 3JSCA 2E3HA 5A2QE 2EBPA 3ASMA 3M0RA 1N3AA 1WNLA 2YLBA 2CZ7B 3CBPA 5IYCP 2LNHB 4HT8A 4XTZA 1KQ1A 2HL8A 3FLGA 4JUVA 2KNBB 1YFNA 1AZGB 4E47A 3RR6A 2BUDA 2DKAA 4M77D 2YRCA 2OTLQ 2QDLA 3A8HB 5LJ3e 2QRDA 1NBEB 1QMCA 3L2VA 3M0PA 4QW2A 3PNWC 3M0TA 2HAXA 1M1FA 2CT4A 1QN3A 2J6OA 2DETA 3RSMA 7AT1B 2C06A 1YIJT 1MPGA 1LOJA 1EUVA 4M78F 3CC2A 1ZA2B 1ZSGA 1KD1U 1Q86C 1I4K1 1OX9A 1WHKA 3OSEA 1QN8A 3CMEA 5I2SA 2V1QA 4JS5A 1D3BB 4AG1C 3GF5A 3JB9F 1SEMA 4RTTA 2CUDA 1J3TA 2XKOC 5DM7R 2NOZA 2EQUA 2LQ8A 2QR1A 1UDLA 1T3SA 4PL6A 5IYDP 4RTXA 1VQ6T 4C92C 3BY7A 2ZPEB 3VS0A 5BMNA 3QHSA 1VTOA 2NVMA 3CPWP 3JCMW 2J05A 3GPLA 2WACA 2NLUA 2QEXQ 2COWA 4JJCA 2V8IA 2V8JA 3X26B 5ECAA 1VQLT 4J6YA 5GANg 2VKNA 1U8RA 2RQVA 5IXBA 2X9HA 2COYA 2MWPA 4WCIA 4ROCB 2O9SA 1F1BB 2E5KA 4I8OA 1UG1A 2KRNA 1TH7A 5IN1A 1YN8A 1TU0B 1VQ8Q 1NM7A 1PC0A 2L3RA 2X3WD 2ZPHB 2B8AA 1R0CB 2HMAA 1R4XA 3OYJA 4F14A 1SKUB 2EW3A 1UECA 1UTIA 2CH4A 2HSPA 1KFQA 2H8HA 1BIAA 4RCCA 2VXFA 1MHNA 4M7DF 4XU0A 3O5ZA 1WHGA 2QQRA 3OC3C 1ZSZB 2A36A 4NS5A 2FPEA 2D6FA 2JZ2A 4O5VA 2PQWA 5IHKA 2CT3A 5HKCA 2F69A 3F10A 5KYNA 3OYLA 2KRMA 2LRQA 3O8VA 4LDXA 3RDVA 1K8AC 3UDCA 4M7AA 3DB4A 4EMGA 3VS7A 1M90U 2JVVA 4KRTA 5KYWB 1KQSP 3M53A 2X4XA 3CC7Q 4NOYA 4AFSC 1NEGA 2FKFA 2VB6A 4JJDA 4EMKC 2RQWA 1T0HA 5GAN3 2AIRB 1VQLA 1UHCA 1WJWA 2K2VA 1I1JA 2IG0A 2B86A 1Q7YC 3CCUQ 3MP1A 3FJ5A 3V8LA 2NWMA 4GBQA 4C8QF 5EPCA 3DKMA 3FC3A 1QVGA 3CCJQ 2LAEA 3CD6T 1YITT 2EYQA 4QQGA 2RPNA 2AK5A 1ABQA 1FMVA 3QPHA 4C92D 1X6OA 2HCKA 3L1AA 1AHJB 2AKLA 3ME9A 4LE9A 5FRNA 4IIOA 3UA6A 2YUNA 5KL0A 3PMIA 3M58A 1V29B 2LVMA 2NWVA 2EAYA 3CC4Q 1YQLA 5J26A 1VQNA 4HKEA 3LGLA 1EFNA 2O4XA 2ZCFB 3JV3A 2HQEA 4KH0B 1R8OB 4IUPA 1DIZA 2OTJQ 2DFUA 4Y28E 1VUBA 3INZA 1VQPQ 2J06A 1W1FA 3RBBB 1W2BA 1VQKT 2CREA 2SRCA 2E12A 1IHVA 1WFWA 3L2WA 1E6GA 5D6XA 1Y0MA 4ATOA 4M7AC 4TVRA 1VIFA 4ANJA 2EWNA 5LJ3h 1TBAB 3BDUA 1XQHA 2PZ1A 2G3RA 4PNOA 3LH5A 3OYHA 1SF9A 1JO8A 3CD6A 1X69A 1GFCA 3CQTA 3WVDB 3OQ5A 4XU2A 1K73C 1B34B 2QRCA 2CYZB 3I3WA 3MPUB 3PT9A 3V8JA 4M75A 3CMEQ 4NL3A 2IIMA 1D3BA 5GMKe 4LDYA 1QN5A 3OYIA 5KE2A 4X34A 1MNDA 2JTFA 2DD4A 3A1PA 1UHFA 3QWYA 1WHLA 1Q82R 2O88A 2L8DA 1VQ4A 3A8LB 1VQKA 4HCCA 3VS4A 2DJZA 3HL8A 2LTOA 2YHTA 3EGDB 2K6DA 4OMFB 3IQLA 4ZGJB 1GFDA 4FW1A 1ABOA 4PJOE 4OB3B 2ZAEA 3I56A 1EIFA 2G30A 2K4YA 1Q81R 4Q11A 1NVPA 1QN9A 1N5ZA 1SRMA 3CCMA 3OH6A 2DJQA 3G1JA 3EFOB 1K9MU 3SFMA 2G6FX 2AHJB 2CZ0B 1KD1C 2Z0FA 4C0GA 1HD3A 1M4ZA 2J6FA 1BI3A 4A4KA 2FRYA 3DB3A 1M8VA 2QQSA 1WGSA 1ZSZA 1NJIC 4KT0E 2VJ0A 2YUPA 2JJ9A 2P4TA 2QYZA 1IB8A 4IURA 2VWFA 4HVWA 1IGUA 2HL9A 1N39A 4C5HA 3OYDA 1YP5A 2CP2A 5KYWA 3CCRT 3VS1A 5AT1B 3EG9B 3VS6A 5LJ3g 4Z88A 1KQ2A 3RKWA 2DNUA 1JJ2A 1G3YA 4PJOG 2CP0A 1FX7A 3M0SA 1RAEB 3P8HA 4PJMA 1WXTA 2NUPB 2LDMA 3J7AF 1RL2A 5LJ5j 4V2SA 1QNEA 3QG1A 1SRLA 2E6NA 1VKLA 1G8XA 3QYGB 4C7PA 2XIDA 1K76A 1AWJA 1FMKA 2NUTA 4RCBA 5I22A 1A0NB 1Q9UA 2BTTA 5CK9A 2BE7D 4XK8E 1PNJA 5LJ5g 2ABLA 2DK3A 4VUBA 4XU3A 4OF1A 2YRDA 1WPYA 4M7AF 3OS2A 1U3OA 3LLRA 4EJYA 3EIKA 1VQMT 4B9XA 3V7RA 2QQ9A 1N27A 2LCLA 2Y4YA 1ZSZC 4C5IA 2QAZA 1M90C 3VS3A 1T0JA 5IAYA 1RI9A 2XI9A 8AT1B 3CCRA 1C0MA 3JCMf
chains in the Genus database with same CATH topology
4A4FA 1M1GA 1VQOA 4FT2A 4IUVA 2XK0A 3X24B 4C8QC 3LH0A 1YBYA 2RM4A 4C92A 3MCAB 4EMHA 3ZEHA 4JLGA 2DO3A 2PU9B 5DLQE 2CZ6B 3OYGA 4ELYC 1VQNT 1YJ9A 2VV5A 3C95A 2DXTA 3OYBA 1KC8C 3HP9A 1IREB 2O01E 4A53A 3M59A 3OYEA 3P8BB 4BB7A 1QP3A 4HA8A 4NL2A 4PLLA 3JSCA 4BE2A 3QSUA 5A2QE 4KULA 4J8OA 1HXDA 1SSFA 2RHZA 4M7DA 3CCEA 1X75C 2ZGWA 2HNIA 1VQ7A 1WNLA 2YLBA 2CZ7B 1G3SA 3HRUA 3KXTA 1VIEA 3CBPA 3QZ5B 4M75D 2E5QA 3CCSA 4E7JA 4MDXA 4HT8A 4XTZA 3VU3C 1KQ1A 2RJDA 3QJ6A 4M78B 3FLGA 4JUVA 5GAMf 4C0FA 2DXCA 4E47A 3HPWA 2XD0A 2BUDA 4CI0C 3JCMh 1KG1A 5CO7A 3HRTA 5CKFA 5FU6C 3C4SA 4M77D 4ZN3A 3G6ET 4HCZA 3WVEB 5CQXA 4PJOC 3VUZA 3X28B 3A8HB 1KC8U 5LJ3e 4M75E 4C5EA 4MZMA 2PUKB 2XICA 4N0AA 5GMKh 5CKHA 1OI1A 2F5KA 3L2VA 2M16A 4BUGA 3MO8A 3PNWC 4QW2A 2HAXA 3JCMc 1M1FA 5FU7C 2GQVA 5LJ3j 5GAN8 1IZ6A 3LGFA 4M7AD 2C06A 5CKDA 2FHDA 3FIFA 2KAFA 1YIJT 2E41A 4A4HA 1NZ9A 1LOJA 2E1HA 3H6ZA 5FRMA 4M78F 2EFIA 3CC2A 4M77E 2FB7A 4LDVA 1VQMA 1KD1U 1YJWA 1Q86C 1BI1A 1I4K1 5HY6A 2E64A 2RJFA 2CGHA 4JRQA 4CRIA 3KBGA 3S3NA 4HT9A 3CMEA 4R56A 5DY9A 5I2SA 2E65A 4Y91A 1RI0A 2DIQA 3LWIA 4JS5A 3M4YA 1D3BB 4MZTA 4BD3A 3GF5A 1VQ9A 1LJOA 3JB9F 2DTIA 4M7AE 3N5BB 4MZPA 2VUBA 5CQYA 5GMKl 4J7FA 3QIIA 5I2MA 2XKOC 4GLKA 5DM7R 3GNGA 2QDYB 2EQUA 3SWNB 2PVGB 3A8OB 1BI0A 2MF2A 3M9QA 2LQ8A 3NTIA 1QP2A 4LD9K 4PL6A 4FL6A 1YHQT 3LW5E 3G4ST 3BDLA 3OYFA 3DLLA 4N4IA 1VQ6T 3RMQA 4C92C 3OW2S 3BY7A 3QJYA 3X20B 2ZPEB 4BE1A 3QHSA 1VQ4T 3OW2A 3FRNA 3HFNA 5GAN6 1UEBA 3G71T 3JCMW 4PJOA 3S3MA 3GPLA 5CCAA 2WACA 2NLUA 4M7DC 4KBMB 1KHIA 2V8IA 2LCCA 2P0QA 2RJCA 3A5ZB 5A0DA 1VQ5A 3I56T 2V8JA 3OA6A 3X26B 5GAOr 4II1A 1VQLT 4J6YA 3UWNA 2Y4XA 3G7ZA 5GANg 3G6EA 3JB9I 1U8RA 2QQBA 3CCMT 3ER0A 3H8ZA 4XTUA 1UGQB 4OP0A 2KMTA 4M7DE 4M7DB 2HD0A 1FWZA 2DIGA 2K3YA 2MWPA 3I55T 3OSVA 5LJ5f 4M75G 3OYCA 1N8RU 4J6WA 4RMOA 1TH7A 5IN1A 2DTOA 5GAOn 4M78D 5CVIA 2P0KA 2XU8A 3MHXA 2DPPB 4N0AC 2L3RA 1Y71A 2ZPHB 5FLXE 2B8AA 4C92F 4DA4A 4BY6B 2DEQA 5L8RE 1KHCA 3OYJA 1M1KU 2KK4A 4M77G 3OBWA 1LNXA 4OGEA 3CCJT 4XTVA 4DOWA 4FIBA 3HFOA 5HK3A 1BIAA 4RCCA 3RIRA 3JB9D 1QVPA 2VXFA 3R6OA 3OYKA 1YI2T 1MHNA 3EAEA 4M7DF 5KCOA 5CKEA 4XU0A 4M78E 2XDBA 2QQRA 5CKBA 3OYAA 4NS5A 3NFCA 1M9SA 2L89A 4F7UB 2K5LA 2QA4T 2D6FA 3QXEB 4M77A 2JZ2A 4M7AG 3JAME 4O5VA 2PVOB 3URGA 2PQWA 1YHQA 3CMAT 2RHYA 5HKCA 2F69A 4GY5A 3G4SA 1K9MC 3JCMd 2IVWA 2RA2A 5LJ5h 3QO3A 3OYLA 2LRQA 1PSFA 1YCYA 3CPFA 3O8VA 4MMKA 4C8QB 4LDXA 4J83A 3C94A 1JRIA 4MDWA 2KSSA 3CC4T 5GAN5 3FDRA 1K8AC 3UDCA 3JB9J 4M7AA 3DB4A 2EIFA 1Y7XA 4EMGA 3G71A 1QVFS 3CBOA 2DD5A 1M90U 2JVVA 1N6AA 4ZGEB 3M53A 1B34A 2X4XA 3ZBDA 2OTJT 3CCVT 4NOYA 2ZPIB 4C5GA 1QVFA 4EMKC 5KCHA 1BIBA 4XAXB 4JRPA 4JLIA 3L2UA 4R55A 4C0DC 5GAN3 4JDSA 4BDZA 1VQLA 3MEUA 2BKDN 1U1SA 2K2VA 3PIPA 2DAQA 3M56A 4F7UF 2FL7A 2IG0A 1VQPT 1DJ7B 1Q7YC 3MP1A 1WJRA 5J3BA 5C0MA 1QVGS 1U1TA 3V8LA 4JRKA 1JB0E 3PIOA 5GAMd 3CCLT 4BDYA 4C8QF 3DKMA 2QEXT 1OYXA 1X01A 3PFSA 2WSEE 3QDRB 2XDPA 4ZN1A 2A7YA 3FC3A 1QVGA 1GXIE 3RUXA 3DLMA 5FU6B 5GAOp 3RESA 2OTLA 3SD4A 3CD6T 4J7IA 1YITT 2OAUA 4PJOB 2EYQA 3M5AA 3V7SA 4XTYA 4QQGA 3VKIA 4C92D 3QPHA 2EJ9A 2LNVA 4EDUA 1X6OA 3L1AA 1AHJB 2EQKA 3QZ9B 5GMKm 2JUFA 5FU7B 2XDDA 3ME9A 2X4JA 5FRNA 4OGCA 4JS4A 5IT9E 2X35A 2RI3A 5GAMh 3GOXA 3PMIA 3M58A 1V29B 1YI2A 1VQ8T 4M7DD 3RMSA 2V8KA 2LVMA 1Q7YU 4O6JA 3JCMP 5EG2A 5GANe 5GAOl 3E9GA 2EAYA 3M57A 2QA4A 4E7HA 3VV0A 2I2LA 5J26A 5LJ3f 1VQNA 1Y96B 3LGLA 1ZBXA 2O4XA 2ZCFB 4HKEA 4M75C 4DOVA 5GAN4 2HQEA 4B9WA 3CMET 1R8OB 4M78G 4IUPA 4OB0B 5GANj 2CS7A 4PJOF 2RI5A 4RG2A 3S6WA 1FXXA 1NE8A 2CKKA 2CZ1B 2RK2A 4A4GA 3JCMQ 3JB9H 1W2BS 4EMKA 1I81A 2RK1A 5LJ3d 4HCBA 1W4SA 4QVZA 4XU1A 1VUBA 3CEYA 3INZA 1QW1A 2L5QA 4Y28E 3GLXA 4ZTJA 1O75A 4IUTA 4M77C 1Q86U 1W2BA 2K57A 2RB6A 5I21A 1G5VA 4M78A 2LT4A 3JB9G 2VC8A 1VQKT 2OTJA 1H3ZA 2JNGA 3PTAA 3CCVA 2E12A 3JRZA 1BYMA 4OB2B 2KY9A 5LL6S 3FJPA 3LX7A 3L2WA 1UGRB 2DVEA 2RHUA 1YJNT 1UB4A 5D6XA 4C92B 3J81E 1Q82C 2EJFA 2R57A 3MP8A 4ME7A 4ATOA 5D6YA 2KQWA 4PLIA 3TREA 2Y90A 4M7AC 1I8FA 4TVRA 1VIFA 2X4WA 3VYHB 4QVCA 4IKFA 2EWNA 3CCLA 3QBYA 5LJ3h 1MGQA 3BDUA 1XQHA 3TCJA 4C8QD 1O9SA 2QEXA 3OBYA 4BE0A 2BIVA 3OS0A 2G3RA 1VQ7T 2QTXA 4PNOA 3NTHA 5CAIA 3OYHA 3CC7T 3CPWS 3VJPA 1H641 2M0OA 2VXEA 3CD6A 3S3OA 2DXUA 3WVDB 2ZZDA 3OQ5A 4XU2A 4F7UE 3CPWA 1YIJA 1B34B 2RH2A 4C0ZA 1Q81C 4BI8B 3CCUT 1K73C 1JBMA 4N4HA 4L59A 4ZTFA 2CYZB 3JCMe 2QI2A 5LJ5d 3ZFJA 3MEAA 4FM4B 3PT9A 3RERA 4C8QE 2K5IA 4M75A 3V8JA 4NL3A 2ZPFB 5J39A 1XNIA 3HSBA 2F5TX 1D3BA 1VQ8A 3VYGA 3QYHB 5GMKe 4LDYA 3L2RA 3OYIA 4QVDA 4QQ6A 5KE2A 3HHTB 3AHUA 4Q5WA 4X34A 3V8KA 2DXBA 2DTHA 3MEVA 4JJNK 3KUFA 1N9SA 2MWOA 2JTFA 2D9TA 2DD4A 3C12A 4LDWA 2VGMA 3M54A 4RKUE 3SDZA 3VUBA 5GMKj 2JOYA 4PJOD 4P5NA 3GNFB 2E10A 3JCMJ 2HBPA 5GAN2 2RI2A 1VQ6A 3P8DA 2QXFA 3MEWA 2L8DA 3ASKA 3WXMB 3BW1A 2LX9A 5GAMe 1VQ4A 4J5YA 3A8LB 1N9RA 3X25B 2JN0A 1VQKA 4HCCA 3JCMg 2DJZA 1WQ7A 3HKSA 2LTOA 2YHTA 3HL8A 4OMFB 3JCMX 3GP8A 1VQ9T 4M7DG 4ZGJB 1Y07A 3F70A 5AYFA 1YJNA 2PVDB 2VYTA 5GAMj 3E19A 4N4GA 3JCMV 4PJOE 4OB3B 3EFRA 3I56A 1EIFA 3MP6A 3RKXA 4BI3A 2O4XB 1WQWA 2X4YA 1G3TA 3GIBA 3E1SA 3LWHA 1BI2A 2K4YA 2KVQG 4A4EA 4FT4A 4M78C 3LYIA 3PMTA 1XOVA 2LQKA 3CCMA 1OZ2A 3EFSA 1G3WA 2K3XA 2LC4A 4MMLA 5GMKi 3OYYA 3CC7A 4OVAA 1K9MU 4EMKB 2FYKA 4FSXA 2KDSA 3L42A 3SFMA 3I55A 1P92A 4C0DB 1NPPA 2ZPBB 2AHJB 1KQSS 4J6XA 3CCQT 2CZ0B 2EJGA 5GAN7 5HK0A 2PUOB 1KD1C 3M4GA 3T9NA 3CCUA 1K8AU 4C0GA 3L2ZA 5GAMg 1M4ZA 4E7LA 1KQSA 2WSCE 2R5AA 2MMPA 3TU4K 5CIUA 3META 1VQ5T 4F7UG 4E7IA 5GAOm 1BI3A 4A4KA 3CCJA 4XTXA 1ZHIA 3DB3A 2P0PA 1M8VA 2GF7A 1S72T 2DKGA 2QQSA 4C8QG 4KUDK 3NTKA 1OZ3A 4A54A 1WGSA 2D0QB 5A0GA 1NJIC 4F7UA 4KT0E 5KH6A 4EPCA 2EKOA 4C92E 2E70A 3CMAA 2RO0A 2P4TA 3UT1A 1WJQA 2EQJA 4IUQA 2DZCA 5M9OA 2XG8D 2R5MA 3OYMA 3CBMA 4C8QA 3UPUA 2K5FA 1ZQ1A 2LT1A 4IURA 4RG8A 3JCMb 4FU6A 1BKBA 1XTDA 3CC4A 2RHXA 4C5HA 2GCXA 4M75B 3SWNC 5C6SA 3OYDA 5GAOq 2YLCA 4PKCC 3OYNA 3FEOA 3SB2A 3CCRT 1JJ2S 3FB9A 4ELZC 1VQOT 2DZ9A 4Z02A 5LJ3g 2M9UA 4QQDA 1KQ2A 3A8GB 3RKWA 3OMCA 1JJ2A 1G3YA 4X9DA 1NPRA 2H3JA 3Q1JA 4DQ2A 2FVUA 3OS1A 4BACA 1VQPA 4LD6A 4M77B 4X9CA 5A0LA 1YJ9T 4PJOG 1NJIU 5GANf 2A3LA 5LJ5e 1FX7A 3RKYA 1I5LA 2JTMA 2WSFE 1M5Q1 3P8HA 1WJSA 1N8RC 2LDMA 3M55A 3CCET 3J7AF 3OB9A 2HQXA 4XTWA 1RL2A 1UGSB 3BFMA 5DLOA 5LJ5j 3J80E 3CXCS 3CCQA 4V2SA 4OB1B 2RHIA 4M75F 4M7AB 5GANd 3CCST 3QUIA 3QG1A 3QKJA 2E6NA 1YITA 1PSEA 3CXCA 4LDUA 2EQMA 3QYGB 3V7CA 1M1KC 2XIDA 4BI4A 2GFAA 4UC4A 5KE3A 3PGGA 3OSSC 4RCBA 2RD1A 2E6ZA 4WF2A 5FROA 1Q82U 3L2QA 4M77F 1S72A 4YTLA 3HRSA 1HK9A 5CK9A 4KUIA 2GFUA 2QQAA 4L6V5 4D6WA 4XK8E 4IUUA 4BY6C 5LJ5g 3A8MB 2DK3A 1UGPB 4XQ3A 4VUBA 1Y96A 4XU3A 5GANh 2VGNA 2M1HA 4OF1A 3SWNA 4JRIA 4ZGDB 1WPYA 4M7AF 3OS2A 2MI6A 2R58A 5D6WA 2OTLT 2ZPGB 5CR2A 4E7KA 2XHCA 3LLRA 2MAMA 3CC2T 4C92G 1VQMT 4B9XA 2RJEA 3E9FA 3V7RA 2QQ9A 3OS5A 1YJWT 1N27A 2LCLA 2Y4YA 4C5IA 1Q81U 3OMGA 1K73U 3OY9A 1M90C 2YRVA 5IAYA 3TEEA 4L5GA 2XI9A 3CCRA 3JCMf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO F;  4XTU A;  3L2Z A;  4OP0 A;  5GAM g;  4M7D B;  4C8Q C;  2RM4 A;  4C92 A;  3JCM Q;  4EMH A;  5GAN j;  3JB9 H;  4EMK A;  1I81 A;  5LJ3 d;  4F7U G;  5LJ5 f;  4M7D E;  4M75 G;  4XU1 A;  5GAO m;  3INZ A;  2DXT A;  4M77 C;  4A53 A;  2K57 A;  2RB6 A;  1TH7 A;  4J6W A;  2DTO A;  4XTX A;  5I21 A;  5GAO n;  4HA8 A;  4M78 A;  4NL2 A;  2VC8 A;  4M78 D;  3JB9 G;  3QSU A;  1M8V A;  2DKG A;  4C8Q G;  1HXD A;  4M7D A;  3FJP A;  4N0A C;  2DVE A;  4A54 A;  4C92 F;  4C92 B;  2ZGW A;  2HNI A;  1WNL A;  2YLB A;  2DEQ A;  2EJF A;  4F7U A;  4M75 D;  4M77 G;  1LNX A;  2Y90 A;  4C92 E;  4XTZ A;  4HT8 A;  4M7A C;  1I8F A;  4XTV A;  3VU3 C;  4QVC A;  1KQ1 A;  3HFO A;  1BIA A;  4M78 B;  4RCC A;  3RIR A;  2DZC A;  2EWN A;  3JB9 D;  2VXF A;  4JUV A;  5LJ3 h;  1MGQ A;  3BDU A;  4C8Q A;  5GAM f;  4M7D F;  4C8Q D;  4XU0 A;  4M78 E;  3JCM b;  2QTX A;  4PNO A;  5CAI A;  3JCM h;  4F7U B;  4M75 B;  3SWN C;  1H64 1;  4M77 A;  4M7A G;  2VXE A;  4M77 D;  5GAO q;  2YLC A;  2DXU A;  4PJO C;  4F7U E;  4XU2 A;  3SB2 A;  4M75 E;  5LJ3 e;  2RA2 A;  1B34 B;  3FB9 A;  3QO3 A;  5LJ5 h;  3JCM d;  1JBM A;  4N0A A;  5GMK h;  1YCY A;  4MMK A;  2DZ9 A;  4C8Q B;  5LJ3 g;  1KQ2 A;  1JRI A;  3RKW A;  3JCM e;  4X9D A;  3JCM c;  5LJ5 d;  5GAN 5;  4DQ2 A;  5LJ3 j;  5GAN 8;  4C8Q E;  3V8J A;  4M75 A;  3JB9 J;  3RER A;  4NL3 A;  4M7A A;  4M77 B;  4X9C A;  4M7A D;  4PJO G;  4EMG A;  5GAN f;  3HSB A;  3FIF A;  5LJ5 e;  2E41 A;  1D3B A;  1LOJ A;  2E1H A;  1B34 A;  4M78 F;  5GMK e;  4M77 E;  2FB7 A;  3RKY A;  1I5L A;  4NOY A;  1M5Q 1;  3AHU A;  4EMK C;  4QVD A;  1BIB A;  1I4K 1;  4JLI A;  5GAN 3;  3V8K A;  2E64 A;  4XTW A;  2DTH A;  3BFM A;  5LJ5 j;  4V2S A;  1U1S A;  1N9S A;  2CGH A;  4F7U F;  5GMK j;  4M75 F;  4M7A B;  5GAN d;  4HT9 A;  3QUI A;  5DY9 A;  4PJO D;  2E65 A;  4Y91 A;  1D3B B;  2E10 A;  3JCM J;  1LJO A;  1U1T A;  2DTI A;  4JRK A;  3V7C A;  3V8L A;  5GAM d;  5GAN 2;  3JB9 F;  4M7A E;  5GMK l;  4C8Q F;  1X01 A;  3BW1 A;  3PGG A;  4RCB A;  5GAM e;  3RUX A;  2RD1 A;  4J5Y A;  4WF2 A;  3SWN B;  1N9R A;  5GAO p;  2JN0 A;  3RES A;  4M77 F;  3JCM g;  2DJZ A;  4PJO B;  1WQ7 A;  2YHT A;  4M7D G;  1HK9 A;  3JCM X;  3V7S A;  4XTY A;  4C92 D;  5GAM j;  2EJ9 A;  3JCM V;  4C92 C;  4PJO E;  5LJ5 g;  3L1A A;  3BY7 A;  3EFR A;  5GAN h;  4XQ3 A;  5GMK m;  1Y96 A;  4XU3 A;  3RKX A;  1WQW A;  3GIB A;  3QHS A;  3SWN A;  4JRI A;  1WPY A;  3HFN A;  5GAM h;  5GAN 6;  4M7A F;  4M78 C;  3JCM W;  4PJO A;  3EFS A;  4M7D D;  4M7D C;  4MML A;  4C92 G;  5GMK i;  3JCM P;  4EMK B;  2FYK A;  3V7R A;  5GAN e;  2EAY A;  5GAO l;  2I2L A;  5LJ3 f;  5GAO r;  1Y96 B;  4M75 C;  5GAN 4;  4J6Y A;  4J6X A;  5GAN g;  2EJG A;  3JB9 I;  5GAN 7;  4M78 G;  3M4G A;  3JCM f; 
#chains in the Genus database with same CATH topology
 2BZX A;  1PWT A;  2XK0 A;  4LXC A;  1AOJ A;  3UF4 A;  4EMH A;  3HS8 A;  5DLQ E;  1NYF A;  1VOM A;  3H9N A;  1VYT A;  2A08 A;  2QRE A;  1RAD B;  1IRE B;  3M59 A;  3OYE A;  1QP3 A;  4BE2 A;  4PLL A;  3QSU A;  1OQK A;  4GLM A;  1HXD A;  2RHZ A;  4M7D A;  2HNI A;  1VQ7 A;  1B07 A;  1VQL Q;  1QVG P;  1G3S A;  1NLO C;  3HRU A;  1VIE A;  1ZUU A;  4M75 D;  4EAI A;  4C0F A;  2DYI A;  3REB B;  1YTB A;  4ZN3 A;  3G6E T;  4HCZ A;  1KY7 A;  1KC8 U;  3THK A;  4C5E A;  4N0A A;  1MMD A;  5GMK h;  2DVJ A;  2GQI A;  3MO8 A;  3N89 A;  2GQV A;  1QWE A;  5GAN 8;  1IZ6 A;  3LGF A;  2MJ7 A;  2KEA A;  2E41 A;  2E1H A;  3H6Z A;  5FRM A;  1HJD A;  4M77 E;  1VQM A;  1MP9 A;  3EHQ A;  2R5X A;  5HY6 A;  1VQN Q;  1U06 A;  2BZ8 A;  1C47 A;  2RJF A;  2CGH A;  4JRQ A;  4LNP A;  4CRI A;  1W2B P;  3KBG A;  3S3N A;  3EGX B;  5DY9 A;  4Y91 A;  3EGD A;  4BD3 A;  4PJN A;  1VQ9 A;  1ZX6 A;  3EH1 A;  4OMQ A;  3N5B B;  1OU9 A;  1X6B A;  2DMO A;  1KYF A;  1BI0 A;  2MF2 A;  4LD9 K;  1E6H A;  3EFO A;  3BDL A;  3OYF A;  1KY6 A;  1R77 A;  3OW2 S;  1WXB A;  1Q7Y R;  1B9K A;  4BE1 A;  3HFN A;  5GAN 6;  4Z89 A;  3S3M A;  4M7D C;  3BKQ X;  1KHI A;  1LXT A;  2DKD A;  2Z8U A;  1VQ5 A;  5GAO r;  2W10 A;  3G6E A;  3G7Z A;  4J9H A;  3CD6 Q;  2EYY A;  3ER0 A;  2KMT A;  3RPJ A;  2HD0 A;  1FWZ A;  3I55 T;  1Z9Q A;  5IXF A;  1LWW A;  1N8R U;  1WYX A;  4RMO A;  4M78 D;  2ATC B;  2CP7 A;  2P0K A;  2XU8 A;  4N0A C;  2LQN A;  3AT1 B;  4BY6 B;  2V8Q A;  1KHC A;  1M1K U;  4M77 G;  2KK4 A;  4RTY A;  4XTV A;  2I0N A;  1NGM A;  1LCK A;  4FIB A;  3HFO A;  3CWU A;  3RIR A;  3R6N A;  3JB9 D;  4ROD B;  1QVP A;  3EG9 A;  1ZUK A;  1RLP C;  3EAE A;  4ROE B;  5KCO A;  4AG2 C;  2XDB A;  1CKA A;  5CKB A;  3OYA A;  3NFC A;  2QA4 T;  3C04 A;  1VQ4 Q;  1UE9 A;  3URG A;  2PVO B;  1IXD A;  3CMA T;  1K9M C;  3JCM d;  2IVW A;  1GCP A;  1JXM A;  1YCY A;  2NUP A;  4JPB W;  4MMK A;  3C94 A;  1JRI A;  2NOE A;  5EC7 A;  3I56 Q;  2FZK B;  1JXO A;  3FDR A;  3JB9 J;  5GJV B;  2EIF A;  2KXD A;  3CCM Q;  1GL5 A;  1N6A A;  4CC7 A;  3ZBD A;  1QN4 A;  3CCV T;  2ZPI B;  4C5G A;  1QVF A;  4XAX B;  1VTL E;  3L2U A;  4R55 A;  4BDZ A;  1DJ7 B;  5J3B A;  4AMC A;  3PIO A;  1JB0 E;  1NYG A;  1QQJ A;  5L23 A;  3PFS A;  2XHI A;  3QDR B;  3RUX A;  5FU6 B;  3RES A;  2ZFD B;  4PJO B;  3NPF A;  3V7S A;  3M5A A;  1LWY A;  4XTY A;  4KGZ B;  2EQK A;  3QZ9 B;  5GMK m;  1K0X A;  1OV3 A;  1T6A A;  5IT9 E;  4PFP A;  5GAM h;  3GOX A;  2DLP A;  4M7D D;  3RMS A;  3JCM P;  2F2W A;  3I5R A;  1JJ2 P;  2DKC A;  3E9G A;  3M57 A;  2QA4 A;  1LVK A;  2M0Y A;  2M02 A;  5GAN j;  1FXX A;  2CKK A;  3A98 A;  4A4G A;  2DIL A;  3JCM Q;  4EMK A;  1W4S A;  2YT6 A;  4QVZ A;  4F17 A;  3I9Q A;  4IUT A;  2ROL A;  2LT4 A;  1W70 A;  3CCV A;  3TSW A;  3FJP A;  1N3C A;  3I35 A;  1UGR B;  1YJN T;  1UB4 A;  2D8H A;  2EJF A;  2P4R A;  1JDY A;  2KQW A;  4PLI A;  4PY5 A;  3VYH B;  4QVC A;  1JFI C;  4C8Q D;  3OBY A;  3NTH A;  3CPW S;  3H1Z A;  3VJP A;  3U23 A;  4ESR A;  1YIJ A;  4F7U E;  4C0Z A;  4FSS A;  1OX8 A;  4N4H A;  3JCM e;  3ZFJ A;  3MEA A;  4FM4 B;  1I07 A;  3EGX A;  2ZPF B;  5J39 A;  1M3C A;  1PG5 B;  2L0A A;  1S1N A;  3AHU A;  4K11 A;  3HHT B;  4Q5W A;  1EBM A;  2EGC A;  2GGR A;  3KUF A;  3CCR Q;  1VQ6 A;  1GBQ A;  2QXF A;  3MEW A;  1BCM A;  3NHN A;  3ASK A;  1OU8 A;  3TQ7 P;  4KGV B;  2D0B A;  4J5Y A;  1N9R A;  4IL8 A;  3TDH A;  4DBF A;  1YJN A;  2VYT A;  5GAM j;  1VQ7 Q;  2JT4 A;  4KGX B;  1GCQ C;  2X4Y A;  3E1S A;  2D0N A;  1C4G A;  3EG2 A;  2DER A;  4FT4 A;  1XOV A;  5GMK i;  2MCN A;  4OVA A;  4FSX A;  2KDS A;  1BB9 A;  2YDL A;  2LMJ A;  4C0D B;  1IRX A;  1ZUY A;  1KQS S;  4J6X A;  3CCQ T;  2JOI A;  2EJG A;  5GAN 7;  1G2B A;  2PUO B;  5HK0 A;  3D7S B;  4J9B A;  5GAM g;  5KYU A;  2WSC E;  1OOT A;  3TU4 K;  1JEG A;  4HVU A;  3MET A;  1TUD A;  4F7U G;  4E7I A;  2V1R A;  5GAO m;  4XTX A;  1ZHI A;  2BE9 B;  3CVS A;  2P0P A;  3KRM A;  1D0Y A;  4KUD K;  2RQU A;  4PFZ A;  5KYX A;  1PKT A;  1QLY A;  5A0G A;  2E70 A;  4D8D A;  1QCN A;  2VAS A;  1VQ9 Q;  1WJQ A;  3H0H A;  3OYM A;  3CBM A;  3TSZ A;  3UPU A;  2O9V A;  3EAY A;  1ZQ1 A;  2JS2 A;  4RG8 A;  2LJ1 A;  2GBQ A;  1MUZ A;  1TTH B;  1XTD A;  1K0S A;  3OST A;  2YLC A;  1WQA A;  4E7Z A;  2YH5 A;  3FB9 A;  1PHT A;  4ELZ C;  1AIS A;  1RAI B;  1VQO T;  1Z9Z A;  4Z02 A;  2FKM X;  2GTO A;  1AVZ C;  2YSQ A;  1YJ9 T;  4M77 B;  5A0L A;  1EX4 A;  3RKY A;  1I5L A;  1N8R C;  2O3O A;  1VQ5 Q;  3CCE T;  1M30 A;  1NEB A;  3OB9 A;  3CCQ A;  4OB1 B;  5GAN d;  3QKJ A;  1YIT A;  2CP5 A;  1QNA A;  3CXC A;  2FRW A;  4LDU A;  2QG9 B;  1M1K C;  4WXA A;  4EAK A;  1BBZ A;  4CC3 A;  1LWV A;  2SEM A;  2PNI A;  4UC4 A;  5KE3 A;  3PGG A;  4WF2 A;  5FRO A;  2RF0 A;  1Q82 U;  4YTL A;  3HRS A;  3PE0 A;  4BY6 C;  3CWT A;  3NMZ C;  1BK2 A;  2KYB A;  1KO9 A;  2MIO A;  2M1H A;  4JRI A;  1LPL A;  2HDA A;  5D6W A;  2OTL T;  4KH1 B;  3ENO C;  4Y92 A;  2MAM A;  1RUW A;  2RJE A;  3PDK A;  3VRY A;  1Q81 U;  1TOV A;  2YRV A;  1J3M A;  3DPU A;  3EG0 A;  1D0Z A;  2JM8 A;  9ATC B;  1VQO A;  4FT2 A;  1QVF P;  3LH0 A;  2DM1 A;  2RM4 A;  3MCA B;  4FYV B;  2DO3 A;  2CZ6 B;  3SHW A;  3REA B;  1YJ9 A;  2DXT A;  3OYB A;  1RAB B;  4HA8 A;  4NL2 A;  4J8O A;  4QG5 A;  2DL7 A;  3CCE A;  2D8J A;  2AKK A;  3KXT A;  2E5Q A;  4E7J A;  4MDX A;  1SSH A;  1CKB A;  2J6K A;  3VU3 C;  2LX7 A;  1D0X A;  2RMO A;  3HPW A;  2K3B A;  3JCM h;  1H3H A;  3TE5 A;  5CO7 A;  3HRT A;  5CKF A;  5FU6 C;  3C4S A;  3WVE B;  5CQX A;  4PJO C;  3VUZ A;  3X28 B;  4M75 E;  4MZM A;  2PUK B;  3CC2 Q;  2KXC A;  5CKH A;  4JJB A;  1OI1 A;  4BUG A;  2EYX A;  1WHM A;  3JCM c;  2K79 A;  4D7R A;  5LJ3 j;  1D1B A;  4RTZ A;  4M7A D;  2L3Q A;  2GTJ A;  4A4H A;  1NZ9 A;  2KBT A;  2EFI A;  2FB7 A;  1BU1 A;  2QA4 Q;  2HKP A;  3CVT A;  4HT9 A;  2ECZ A;  5F9C A;  4R56 A;  1I0C A;  2E65 A;  1RI0 A;  2DIQ A;  3M4Y A;  2CDT A;  2DTI A;  2VUB A;  5CQY A;  5GMK l;  2QAS A;  4J7F A;  3QII A;  5I2M A;  2V9J A;  3SWN B;  3A8O B;  1UL7 A;  3M9Q A;  3EH2 A;  1TXQ A;  4FL6 A;  2NUZ A;  1YHQ T;  3G4S T;  2X3X D;  4N4I A;  3H0I A;  2H5A X;  3PVL A;  1RLQ C;  1FN7 A;  2KE9 A;  2MZ8 A;  3FRN A;  2FPD A;  4AT1 B;  3G71 T;  1QWF A;  2OAW A;  5CCA A;  4J9F A;  4KBM B;  5A0D A;  2P0Q A;  3A5Z B;  3OA6 A;  2FUV A;  4II1 A;  2Y4X A;  4EAJ A;  3JB9 I;  2K7A A;  1YIJ Q;  2LJ3 A;  1QN6 A;  1Q86 R;  1TWB A;  4OP0 A;  1PD1 A;  4ORZ A;  2MYS A;  2DIG A;  2K3Y A;  3OSV A;  5LJ5 f;  4M75 G;  2JPI A;  2L2P A;  3VRZ A;  3OYC A;  4J6W A;  1UJ0 A;  5GAO n;  2DTO A;  2F7L A;  1UUE A;  4RTV A;  1TUO A;  3MHX A;  1Y71 A;  5FLX E;  5I11 A;  5L8R E;  1RAA B;  3OBW A;  1ZLM A;  4OGE A;  3CCJ T;  2JM9 A;  1NLP C;  1H8K A;  1B7T A;  1VQ6 Q;  1KYU A;  1YI2 T;  1JU5 C;  4M78 E;  4F7U B;  3QXE B;  4M77 A;  1YHQ A;  2F1L A;  4QT7 A;  3G4S A;  2RA2 A;  1GBR A;  1PSF A;  3CPF A;  3QDF A;  2KSS A;  3CC4 T;  5GAN 5;  1Y7X A;  3G71 A;  3CBO A;  2DD5 A;  5IHI A;  4ZGE B;  1B34 A;  2E4H A;  2OTJ T;  4WX8 A;  1RAH B;  1BIB A;  3EHR A;  4JLI A;  2FZC B;  4C0D C;  1QKW A;  4JDS A;  1WZO A;  2BKD N;  3D4V A;  3PIP A;  2DAQ A;  3M56 A;  2FL7 A;  1VQP T;  2HZM A;  1QVG S;  4BDY A;  4JRK A;  1T3L A;  3CCL T;  2DL4 A;  1TS9 A;  5BMP A;  1CSK A;  5IHN A;  1OYX A;  1X01 A;  1SPK A;  2WSE E;  3BE3 A;  3H0F A;  4ZN1 A;  2A7Y A;  4FW2 A;  1GXI E;  1HU0 A;  2EGE A;  1VYU A;  3DLM A;  5GAO p;  3GBQ A;  2OAU A;  5JN5 A;  5HSH A;  1V5S A;  2LNV A;  2OOX A;  4EDU A;  2JW4 A;  2JUF A;  1W6X A;  5FU7 B;  2XDD A;  4E6R A;  4IIM A;  1PD0 A;  1YI2 A;  2ESW A;  2FPF A;  1Q7Y U;  5EG2 A;  4E7S A;  1K8A R;  5GAO l;  4E7H A;  1P5G X;  2GNC A;  5JMV D;  2I2L A;  1NH2 A;  2P84 A;  3MJX A;  4DOV A;  2QLV A;  4B9W A;  3CME T;  4M78 G;  4OB0 B;  2PTK A;  4PJO F;  1D1A A;  4RG2 A;  3S6W A;  2YA3 A;  1NE8 A;  1Y57 A;  1JQQ A;  1W2B S;  1I81 A;  2RK1 A;  5LJ3 d;  4HCB A;  2JTE A;  4M7D E;  3CEY A;  3GLX A;  1ZBJ A;  4M77 C;  2K57 A;  1G5V A;  3JB9 G;  2OTJ A;  1H3Z A;  3CXC P;  3PTA A;  2FEI A;  1BYM A;  5LL6 S;  3NA5 A;  4AFQ C;  2RHU A;  2C0I A;  1Q82 C;  1ARK A;  3MP8 A;  3CCQ Q;  5D6Y A;  4R0K A;  2K2M A;  2Y90 A;  2DA9 A;  1I8F A;  4IKF A;  1YIT Q;  2NOB A;  3CCL A;  4BE0 A;  3OH9 A;  3OS0 A;  2QTX A;  2M0O A;  3S3O A;  2ZZD A;  2RH2 A;  1Q81 C;  4BI8 B;  1JBM A;  1VA7 A;  2H3E B;  2ROT A;  4AFU C;  4HXJ A;  2MPX C;  3D7Q A;  1PCZ A;  1QCF A;  3M0Q A;  2OI3 A;  5LJ5 d;  3RER A;  4C8Q E;  3VYG A;  1D09 B;  3E2U A;  3L2R A;  4QVD A;  4QQ6 A;  3V8K A;  3MEV A;  2DTH A;  1N9S A;  2MWO A;  3C12 A;  2D9T A;  4LDW A;  4RKU E;  3SDZ A;  2VGM A;  1U5S A;  2EKH A;  5GMK j;  1VQK Q;  2JHN A;  4WZS D;  1RM1 A;  4FCY A;  4P5N A;  1HYO A;  1K9A A;  1M2V B;  3JCM J;  2RI2 A;  2FG0 A;  3WXM B;  3BW1 A;  8ATC B;  1YJ9 Q;  3X25 B;  2CSQ A;  2JN0 A;  5KYY B;  1WXU A;  3HKS A;  4M7D G;  3JCM X;  3F70 A;  2PVD B;  3E19 A;  4N4G A;  3JCM V;  1TUC A;  1IHW A;  1OUL A;  3EFR A;  2XMF A;  3MP6 A;  3I0X A;  2O4X B;  1WQW A;  1PCX A;  2CP3 A;  1K73 R;  4OMO A;  3LWH A;  2QGF B;  3KTU A;  2LP5 A;  3LYI A;  3PMT A;  1OZ2 A;  1MNE A;  2LC4 A;  2KT8 A;  4RTU A;  3OYY A;  3L42 A;  3I55 A;  1P92 A;  1NPP A;  2ZPB B;  1K4U S;  4JZ4 A;  3L2Z A;  2MMP A;  5CIU A;  1C1A A;  1KSW A;  3PMG A;  4LN2 A;  2HBW A;  3OSM A;  1K2Y X;  1WHH A;  3HS9 A;  4OMP A;  1S72 T;  2DKG A;  1AT1 B;  4C8Q G;  3ULR B;  4A54 A;  2D0Q B;  4LUE A;  4F7U A;  5KH6 A;  1QKX A;  1V76 A;  2EKO A;  4C92 E;  3CMA A;  2DZC A;  2XG8 D;  4HVV A;  2LT1 A;  1YQR A;  4FU6 A;  1BKB A;  2RHX A;  2LCS A;  4M75 B;  3SWN C;  3DPT A;  1GCQ A;  1MMA A;  5GAO q;  4PKC C;  1TUG B;  3OYN A;  1YCS B;  3FEO A;  3SB2 A;  1JJ2 S;  1PRL C;  2JS0 A;  4OML A;  3I0W A;  4QQD A;  1H92 A;  3OMC A;  4X9D A;  1NPR A;  2H3J A;  2LJ0 A;  1KD1 R;  4DQ2 A;  3OS1 A;  1WDX A;  1PCJ X;  3F0Z A;  4LD6 A;  1NJI U;  1KK7 A;  5GAN f;  2A3L A;  5LJ5 e;  2JTM A;  2WSF E;  4WTO B;  4X1V A;  5FW9 A;  4FYW B;  4FYY B;  2HQX A;  2KRS A;  5DLO A;  3J80 E;  4RUG A;  2QK0 A;  2RHI A;  3CCS T;  3QUI A;  2QTV A;  2EQM A;  3V7C A;  1NJI R;  3TVT A;  5IH2 A;  4M77 F;  2HZS A;  2DX1 A;  2EGA A;  3EGU A;  1S72 A;  1RAC B;  4EAG A;  2JXB A;  2DRK A;  4D6W A;  4IUU A;  1UGP B;  2HSE B;  1UFF A;  1K35 A;  2NOF A;  2MI6 A;  2ZPG B;  4E7K A;  2DEU A;  4C92 G;  1M8M A;  3E9F A;  3OS5 A;  1YJW T;  2CP6 A;  3OMG A;  2OOY A;  2Y8L A;  1OPL A;  5FWC A;  3TEE A;  1YHQ Q;  3G4S Q;  2JMA A;  4PJL A;  4A4F A;  1M1G A;  1VYV A;  2NOL A;  4TPS A;  1ACM B;  4HJH A;  4JLG A;  1VOL B;  1VQN T;  2HKQ B;  3C95 A;  3HTR A;  1KC8 C;  2O01 E;  4A53 A;  3G71 Q;  2EYW A;  4J9I A;  4KUL A;  1SSF A;  2DBK A;  1BCO A;  1X75 C;  2ZGW A;  3QZ5 B;  3CCS A;  2RJD A;  4D7Q A;  3QJ6 A;  1KJW A;  4M78 B;  1M2O A;  1SHF A;  5GAM f;  2DXC A;  4F04 B;  2XD0 A;  1YWP A;  4CI0 C;  1KG1 A;  2QGG A;  1M3Q A;  1UT7 A;  1RAF B;  1PKS A;  3PVQ A;  2AZS A;  2NLV A;  2XIC A;  1VQM Q;  1M90 R;  2F5K A;  2M16 A;  2Z0W A;  1QN7 A;  5FU7 C;  1OPK A;  2L3P A;  2X51 A;  2DRM A;  5CKD A;  2FHD A;  2CUB A;  2KAF A;  3FIF A;  5HCK A;  1YI2 Q;  1M2V A;  4LDV A;  2NYS A;  1TG0 A;  3VS5 A;  1YJW A;  2ENM A;  2W0Z A;  1KYD A;  1BI1 A;  2NUT B;  4EIK A;  2E64 A;  4EJZ A;  2YWW A;  3OGD A;  4E2F B;  5KYY A;  3IH7 A;  3LWI A;  4MZT A;  1LJO A;  4M7A E;  2A28 A;  4MZP A;  4DUL A;  2NOH A;  4B6M A;  1AEY A;  2EHB D;  4GLK A;  2NOI A;  3GNG A;  2DE0 X;  2F2X A;  2QDY B;  2PVG B;  3NTI A;  2L3S A;  1QP2 A;  3LW5 E;  2DBM A;  2HEQ A;  3DLL A;  3RMQ A;  3QJY A;  3X20 B;  3G6E Q;  1VQ4 T;  4BJU A;  3OW2 A;  1OEB A;  1UEB A;  4PJO A;  3CCL Q;  1UT4 A;  2JMC A;  2LCC A;  2RJC A;  4J9E A;  3I56 T;  2D0C A;  4DBH A;  3UWN A;  1Q95 G;  2QQB A;  3H41 A;  3OCI A;  3CCM T;  3H8Z A;  4XTU A;  1UGQ B;  4M7D B;  2D0A A;  2MK5 A;  2CSI A;  5CVI A;  2A37 A;  1TGH A;  2KRO A;  2DPP B;  4DA4 A;  4C92 F;  2IV9 A;  2A0F B;  2DEQ A;  2F2V A;  1LNX A;  1TSF A;  4DOW A;  2DL3 A;  5HK3 A;  2O31 A;  4LUD A;  3R6O A;  3OYK A;  1MV0 B;  2RQT A;  5CKE A;  1WA7 A;  2BZY A;  1M9S A;  2L89 A;  1KFI A;  2K5L A;  4M7A G;  3JAM E;  2RHY A;  4GY5 A;  5LJ5 h;  3QO3 A;  1XJW B;  2FO0 A;  4C8Q B;  1PM3 A;  4J83 A;  2YUQ A;  5D7U A;  4MDW A;  4M4Z A;  3SNS A;  4J9D A;  4JZ3 A;  1QVF S;  2FZG B;  1YWO A;  3CWS A;  4HCK A;  4CC4 B;  1AWX A;  5KCH A;  3I55 Q;  4JRP A;  2MOX A;  3MEU A;  1AWO A;  1U1S A;  4F7U F;  3CW7 A;  2RNA A;  1KFZ A;  2K9G A;  4OMM A;  1WJR A;  5C0M A;  1U1T A;  1X27 A;  5GAM d;  2QEX T;  2XDP A;  3MKD A;  1AD5 A;  2HQH A;  2OTL A;  3SD4 A;  2DL8 A;  4J7I A;  2ED1 A;  2KI7 A;  3VKI A;  2V26 A;  2KGT A;  2EJ9 A;  2C0T A;  5GJW B;  2X4J A;  1K9M R;  4OGC A;  3CMA Q;  4JS4 A;  2X35 A;  2AZV A;  2RI3 A;  3ZL7 C;  4FYX B;  1VQ8 T;  4DEY A;  2V8K A;  4O6J A;  5GAN e;  3UW2 A;  3VV0 A;  5LJ3 f;  1Y96 B;  4M75 C;  1ZBX A;  5GAN 4;  1WLP B;  1AZE A;  5FWB A;  4DBQ A;  1RAG B;  2CS7 A;  2RI5 A;  3CCV Q;  1PVS A;  2CZ1 B;  2RK2 A;  2LQW A;  4Z8A A;  3JB9 H;  1P5D X;  1GRI A;  1G83 A;  4ZTJ A;  4XU1 A;  1QW1 A;  2L5Q A;  1O75 A;  4MRQ A;  1Q86 U;  5I21 A;  2RB6 A;  4M78 A;  2VC8 A;  2H4L X;  2JNG A;  3JRZ A;  4OB2 B;  2KY9 A;  1KIK A;  3LX7 A;  1W80 A;  1M3B A;  2HL5 C;  2DVE A;  4C92 B;  3J81 E;  1QNB A;  4ME7 A;  2R57 A;  2M51 A;  3TRE A;  2Y8Q A;  5IYB P;  2X4W A;  3RNJ A;  2EPD A;  3QBY A;  4PJJ A;  1MGQ A;  3TCJ A;  2QEX A;  1O9S A;  1WHJ A;  2BIV A;  1D1C A;  1IO6 A;  1VQ7 T;  3CC7 T;  5CAI A;  2EYZ A;  1H64 1;  2VXE A;  1S72 Q;  2DXU A;  3CPW A;  4F16 A;  3CCU T;  4L59 A;  4ZTF A;  3UAT A;  1UJY A;  2QI2 A;  2K5I A;  1XNI A;  3HSB A;  2F5T X;  1VOK A;  1VQ8 A;  2EVR A;  3QYH B;  2YUO A;  2I5W A;  1SHG A;  2C0O A;  2DXB A;  4JJN K;  3M54 A;  4AFZ C;  3VUB A;  1X2K A;  2JOY A;  4PJO D;  1E7O A;  2E10 A;  2ED0 A;  3GNF B;  1K1Z A;  2HBP A;  3C0C A;  3UA7 A;  5GAN 2;  1YJN Q;  4EAL A;  2PWW A;  3M0U A;  3P8D A;  2CH4 W;  2KT1 A;  2LX9 A;  5GAM e;  1UGV A;  6AT1 B;  3JCM g;  1D3U A;  1QTP A;  2J7I A;  1WQ7 A;  3GP8 A;  3SEM A;  1VQ9 T;  2VVK A;  2AT1 B;  1Y07 A;  5AYF A;  3RKX A;  4BI3 A;  4A63 B;  3CCS Q;  1G3T A;  1M27 C;  1WX6 A;  2DYB A;  3GIB A;  1BI2 A;  2KVQ G;  1MV3 A;  4A4E A;  1YQK A;  4M78 C;  2IPO B;  2LQK A;  1R0B G;  3T4N A;  3I5S A;  3EFS A;  1G3W A;  2K3X A;  4MML A;  3CC7 A;  1WI7 A;  2E3I A;  1WIE A;  4EMK B;  2FYK A;  1C6V X;  1XSZ A;  3M4G A;  3T9N A;  4CC2 A;  3CCU A;  1X6G A;  1K8A U;  1KQS A;  4E7L A;  2R5A A;  1EZZ B;  1YNZ A;  1VQ5 T;  1HSQ A;  3EG1 A;  3CCJ A;  1QNC A;  2GF7 A;  3ENC A;  2HKN A;  1YJW Q;  1ZA1 B;  3NTK A;  3VS2 A;  1OZ3 A;  5AN4 A;  2IV8 A;  4EPC A;  2FGT A;  4OMN A;  4CFF A;  2RO0 A;  3UT1 A;  4B0A A;  1X2Q A;  2EQJ A;  4IUQ A;  1M3A A;  5M9O A;  2R5M A;  2O2O A;  4C8Q A;  2K5F A;  1KC8 R;  3JCM b;  4DBR A;  3CC4 A;  2KYM A;  2LZ6 B;  2GCX A;  3OW2 P;  5C6S A;  2OX7 A;  1IGQ A;  4D8K A;  2DZ9 A;  2M9U A;  1CDW A;  3A8G B;  3Q1J A;  2FVU A;  2DF6 A;  4BAC A;  1VQP A;  4PK4 A;  3QWX X;  4X9C A;  2DL5 A;  1I5O B;  1QCO A;  3OLP A;  1QTS A;  1X43 A;  4PFO A;  1M5Q 1;  1WJS A;  2EQI A;  2D1X A;  3M55 A;  4XTW A;  1PCM X;  1UGS B;  3BFM A;  3CXC S;  3CWA A;  4M75 F;  4M7A B;  4J9C A;  1TBP A;  2JHJ A;  3NGP A;  2HL3 A;  1AWW A;  1PSE A;  4ZNX A;  4J9G A;  4BI4 A;  4DEX A;  2GFA A;  2OJ2 A;  2KR3 A;  1PZD A;  3EG3 A;  3OSS C;  1YQM A;  2RD1 A;  2E6Z A;  1SG5 A;  3L2Q A;  4QKU A;  3KFV A;  1HK9 A;  2YXY A;  4KUI A;  2GFU A;  3ULX A;  2QQA A;  4L6V 5;  1M3H A;  3A8M B;  5GAN h;  4XQ3 A;  1Y96 A;  2VGN A;  3SWN A;  1MMG A;  4ZGD B;  1E42 A;  2V92 A;  2R58 A;  3VN5 A;  2RQR A;  1C9B B;  5KYU B;  5CR2 A;  1VQO Q;  2COZ A;  2XHC A;  1B3Q A;  3CC2 T;  2HZY A;  2RN8 A;  1FYN A;  1K73 U;  3OY9 A;  1NG2 A;  1PRM C;  1V1C A;  4RTW A;  4L5G A;  1N8R R;  1MMN A;  3X24 B;  4IUV A;  5KYX B;  4C8Q C;  1YBY A;  1FMW A;  4C92 A;  3CCE Q;  3ZEH A;  2PU9 B;  3OYG A;  4ELY C;  2VV5 A;  3HP9 A;  1YTF A;  3P8B B;  4BB7 A;  1M1K R;  3JSC A;  2E3H A;  5A2Q E;  2EBP A;  3ASM A;  3M0R A;  1N3A A;  1WNL A;  2YLB A;  2CZ7 B;  3CBP A;  5IYC P;  2LNH B;  4HT8 A;  4XTZ A;  1KQ1 A;  2HL8 A;  3FLG A;  4JUV A;  2KNB B;  1YFN A;  1AZG B;  4E47 A;  3RR6 A;  2BUD A;  2DKA A;  4M77 D;  2YRC A;  2OTL Q;  2QDL A;  3A8H B;  5LJ3 e;  2QRD A;  1NBE B;  1QMC A;  3L2V A;  3M0P A;  4QW2 A;  3PNW C;  3M0T A;  2HAX A;  1M1F A;  2CT4 A;  1QN3 A;  2J6O A;  2DET A;  3RSM A;  7AT1 B;  2C06 A;  1YIJ T;  1MPG A;  1LOJ A;  1EUV A;  4M78 F;  3CC2 A;  1ZA2 B;  1ZSG A;  1KD1 U;  1Q86 C;  1I4K 1;  1OX9 A;  1WHK A;  3OSE A;  1QN8 A;  3CME A;  5I2S A;  2V1Q A;  4JS5 A;  1D3B B;  4AG1 C;  3GF5 A;  3JB9 F;  1SEM A;  4RTT A;  2CUD A;  1J3T A;  2XKO C;  5DM7 R;  2NOZ A;  2EQU A;  2LQ8 A;  2QR1 A;  1UDL A;  1T3S A;  4PL6 A;  5IYD P;  4RTX A;  1VQ6 T;  4C92 C;  3BY7 A;  2ZPE B;  3VS0 A;  5BMN A;  3QHS A;  1VTO A;  2NVM A;  3CPW P;  3JCM W;  2J05 A;  3GPL A;  2WAC A;  2NLU A;  2QEX Q;  2COW A;  4JJC A;  2V8I A;  2V8J A;  3X26 B;  5ECA A;  1VQL T;  4J6Y A;  5GAN g;  2VKN A;  1U8R A;  2RQV A;  5IXB A;  2X9H A;  2COY A;  2MWP A;  4WCI A;  4ROC B;  2O9S A;  1F1B B;  2E5K A;  4I8O A;  1UG1 A;  2KRN A;  1TH7 A;  5IN1 A;  1YN8 A;  1TU0 B;  1VQ8 Q;  1NM7 A;  1PC0 A;  2L3R A;  2X3W D;  2ZPH B;  2B8A A;  1R0C B;  2HMA A;  1R4X A;  3OYJ A;  4F14 A;  1SKU B;  2EW3 A;  1UEC A;  1UTI A;  2CH4 A;  2HSP A;  1KFQ A;  2H8H A;  1BIA A;  4RCC A;  2VXF A;  1MHN A;  4M7D F;  4XU0 A;  3O5Z A;  1WHG A;  2QQR A;  3OC3 C;  1ZSZ B;  2A36 A;  4NS5 A;  2FPE A;  2D6F A;  2JZ2 A;  4O5V A;  2PQW A;  5IHK A;  2CT3 A;  5HKC A;  2F69 A;  3F10 A;  5KYN A;  3OYL A;  2KRM A;  2LRQ A;  3O8V A;  4LDX A;  3RDV A;  1K8A C;  3UDC A;  4M7A A;  3DB4 A;  4EMG A;  3VS7 A;  1M90 U;  2JVV A;  4KRT A;  5KYW B;  1KQS P;  3M53 A;  2X4X A;  3CC7 Q;  4NOY A;  4AFS C;  1NEG A;  2FKF A;  2VB6 A;  4JJD A;  4EMK C;  2RQW A;  1T0H A;  5GAN 3;  2AIR B;  1VQL A;  1UHC A;  1WJW A;  2K2V A;  1I1J A;  2IG0 A;  2B86 A;  1Q7Y C;  3CCU Q;  3MP1 A;  3FJ5 A;  3V8L A;  2NWM A;  4GBQ A;  4C8Q F;  5EPC A;  3DKM A;  3FC3 A;  1QVG A;  3CCJ Q;  2LAE A;  3CD6 T;  1YIT T;  2EYQ A;  4QQG A;  2RPN A;  2AK5 A;  1ABQ A;  1FMV A;  3QPH A;  4C92 D;  1X6O A;  2HCK A;  3L1A A;  1AHJ B;  2AKL A;  3ME9 A;  4LE9 A;  5FRN A;  4IIO A;  3UA6 A;  2YUN A;  5KL0 A;  3PMI A;  3M58 A;  1V29 B;  2LVM A;  2NWV A;  2EAY A;  3CC4 Q;  1YQL A;  5J26 A;  1VQN A;  4HKE A;  3LGL A;  1EFN A;  2O4X A;  2ZCF B;  3JV3 A;  2HQE A;  4KH0 B;  1R8O B;  4IUP A;  1DIZ A;  2OTJ Q;  2DFU A;  4Y28 E;  1VUB A;  3INZ A;  1VQP Q;  2J06 A;  1W1F A;  3RBB B;  1W2B A;  1VQK T;  2CRE A;  2SRC A;  2E12 A;  1IHV A;  1WFW A;  3L2W A;  1E6G A;  5D6X A;  1Y0M A;  4ATO A;  4M7A C;  4TVR A;  1VIF A;  4ANJ A;  2EWN A;  5LJ3 h;  1TBA B;  3BDU A;  1XQH A;  2PZ1 A;  2G3R A;  4PNO A;  3LH5 A;  3OYH A;  1SF9 A;  1JO8 A;  3CD6 A;  1X69 A;  1GFC A;  3CQT A;  3WVD B;  3OQ5 A;  4XU2 A;  1K73 C;  1B34 B;  2QRC A;  2CYZ B;  3I3W A;  3MPU B;  3PT9 A;  3V8J A;  4M75 A;  3CME Q;  4NL3 A;  2IIM A;  1D3B A;  5GMK e;  4LDY A;  1QN5 A;  3OYI A;  5KE2 A;  4X34 A;  1MND A;  2JTF A;  2DD4 A;  3A1P A;  1UHF A;  3QWY A;  1WHL A;  1Q82 R;  2O88 A;  2L8D A;  1VQ4 A;  3A8L B;  1VQK A;  4HCC A;  3VS4 A;  2DJZ A;  3HL8 A;  2LTO A;  2YHT A;  3EGD B;  2K6D A;  4OMF B;  3IQL A;  4ZGJ B;  1GFD A;  4FW1 A;  1ABO A;  4PJO E;  4OB3 B;  2ZAE A;  3I56 A;  1EIF A;  2G30 A;  2K4Y A;  1Q81 R;  4Q11 A;  1NVP A;  1QN9 A;  1N5Z A;  1SRM A;  3CCM A;  3OH6 A;  2DJQ A;  3G1J A;  3EFO B;  1K9M U;  3SFM A;  2G6F X;  2AHJ B;  2CZ0 B;  1KD1 C;  2Z0F A;  4C0G A;  1HD3 A;  1M4Z A;  2J6F A;  1BI3 A;  4A4K A;  2FRY A;  3DB3 A;  1M8V A;  2QQS A;  1WGS A;  1ZSZ A;  1NJI C;  4KT0 E;  2VJ0 A;  2YUP A;  2JJ9 A;  2P4T A;  2QYZ A;  1IB8 A;  4IUR A;  2VWF A;  4HVW A;  1IGU A;  2HL9 A;  1N39 A;  4C5H A;  3OYD A;  1YP5 A;  2CP2 A;  5KYW A;  3CCR T;  3VS1 A;  5AT1 B;  3EG9 B;  3VS6 A;  5LJ3 g;  4Z88 A;  1KQ2 A;  3RKW A;  2DNU A;  1JJ2 A;  1G3Y A;  4PJO G;  2CP0 A;  1FX7 A;  3M0S A;  1RAE B;  3P8H A;  4PJM A;  1WXT A;  2NUP B;  2LDM A;  3J7A F;  1RL2 A;  5LJ5 j;  4V2S A;  1QNE A;  3QG1 A;  1SRL A;  2E6N A;  1VKL A;  1G8X A;  3QYG B;  4C7P A;  2XID A;  1K76 A;  1AWJ A;  1FMK A;  2NUT A;  4RCB A;  5I22 A;  1A0N B;  1Q9U A;  2BTT A;  5CK9 A;  2BE7 D;  4XK8 E;  1PNJ A;  5LJ5 g;  2ABL A;  2DK3 A;  4VUB A;  4XU3 A;  4OF1 A;  2YRD A;  1WPY A;  4M7A F;  3OS2 A;  1U3O A;  3LLR A;  4EJY A;  3EIK A;  1VQM T;  4B9X A;  3V7R A;  2QQ9 A;  1N27 A;  2LCL A;  2Y4Y A;  1ZSZ C;  4C5I A;  2QAZ A;  1M90 C;  3VS3 A;  1T0J A;  5IAY A;  1RI9 A;  2XI9 A;  8AT1 B;  3CCR A;  1C0M A;  3JCM f; 
#chains in the Genus database with same CATH homology
 4A4F A;  1M1G A;  1VQO A;  4FT2 A;  4IUV A;  2XK0 A;  3X24 B;  4C8Q C;  3LH0 A;  1YBY A;  2RM4 A;  4C92 A;  3MCA B;  4EMH A;  3ZEH A;  4JLG A;  2DO3 A;  2PU9 B;  5DLQ E;  2CZ6 B;  3OYG A;  4ELY C;  1VQN T;  1YJ9 A;  2VV5 A;  3C95 A;  2DXT A;  3OYB A;  1KC8 C;  3HP9 A;  1IRE B;  2O01 E;  4A53 A;  3M59 A;  3OYE A;  3P8B B;  4BB7 A;  1QP3 A;  4HA8 A;  4NL2 A;  4PLL A;  3JSC A;  4BE2 A;  3QSU A;  5A2Q E;  4KUL A;  4J8O A;  1HXD A;  1SSF A;  2RHZ A;  4M7D A;  3CCE A;  1X75 C;  2ZGW A;  2HNI A;  1VQ7 A;  1WNL A;  2YLB A;  2CZ7 B;  1G3S A;  3HRU A;  3KXT A;  1VIE A;  3CBP A;  3QZ5 B;  4M75 D;  2E5Q A;  3CCS A;  4E7J A;  4MDX A;  4HT8 A;  4XTZ A;  3VU3 C;  1KQ1 A;  2RJD A;  3QJ6 A;  4M78 B;  3FLG A;  4JUV A;  5GAM f;  4C0F A;  2DXC A;  4E47 A;  3HPW A;  2XD0 A;  2BUD A;  4CI0 C;  3JCM h;  1KG1 A;  5CO7 A;  3HRT A;  5CKF A;  5FU6 C;  3C4S A;  4M77 D;  4ZN3 A;  3G6E T;  4HCZ A;  3WVE B;  5CQX A;  4PJO C;  3VUZ A;  3X28 B;  3A8H B;  1KC8 U;  5LJ3 e;  4M75 E;  4C5E A;  4MZM A;  2PUK B;  2XIC A;  4N0A A;  5GMK h;  5CKH A;  1OI1 A;  2F5K A;  3L2V A;  2M16 A;  4BUG A;  3MO8 A;  3PNW C;  4QW2 A;  2HAX A;  3JCM c;  1M1F A;  5FU7 C;  2GQV A;  5LJ3 j;  5GAN 8;  1IZ6 A;  3LGF A;  4M7A D;  2C06 A;  5CKD A;  2FHD A;  3FIF A;  2KAF A;  1YIJ T;  2E41 A;  4A4H A;  1NZ9 A;  1LOJ A;  2E1H A;  3H6Z A;  5FRM A;  4M78 F;  2EFI A;  3CC2 A;  4M77 E;  2FB7 A;  4LDV A;  1VQM A;  1KD1 U;  1YJW A;  1Q86 C;  1BI1 A;  1I4K 1;  5HY6 A;  2E64 A;  2RJF A;  2CGH A;  4JRQ A;  4CRI A;  3KBG A;  3S3N A;  4HT9 A;  3CME A;  4R56 A;  5DY9 A;  5I2S A;  2E65 A;  4Y91 A;  1RI0 A;  2DIQ A;  3LWI A;  4JS5 A;  3M4Y A;  1D3B B;  4MZT A;  4BD3 A;  3GF5 A;  1VQ9 A;  1LJO A;  3JB9 F;  2DTI A;  4M7A E;  3N5B B;  4MZP A;  2VUB A;  5CQY A;  5GMK l;  4J7F A;  3QII A;  5I2M A;  2XKO C;  4GLK A;  5DM7 R;  3GNG A;  2QDY B;  2EQU A;  3SWN B;  2PVG B;  3A8O B;  1BI0 A;  2MF2 A;  3M9Q A;  2LQ8 A;  3NTI A;  1QP2 A;  4LD9 K;  4PL6 A;  4FL6 A;  1YHQ T;  3LW5 E;  3G4S T;  3BDL A;  3OYF A;  3DLL A;  4N4I A;  1VQ6 T;  3RMQ A;  4C92 C;  3OW2 S;  3BY7 A;  3QJY A;  3X20 B;  2ZPE B;  4BE1 A;  3QHS A;  1VQ4 T;  3OW2 A;  3FRN A;  3HFN A;  5GAN 6;  1UEB A;  3G71 T;  3JCM W;  4PJO A;  3S3M A;  3GPL A;  5CCA A;  2WAC A;  2NLU A;  4M7D C;  4KBM B;  1KHI A;  2V8I A;  2LCC A;  2P0Q A;  2RJC A;  3A5Z B;  5A0D A;  1VQ5 A;  3I56 T;  2V8J A;  3OA6 A;  3X26 B;  5GAO r;  4II1 A;  1VQL T;  4J6Y A;  3UWN A;  2Y4X A;  3G7Z A;  5GAN g;  3G6E A;  3JB9 I;  1U8R A;  2QQB A;  3CCM T;  3ER0 A;  3H8Z A;  4XTU A;  1UGQ B;  4OP0 A;  2KMT A;  4M7D E;  4M7D B;  2HD0 A;  1FWZ A;  2DIG A;  2K3Y A;  2MWP A;  3I55 T;  3OSV A;  5LJ5 f;  4M75 G;  3OYC A;  1N8R U;  4J6W A;  4RMO A;  1TH7 A;  5IN1 A;  2DTO A;  5GAO n;  4M78 D;  5CVI A;  2P0K A;  2XU8 A;  3MHX A;  2DPP B;  4N0A C;  2L3R A;  1Y71 A;  2ZPH B;  5FLX E;  2B8A A;  4C92 F;  4DA4 A;  4BY6 B;  2DEQ A;  5L8R E;  1KHC A;  3OYJ A;  1M1K U;  2KK4 A;  4M77 G;  3OBW A;  1LNX A;  4OGE A;  3CCJ T;  4XTV A;  4DOW A;  4FIB A;  3HFO A;  5HK3 A;  1BIA A;  4RCC A;  3RIR A;  3JB9 D;  1QVP A;  2VXF A;  3R6O A;  3OYK A;  1YI2 T;  1MHN A;  3EAE A;  4M7D F;  5KCO A;  5CKE A;  4XU0 A;  4M78 E;  2XDB A;  2QQR A;  5CKB A;  3OYA A;  4NS5 A;  3NFC A;  1M9S A;  2L89 A;  4F7U B;  2K5L A;  2QA4 T;  2D6F A;  3QXE B;  4M77 A;  2JZ2 A;  4M7A G;  3JAM E;  4O5V A;  2PVO B;  3URG A;  2PQW A;  1YHQ A;  3CMA T;  2RHY A;  5HKC A;  2F69 A;  4GY5 A;  3G4S A;  1K9M C;  3JCM d;  2IVW A;  2RA2 A;  5LJ5 h;  3QO3 A;  3OYL A;  2LRQ A;  1PSF A;  1YCY A;  3CPF A;  3O8V A;  4MMK A;  4C8Q B;  4LDX A;  4J83 A;  3C94 A;  1JRI A;  4MDW A;  2KSS A;  3CC4 T;  5GAN 5;  3FDR A;  1K8A C;  3UDC A;  3JB9 J;  4M7A A;  3DB4 A;  2EIF A;  1Y7X A;  4EMG A;  3G71 A;  1QVF S;  3CBO A;  2DD5 A;  1M90 U;  2JVV A;  1N6A A;  4ZGE B;  3M53 A;  1B34 A;  2X4X A;  3ZBD A;  2OTJ T;  3CCV T;  4NOY A;  2ZPI B;  4C5G A;  1QVF A;  4EMK C;  5KCH A;  1BIB A;  4XAX B;  4JRP A;  4JLI A;  3L2U A;  4R55 A;  4C0D C;  5GAN 3;  4JDS A;  4BDZ A;  1VQL A;  3MEU A;  2BKD N;  1U1S A;  2K2V A;  3PIP A;  2DAQ A;  3M56 A;  4F7U F;  2FL7 A;  2IG0 A;  1VQP T;  1DJ7 B;  1Q7Y C;  3MP1 A;  1WJR A;  5J3B A;  5C0M A;  1QVG S;  1U1T A;  3V8L A;  4JRK A;  1JB0 E;  3PIO A;  5GAM d;  3CCL T;  4BDY A;  4C8Q F;  3DKM A;  2QEX T;  1OYX A;  1X01 A;  3PFS A;  2WSE E;  3QDR B;  2XDP A;  4ZN1 A;  2A7Y A;  3FC3 A;  1QVG A;  1GXI E;  3RUX A;  3DLM A;  5FU6 B;  5GAO p;  3RES A;  2OTL A;  3SD4 A;  3CD6 T;  4J7I A;  1YIT T;  2OAU A;  4PJO B;  2EYQ A;  3M5A A;  3V7S A;  4XTY A;  4QQG A;  3VKI A;  4C92 D;  3QPH A;  2EJ9 A;  2LNV A;  4EDU A;  1X6O A;  3L1A A;  1AHJ B;  2EQK A;  3QZ9 B;  5GMK m;  2JUF A;  5FU7 B;  2XDD A;  3ME9 A;  2X4J A;  5FRN A;  4OGC A;  4JS4 A;  5IT9 E;  2X35 A;  2RI3 A;  5GAM h;  3GOX A;  3PMI A;  3M58 A;  1V29 B;  1YI2 A;  1VQ8 T;  4M7D D;  3RMS A;  2V8K A;  2LVM A;  1Q7Y U;  4O6J A;  3JCM P;  5EG2 A;  5GAN e;  5GAO l;  3E9G A;  2EAY A;  3M57 A;  2QA4 A;  4E7H A;  3VV0 A;  2I2L A;  5J26 A;  5LJ3 f;  1VQN A;  1Y96 B;  3LGL A;  1ZBX A;  2O4X A;  2ZCF B;  4HKE A;  4M75 C;  4DOV A;  5GAN 4;  2HQE A;  4B9W A;  3CME T;  1R8O B;  4M78 G;  4IUP A;  4OB0 B;  5GAN j;  2CS7 A;  4PJO F;  2RI5 A;  4RG2 A;  3S6W A;  1FXX A;  1NE8 A;  2CKK A;  2CZ1 B;  2RK2 A;  4A4G A;  3JCM Q;  3JB9 H;  1W2B S;  4EMK A;  1I81 A;  2RK1 A;  5LJ3 d;  4HCB A;  1W4S A;  4QVZ A;  4XU1 A;  1VUB A;  3CEY A;  3INZ A;  1QW1 A;  2L5Q A;  4Y28 E;  3GLX A;  4ZTJ A;  1O75 A;  4IUT A;  4M77 C;  1Q86 U;  1W2B A;  2K57 A;  2RB6 A;  5I21 A;  1G5V A;  4M78 A;  2LT4 A;  3JB9 G;  2VC8 A;  1VQK T;  2OTJ A;  1H3Z A;  2JNG A;  3PTA A;  3CCV A;  2E12 A;  3JRZ A;  1BYM A;  4OB2 B;  2KY9 A;  5LL6 S;  3FJP A;  3LX7 A;  3L2W A;  1UGR B;  2DVE A;  2RHU A;  1YJN T;  1UB4 A;  5D6X A;  4C92 B;  3J81 E;  1Q82 C;  2EJF A;  2R57 A;  3MP8 A;  4ME7 A;  4ATO A;  5D6Y A;  2KQW A;  4PLI A;  3TRE A;  2Y90 A;  4M7A C;  1I8F A;  4TVR A;  1VIF A;  2X4W A;  3VYH B;  4QVC A;  4IKF A;  2EWN A;  3CCL A;  3QBY A;  5LJ3 h;  1MGQ A;  3BDU A;  1XQH A;  3TCJ A;  4C8Q D;  1O9S A;  2QEX A;  3OBY A;  4BE0 A;  2BIV A;  3OS0 A;  2G3R A;  1VQ7 T;  2QTX A;  4PNO A;  3NTH A;  5CAI A;  3OYH A;  3CC7 T;  3CPW S;  3VJP A;  1H64 1;  2M0O A;  2VXE A;  3CD6 A;  3S3O A;  2DXU A;  3WVD B;  2ZZD A;  3OQ5 A;  4XU2 A;  4F7U E;  3CPW A;  1YIJ A;  1B34 B;  2RH2 A;  4C0Z A;  1Q81 C;  4BI8 B;  3CCU T;  1K73 C;  1JBM A;  4N4H A;  4L59 A;  4ZTF A;  2CYZ B;  3JCM e;  2QI2 A;  5LJ5 d;  3ZFJ A;  3MEA A;  4FM4 B;  3PT9 A;  3RER A;  4C8Q E;  2K5I A;  4M75 A;  3V8J A;  4NL3 A;  2ZPF B;  5J39 A;  1XNI A;  3HSB A;  2F5T X;  1D3B A;  1VQ8 A;  3VYG A;  3QYH B;  5GMK e;  4LDY A;  3L2R A;  3OYI A;  4QVD A;  4QQ6 A;  5KE2 A;  3HHT B;  3AHU A;  4Q5W A;  4X34 A;  3V8K A;  2DXB A;  2DTH A;  3MEV A;  4JJN K;  3KUF A;  1N9S A;  2MWO A;  2JTF A;  2D9T A;  2DD4 A;  3C12 A;  4LDW A;  2VGM A;  3M54 A;  4RKU E;  3SDZ A;  3VUB A;  5GMK j;  2JOY A;  4PJO D;  4P5N A;  3GNF B;  2E10 A;  3JCM J;  2HBP A;  5GAN 2;  2RI2 A;  1VQ6 A;  3P8D A;  2QXF A;  3MEW A;  2L8D A;  3ASK A;  3WXM B;  3BW1 A;  2LX9 A;  5GAM e;  1VQ4 A;  4J5Y A;  3A8L B;  1N9R A;  3X25 B;  2JN0 A;  1VQK A;  4HCC A;  3JCM g;  2DJZ A;  1WQ7 A;  3HKS A;  2LTO A;  2YHT A;  3HL8 A;  4OMF B;  3JCM X;  3GP8 A;  1VQ9 T;  4M7D G;  4ZGJ B;  1Y07 A;  3F70 A;  5AYF A;  1YJN A;  2PVD B;  2VYT A;  5GAM j;  3E19 A;  4N4G A;  3JCM V;  4PJO E;  4OB3 B;  3EFR A;  3I56 A;  1EIF A;  3MP6 A;  3RKX A;  4BI3 A;  2O4X B;  1WQW A;  2X4Y A;  1G3T A;  3GIB A;  3E1S A;  3LWH A;  1BI2 A;  2K4Y A;  2KVQ G;  4A4E A;  4FT4 A;  4M78 C;  3LYI A;  3PMT A;  1XOV A;  2LQK A;  3CCM A;  1OZ2 A;  3EFS A;  1G3W A;  2K3X A;  2LC4 A;  4MML A;  5GMK i;  3OYY A;  3CC7 A;  4OVA A;  1K9M U;  4EMK B;  2FYK A;  4FSX A;  2KDS A;  3L42 A;  3SFM A;  3I55 A;  1P92 A;  4C0D B;  1NPP A;  2ZPB B;  2AHJ B;  1KQS S;  4J6X A;  3CCQ T;  2CZ0 B;  2EJG A;  5GAN 7;  5HK0 A;  2PUO B;  1KD1 C;  3M4G A;  3T9N A;  3CCU A;  1K8A U;  4C0G A;  3L2Z A;  5GAM g;  1M4Z A;  4E7L A;  1KQS A;  2WSC E;  2R5A A;  2MMP A;  3TU4 K;  5CIU A;  3MET A;  1VQ5 T;  4F7U G;  4E7I A;  5GAO m;  1BI3 A;  4A4K A;  3CCJ A;  4XTX A;  1ZHI A;  3DB3 A;  2P0P A;  1M8V A;  2GF7 A;  1S72 T;  2DKG A;  2QQS A;  4C8Q G;  4KUD K;  3NTK A;  1OZ3 A;  4A54 A;  1WGS A;  2D0Q B;  5A0G A;  1NJI C;  4F7U A;  4KT0 E;  5KH6 A;  4EPC A;  2EKO A;  4C92 E;  2E70 A;  3CMA A;  2RO0 A;  2P4T A;  3UT1 A;  1WJQ A;  2EQJ A;  4IUQ A;  2DZC A;  5M9O A;  2XG8 D;  2R5M A;  3OYM A;  3CBM A;  4C8Q A;  3UPU A;  2K5F A;  1ZQ1 A;  2LT1 A;  4IUR A;  4RG8 A;  3JCM b;  4FU6 A;  1BKB A;  1XTD A;  3CC4 A;  2RHX A;  4C5H A;  2GCX A;  4M75 B;  3SWN C;  5C6S A;  3OYD A;  5GAO q;  2YLC A;  4PKC C;  3OYN A;  3FEO A;  3SB2 A;  3CCR T;  1JJ2 S;  3FB9 A;  4ELZ C;  1VQO T;  2DZ9 A;  4Z02 A;  5LJ3 g;  2M9U A;  4QQD A;  1KQ2 A;  3A8G B;  3RKW A;  3OMC A;  1JJ2 A;  1G3Y A;  4X9D A;  1NPR A;  2H3J A;  3Q1J A;  4DQ2 A;  2FVU A;  3OS1 A;  4BAC A;  1VQP A;  4LD6 A;  4M77 B;  4X9C A;  5A0L A;  1YJ9 T;  4PJO G;  1NJI U;  5GAN f;  2A3L A;  5LJ5 e;  1FX7 A;  3RKY A;  1I5L A;  2JTM A;  2WSF E;  1M5Q 1;  3P8H A;  1WJS A;  1N8R C;  2LDM A;  3M55 A;  3CCE T;  3J7A F;  3OB9 A;  2HQX A;  4XTW A;  1RL2 A;  1UGS B;  3BFM A;  5DLO A;  5LJ5 j;  3J80 E;  3CXC S;  3CCQ A;  4V2S A;  4OB1 B;  2RHI A;  4M75 F;  4M7A B;  5GAN d;  3CCS T;  3QUI A;  3QG1 A;  3QKJ A;  2E6N A;  1YIT A;  1PSE A;  3CXC A;  4LDU A;  2EQM A;  3QYG B;  3V7C A;  1M1K C;  2XID A;  4BI4 A;  2GFA A;  4UC4 A;  5KE3 A;  3PGG A;  3OSS C;  4RCB A;  2RD1 A;  2E6Z A;  4WF2 A;  5FRO A;  1Q82 U;  3L2Q A;  4M77 F;  1S72 A;  4YTL A;  3HRS A;  1HK9 A;  5CK9 A;  4KUI A;  2GFU A;  2QQA A;  4L6V 5;  4D6W A;  4XK8 E;  4IUU A;  4BY6 C;  5LJ5 g;  3A8M B;  2DK3 A;  1UGP B;  4XQ3 A;  4VUB A;  1Y96 A;  4XU3 A;  5GAN h;  2VGN A;  2M1H A;  4OF1 A;  3SWN A;  4JRI A;  4ZGD B;  1WPY A;  4M7A F;  3OS2 A;  2MI6 A;  2R58 A;  5D6W A;  2OTL T;  2ZPG B;  5CR2 A;  4E7K A;  2XHC A;  3LLR A;  2MAM A;  3CC2 T;  4C92 G;  1VQM T;  4B9X A;  2RJE A;  3E9F A;  3V7R A;  2QQ9 A;  3OS5 A;  1YJW T;  1N27 A;  2LCL A;  2Y4Y A;  4C5I A;  1Q81 U;  3OMG A;  1K73 U;  3OY9 A;  1M90 C;  2YRV A;  5IAY A;  3TEE A;  4L5G A;  2XI9 A;  3CCR A;  3JCM f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...