1M5Q1

Crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIMYRYIVHIDSTERRIDMREFAKQAEKIFPGMVKYIEETNVVLIGDKVRVSEIGVEGVGPVAERAKRLFEEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small nuclear ribonucleoprotein homolog
publication title Structure and assembly of an augmented Sm-like archaeal protein 14-mer
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Translation
total genus 23
structure length 127
sequence length 127
chains with identical sequence 2, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF14894 Lsm_C Lsm C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m5q101
3.30.310.60 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Like-Sm ribonucleoprotein, C-terminal domain 1m5q102
1D3BA 2EJFA 3EFSA 4MMLA 3RKYA 3SWNA 2DTOA 4C8QF 4M75B 3L2ZA 3QHSA 4M78D 4C92A 3JCMd 2DJZA 4M78B 5GAN6 5GMKe 5LJ5g 5GAOn 1M8VA 4QVCA 5LJ3j 5GAN3 4EMGA 2RB6A 4HA8A 3BFMA 3HFNA 4C8QA 3QSUA 4MMKA 3V7RA 4J6XA 4X9DA 4PJOG 4JRIA 3RUXA 5LJ5e 5GANj 3RKXA 4PNOA 3JCMh 4F7UF 2DEQA 4N0AC 5LJ3h 5GAMj 2FYKA 1JRIA 4M7AF 4PJOD 4F7UA 4M78E 5GMKm 4M7AC 4PJOB 3JCMX 2EAYA 4J6WA 3V7CA 1U1SA 3JCMQ 4HT9A 4C92G 2DZCA 3SB2A 4M7DA 5LJ3f 3VU3C 4EMKA 2RD1A 4OP0A 4XTYA 1B34A 1I4K1 1U1TA 4XQ3A 4Y91A 4EMHA 4C8QG 4M77D 4M77B 5GANf 1D3BB 5CAIA 4X9CA 3RESA 5GAOq 4M75D 3SWNB 3GIBA 1JBMA 3JCMJ 1I81A 4C92D 3INZA 3HSBA 4C92B 3RERA 5GAMf 2DXTA 4XTXA 3JB9I 5LJ5d 1N9RA 2YHTA 2RA2A 1I5LA 4PJOE 1TH7A 1Y96B 3BW1A 4C8QB 5GAOr 2DZ9A 4DQ2A 3JB9G 4F7UG 4JUVA 1LJOA 3QO3A 3JCMb 4XU1A 5GMKj 3FB9A 1I8FA 5GMKi 2HNIA 4M77E 5LJ5h 4M7DG 1MGQA 4M75E 4M77C 4N0AA 3JB9D 3EFRA 4C92E 4M75C 2E41A 4F7UB 1N9SA 2EJGA 4M78C 4WF2A 4XU2A 3JCMf 4M7AA 2DTHA 4A53A 5GMKh 1LOJA 5GAOl 2YLCA 4M7DD 5LJ3g 5GAN2 1KQ1A 2VC8A 4EMKB 4M7DB 1B34B 1M5Q1 2E10A 2DXUA 3JCMc 4XTWA 2CGHA 5DY9A 5GANg 4NOYA 4V2SA 3QUIA 1HK9A 4RCCA 3V8KA 2VXFA 5GAOp 3RKWA 5GAN8 5GAMg 3JCMW 2VXEA 5LJ5j 1KQ2A 3L1AA 4C8QD 3M4GA 3JCMP 4PJOC 1X01A 2EJ9A 2E65A 4M7DE 2E1HA 4XTUA 4NL2A 4M7AG 4J5YA 1BIAA 4M77F 4XTZA 4J6YA 3JCMe 4HT8A 5GAOm 4M75F 5LJ3e 1HXDA 4M78F 3SWNC 3RIRA 2FB7A 4C92F 5GMKl 4M77A 2RM4A 2YLBA 3JCMg 4C92C 4A54A 5GANe 3HFOA 1WPYA 4M75A 4M7AB 3JCMV 2ZGWA 4C8QE 4M78A 4M7AD 2E64A 1WQ7A 5LJ5f 2EWNA 4C8QC 1H641 2DVEA 2DKGA 3BY7A 5GAMe 5GAN4 5LJ3d 5I21A 1Y96A 2QTXA 3V7SA 4NL3A 1LNXA 3FJPA 5GANd 1BIBA 3JB9F 4XTVA 4PJOF 3V8JA 1WQWA 4F7UE 3PGGA 2JN0A 3V8LA 5GAMd 5GAN7 5GAN5 4M7AE 3AHUA 4RCBA 4PJOA 4XU3A 4M77G 4M7DF 5GANh 3BDUA 3JB9H 1WNLA 2I2LA 4M75G 4EMKC 1YCYA 4QVDA 4M7DC 4M78G 2K57A 5GAMh 2Y90A 3FIFA 3JB9J 4XU0A 4JLIA 2DTIA 4JRKA
chains in the Genus database with same CATH superfamily
2EKOA 2HZYA 2GBQA 5FU7C 3RKYA 3FEOA 2VGMA 4C8QF 3L2ZA 1TWBA 2MCNA 1OZ3A 1R0BG 2CP7A 2DIGA 4Y28E 1VQOT 2ZZDA 4A4GA 1SHFA 2M51A 2CZ7B 4J6XA 4X9DA 2K3BA 3L42A 1SEMA 2OTJA 5IYBP 5LJ3h 5BMNA 4F04B 5IYCP 3QDRB 4PJOD 2ZPEB 2QA4A 1JEGA 3VV0A 3V7CA 2HKQB 2O01E 2CT3A 3PNWC 2CP6A 2MAMA 1X75C 4LDWA 1XTDA 2YXYA 2DMOA 4KGXB 2FPEA 3SWNB 1YITT 1JBMA 3C04A 3EH1A 1QNCA 4PJOE 1NJIC 2JM8A 1VOKA 2EQUA 3OYKA 2LNVA 5GMKj 2DK3A 2KT1A 4QKUA 1V5SA 4PJLA 1LWVA 3OYMA 1PNJA 3CCSQ 3M0PA 2JMAA 2BZXA 4PL6A 2P0QA 3C4SA 4CC4B 4II1A 2FL7A 3L2QA 3A8HB 4O6JA 1EIFA 6AT1B 3URGA 1M1KC 3CC4A 1Q9UA 2MOXA 1Q86C 3HS9A 2DXCA 2FPDA 3G71A 3A98A 3VYGA 2XHIA 2YLBA 5C0MA 1G2BA 3M9QA 3FC3A 3TQ7P 1K9MC 1OZ2A 2HEQA 3M57A 4UC4A 2QA4T 2QDYB 3AHUA 1U8RA 2A28A 3M0RA 1PC0A 1T0HA 1KQSA 2G6FX 3RMSA 4RKUE 1EFNA 3OW2A 5J3BA 4YTLA 1R8OB 1KYFA 3ASKA 3QYHB 5GMKe 3DPTA 3OYEA 4BY6B 2KDSA 1D3UA 2XI9A 2LAEA 4JRIA 2CZ1B 1ABOA 3JCMh 2RHUA 2L3QA 4LDVA 4RUGA 2FYKA 2HL8A 1JRIA 1QVGA 4ROEB 3CC7A 2J6KA 4PJOB 3LH5A 1TU0B 2DZCA 4WZSD 4AFZC 1QNBA 5CKFA 3I35A 2JS0A 5GAOq 2K9GA 1SRMA 1KYUA 2PVGB 2K6DA 3DPUA 3CMEA 2HL5C 4ELZC 2KYMA 3G71T 3PVQA 4QQGA 2OTJQ 1NM7A 5EC7A 1G3SA 5ECAA 2KR3A 2YUQA 1YJ9A 2FHDA 5CQYA 3CCVT 2QRCA 2QA4Q 2A08A 1W80A 4D7QA 2E41A 1SSHA 2KRMA 4A4EA 2DTHA 5GAOl 3OSMA 2MF2A 1O75A 1OPLA 3L2WA 1QN4A 4JS5A 2GNCA 1M9SA 2VXFA 3M58A 4IUUA 2VXEA 2LCCA 3GOXA 3M4GA 1XJWB 4ESRA 3A8GB 5D6WA 3OB9A 3QBYA 4FCYA 3F70A 2V92A 1BIAA 4XTZA 4KBMB 2DX1A 1KO9A 1WXUA 1ZSZA 2LRQA 3BE3A 1VQPA 3VRZA 1BU1A 3HKSA 3ME9A 4EJZA 2BZYA 5KYWA 5KCOA 2QRDA 4L6V5 2OTLA 2JPIA 4X34A 4FSSA 4DBHA 1WQWA 2EQMA 4DA4A 3CC4Q 3CC7T 1MNEA 1AWWA 4RMOA 5HSHA 1H8KA 3QYGB 4QQDA 1GBRA 1NEBA 3FIFA 2XG8D 5J39A 1YJNA 1VQ6Q 4M75B 3D7SB 2OX7A 3CMET 1NG2A 2DF6A 5LJ3j 5GAN3 3H41A 3CXCS 2VGNA 4PJOG 4LN2A 4LUEA 3X25B 1YJ9T 4PNOA 5A0DA 3LW5E 4OGEA 3ENCA 2BIVA 1D1AA 3JCMX 1VYUA 2ATCB 3UWNA 2EYQA 2COYA 1M27C 3PMIA 3EAEA 2GGRA 2A0FB 2J05A 2DILA 3OS1A 2F5TX 1QNEA 2RPNA 4QVZA 2COWA 5D6YA 3M0UA 1WFWA 4R55A 3VUZA 4JUVA 1ZUKA 4IUQA 1K9AA 1VQNQ 3KTUA 2CH4W 5LJ5h 1HSQA 2ZPFB 1ZSZC 1AT1B 5IHKA 3G7ZA 2CZ0B 2LZ6B 4PJJA 2OTLT 3S6WA 4JLGA 3E1SA 2D0NA 2XDPA 4E7IA 1KC8R 2HQEA 5FU7B 2YUNA 3CMEQ 2LTOA 4C8QD 1I1JA 3H8ZA 1G3TA 2O9VA 2E65A 2DRMA 2NOIA 1HU0A 2O31A 3N89A 1C4GA 3SNSA 4HCBA 2MPXC 1YJNT 2DD5A 5LJ3e 1D0YA 3RIRA 5GMKl 4IUTA 4BJUA 1H3ZA 3JCMg 2JXBA 1J3MA 1M3BA 4C8QE 2X4JA 4TVRA 2NWVA 1YI2T 3BY7A 2EIFA 2RO0A 2DO3A 4NL3A 1YIJA 3I5RA 2KNBB 3G1JA 1TOVA 2YRDA 4XTVA 4PJOF 2CKKA 1AWXA 2H3EB 1WJRA 1UJ0A 1UHFA 2ROTA 2CS7A 3DB3A 1WNLA 2R57A 4M75G 1FMVA 2LMJA 2Y8QA 1K0XA 2EBPA 2C0OA 5DLOA 5GAMh 3EG9A 2E3HA 1K2YX 1IO6A 2XKOC 1VQPQ 1NEGA 4J8OA 3EFOA 1X2QA 5CQXA 4FW1A 5GAOn 1TUGB 1J3TA 1ZSGA 2YWWA 2M1HA 1G5VA 3CCJA 4A4KA 4HKEA 2FG0A 2COZA 4J9IA 1Z9ZA 2DKAA 1CKAA 3EHQA 2L5QA 1RI0A 1O9SA 4IURA 2RHYA 2Z8UA 4J9CA 5IH2A 2LJ1A 3OBYA 4IL8A 1WA7A 1PRMC 3FJ5A 1T6AA 3OS2A 5CKDA 4X9CA 1V1CA 2LT1A 3JCMJ 2V8KA 4F16A 2C0TA 2JOIA 2YHTA 2K5IA 3E9GA 3TEEA 3FB9A 1OI1A 3MEAA 1QCNA 1AZGB 4N0AA 2EJGA 3VJPA 4IIOA 2ZPGB 1Y0MA 2JTEA 2ZAEA 1KFQA 1RM1A 1YIJT 3EGDA 1PWTA 5DY9A 3CCRQ 4V2SA 4ZTJA 5GAOp 1W6XA 2H3JA 3ULRB 3OBWA 3D4VA 1KC8C 3NTKA 2DL3A 1VQ8Q 3JCMe 4HT8A 4M75F 4MZTA 5KE2A 2ZFDB 2LC4A 2JMCA 2K79A 4J9BA 2IG0A 5FWBA 3QWYA 4ZN3A 1UECA 3JCMV 2V8IA 2DEUA 2O4XA 4D8DA 1UUEA 2CH4A 4BI3A 1RLPC 2EWNA 2NOFA 3CCJT 2DKGA 2MJ7A 2OOYA 1PCZA 3HL8A 2HAXA 1PKSA 2Z0FA 4HJHA 5CCAA 2MWOA 2DPPB 2F2XA 2QK0A 4CC3A 2RF0A 3REAB 2NWMA 4KUIA 3OA6A 3LWHA 3S3MA 4OMFB 3L2UA 5FWCA 3KXTA 1HJDA 3P8DA 2ESWA 3PDKA 4XU0A 4JLIA 3G4SA 3CCMQ 3FLGA 3CPWA 2YA3A 2JZ2A 3H0FA 2YRVA 3OYLA 4PY5A 3QHSA 2EYZA 3I5SA 5LJ5g 1W70A 3ENOC 1EX4A 4MMKA 1VQKQ 3EG1A 2A3LA 3OYFA 4FYWB 3CW7A 4N0AC 2XIDA 3G6EA 3S3NA 4M7AF 1TSFA 1GCQA 4F7UA 1ZLMA 1Y07A 3VS7A 4F14A 3SB2A 1IGUA 4BDYA 1KQSP 3ASMA 2RHXA 4XTXA 4WTOB 4WX8A 1TH7A 2EW3A 3BW1A 4DQ2A 2D9TA 2EQJA 1UB4A 3OW2P 2XHCA 4XU1A 4Z88A 1WYXA 1BK2A 1YN8A 1VYVA 4PKCC 4OVAA 1OQKA 3OCIA 2HD0A 1ZUYA 3MP1A 1YTFA 1RAIB 3JCMf 4M7AA 1GXIE 4N4IA 5GJVB 3CCSA 2M0OA 2CP5A 5A2QE 2MK5A 1QVGP 2CGHA 3TU4K 3L2VA 1D1CA 1X2KA 5GAMg 1N8RU 1WX6A 2YRCA 2LDMA 3IQLA 2OI3A 1X6GA 5CVIA 1VIFA 1OEBA 3G4ST 4Y92A 4FW2A 1W4SA 3E9FA 1I07A 3RBBB 3SD4A 4RTTA 1ZA2B 8ATCB 5KH6A 1WHHA 2DAQA 2X4WA 4AFUC 4J83A 4LDUA 2HKNA 3I9QA 2XMFA 1YBYA 3G6ET 1Q7YR 2JN0A 4HXJA 1GCQC 3MCAB 2K5FA 2EPDA 4DBQA 5GAN5 4QG5A 4PK4A 5KCHA 4M7DF 1WHGA 5GANh 2RQRA 3OYJA 4OF1A 2F5KA 2FO0A 4BI8B 4KH1B 2M02A 2K57A 2KRNA 3JB9J 3OYDA 5LJ5e 1WJSA 1R4XA 1BI0A 5KYYA 1ZSZB 2L3PA 3TDHA 3JRZA 3H0HA 3JCMd 4OMMA 1SSFA 4RG2A 4ZN1A 3KBGA 1UEBA 4WXAA 1WXTA 1PD0A 1VIEA 1Q81R 3NFCA 2HBPA 2IVWA 1PG5B 3FRNA 2KAFA 4N4HA 1KY6A 4E7HA 2RQTA 2C0IA 3E2UA 4A63B 2ECZA 2AHJB 4M7AC 1M1FA 3CCST 3RNJA 1U1SA 2DYIA 1VUBA 3UDCA 4M7DA 1I0CA 3J7AF 1WHLA 3VS5A 3SEMA 1K35A 1QN6A 2V26A 1PM3A 4JZ3A 3UA6A 5FROA 1NVPA 2EFIA 1NGMA 5AYFA 1VQ4Q 4IUVA 3PMGA 2VB6A 4CC2A 1Y7XA 5AN4A 1E6GA 2MI6A 2QQAA 1X69A 3G6EQ 1LCKA 3CMAA 4ROCB 1CKBA 2M0YA 2M9UA 4LD9K 3A8LB 1Y71A 2M16A 1SKUB 2VC8A 4EPCA 1K73U 1MMDA 1AOJA 2E6NA 1HK9A 1M2OA 5CKBA 5I2MA 2HMAA 3OSVA 5GAN8 1QKXA 1WHMA 3JCMP 1CSKA 1TGHA 1N3CA 5IAYA 4J9DA 4RTZA 3OYCA 4MZPA 3I55A 1UFFA 1LWYA 2QXFA 2KE9A 2FB7A 2AK5A 4M77A 4FT4A 1WJWA 1W2BS 2LCSA 1UTIA 5LJ5f 2YUOA 4OMOA 4E6RA 1TS9A 5GAN4 1K0SA 2VWFA 5I21A 2DIQA 1BIBA 2JTMA 3V8JA 1PCXA 2GF7A 4BUGA 3VYHB 1MV3A 2ZPBB 2DRKA 4DBRA 4M7DC 1Q7YC 1GFCA 3H0IA 1VYTA 1Z9QA 1S72A 2XDBA 1RACB 2NUPA 1VQ6A 4DOVA 5GAN7 1VOMA 4QVCA 2MMPA 1AEYA 3HFNA 4LNPA 1G83A 2OTJT 1VTOA 5CKEA 2DL7A 4A4HA 2P0KA 3H1ZA 3TSZA 1P5GX 1AD5A 2RQUA 1W1FA 2QGGA 3LWIA 5GMKm 1Q81C 4EALA 3GNGA 2W10A 3VU3C 3EIKA 2HDAA 1B34A 3I56Q 4EMHA 4JS4A 2LCLA 3CVTA 4OGCA 2CSIA 4M75D 5GJWB 3EFOB 5GAMf 2DXTA 3REBB 3JB9I 5LJ5d 2HKPA 1DJ7B 2KI7A 1OULA 5M9OA 3JCMb 2RHIA 2VV5A 5FLXE 4ZGJB 1VQNA 4HVVA 1K4US 5L23A 4M75E 4M77C 1VQMQ 1NPPA 1IB8A 2NUZA 2FUVA 3RSMA 1TTHB 3OMGA 3GP8A 1UT4A 3H6ZA 2F2VA 5KYXA 1V29B 5GANg 1QN8A 1JJ2S 3RKWA 3CC4T 4HCCA 4M4ZA 2NVMA 2OAUA 1UJYA 3OW2S 4F17A 2QEXA 3MP8A 3CMAQ 2FEIA 2JOYA 3A5ZB 2G30A 1PKTA 3TREA 1YJWA 4KUDK 2DKCA 3KRMA 1IHVA 3META 4MDXA 1VQ6T 1MV0B 1C0MA 4XAXB 3ZBDA 4M7AD 2RI3A 1D1BA 1QVGS 2DVEA 2O2OA 4MRQA 2RN8A 2J6OA 5GAMd 3OYIA 4M7AE 2CSQA 3C12A 4JJCA 1VQ5A 2HQHA 4QVDA 3I55Q 1MMGA 1QWFA 2F2WA 3CC2Q 1K8AR 1HD3A 3JV3A 8AT1B 1KD1U 3X28B 4C0DC 3HRTA 4HCKA 2GQIA 2O4XB 4EJYA 4EMGA 1C9BB 4PFPA 2AKKA 3BFMA 4HA8A 1VKLA 2JHNA 3PTAA 4E7SA 1VQNT 2R5XA 1QVFS 4C5EA 2LQWA 2V9JA 3EG2A 2QG9B 2A7YA 2K5LA 3CXCA 2VVKA 3CVSA 2HL9A 3ER0A 1S72Q 4Y91A 4ZGDB 4Z02A 1JFIC 4ZNXA 1I81A 1XSZA 3VS6A 1X43A 2RA2A 2XD0A 1NJIU 4QW2A 3VS3A 3CPWP 2KK4A 2WSEE 5GMKi 2RHZA 2Z0WA 3CQTA 1TUDA 2PQWA 4F7UB 3VKIA 2XDDA 1E7OA 4M7DD 2B86A 5GAN2 3J81E 2CP0A 1R77A 4NOYA 3CCRA 2RK2A 4FL6A 4PFOA 2IIMA 1P5DX 1TBPA 3R6OA 3OY9A 2E4HA 2EJ9A 4MDWA 5I11A 1M1KU 1VQ5T 4M7DE 1AISA 1Q86U 2X3WD 1M2VA 2QDLA 2IV9A 2GTJA 1VQ8A 1B9KA 1RADB 1VQLQ 1VQPT 1KIKA 2PZ1A 1VQ7A 5D7UA 4M7AB 2MZ8A 4KGZB 4OB1B 1LNXA 1JU5C 2X35A 1D0ZA 3KUFA 1SRLA 1RAAB 2R5MA 5FU6C 4RTXA 2QEXQ 3OS0A 1QP2A 1YJWQ 4LDXA 2KY9A 1QTPA 1KJWA 1TUOA 2BE7D 1SG5A 1E6HA 2AKLA 5IN1A 4JDSA 3CCMA 2BUDA 1K1ZA 4AT1B 1C1AA 4OMQA 1K8AC 1AVZC 2PVOB 1QVPA 3UPUA 1NE8A 1VQKA 3RKXA 3GLXA 2BE9B 2ENMA 2DEQA 4NS5A 3OYGA 3OGDA 2BTTA 3OSSC 4E7JA 3CCLQ 1VQ5Q 3SHWA 1ZX6A 4AG2C 2DKDA 1WI7A 2EAYA 1JB0E 4J6WA 3MKDA 1QTSA 3CBOA 5DM7R 4EMKA 1B7TA 1AWOA 3CCRT 2VJ0A 2DLPA 5GANf 5KYYB 3NTHA 3RESA 1N3AA 1TUCA 1KHCA 4JRQA 3A8MB 1I5LA 2KXDA 2FKMX 1Y96B 2NLUA 2EGAA 4F7UG 1WHJA 4P5NA 3TVTA 1GFDA 1VQ8T 2FPFA 2I5WA 4E2FB 2FVUA 2RK1A 2L89A 3ZL7C 2KMTA 2PTKA 2MWPA 4XU2A 1PCJX 1LOJA 4IUPA 4FYXB 2E12A 4M7DB 2JUFA 1M3HA 1M5Q1 2F1LA 5IT9E 2F69A 4ANJA 7AT1B 2JS2A 4RCCA 3EGUA 4CRIA 1WDXA 1SPKA 5KL0A 4GBQA 3CD6A 2IPOB 2DL8A 2K3XA 4M7AG 4PJMA 3SDZA 3M0SA 4J6YA 3QDFA 3OSEA 3CCMT 3PVLA 2EGCA 3ULXA 3HFOA 5HK3A 1WJQA 1KG1A 3T4NA 1ZBJA 5IHNA 5A0LA 3VUBA 2ZPHB 2G3RA 1VQKT 1NYFA 5FRNA 3X24B 5GANd 3QXEB 3MPUB 3JB9F 4IIMA 1B3QA 1WXBA 2K2VA 5IHIA 4EMKC 2XU8A 2PU9B 1VQ7Q 4MZMA 2Y4XA 1D3BA 1D0XA 5CR2A 4JPBW 4HCZA 5HCKA 3I3WA 2DJZA 3UT1A 4PLIA 3QSUA 2K4YA 2K2MA 1T3SA 2FGTA 1RAEB 4A4FA 4F7UF 4AMCA 3CCQA 1MP9A 2QI2A 3HS8A 3CWAA 2GQVA 2NYSA 5L8RE 3RPJA 2KRSA 4OP0A 1NZ9A 2EYXA 3CCEA 3PE0A 4J9EA 2NUPB 3PMTA 2DM1A 1VQ4A 1F1BB 2RMOA 2XICA 2I0NA 4B9WA 1XQHA 4M7DG 2F7LA 2L3RA 2L3SA 3EGXA 1KFZA 1QN5A 3MEWA 2DA9A 4WF2A 2VYTA 3VS4A 4A53A 3T9NA 3P8HA 1MUZA 3OH6A 1B34B 2E10A 1G8XA 4BDZA 2CDTA 1M90U 1VTLE 4C0DB 3BKQX 3OS5A 5LJ5j 4QQ6A 4LXCA 1KD1R 4D7RA 1LWWA 2E1HA 3UF4A 5I2SA 2MYSA 4EAIA 2JT4A 1YCSB 1RUWA 4C92F 2RM4A 3HPWA 4PLLA 3NMZC 2ZGWA 4M78A 2E64A 4OB3B 4OB0B 1AHJB 4BACA 4EAJA 2QREA 1QNAA 5KYXB 3C0CA 2LJ0A 4C0ZA 4R56A 1FX7A 3WVEB 3CD6Q 1FMWA 2OAWA 1MMAA 2OJ2A 3OSTA 1VQ9Q 4M77G 3QZ5B 3JB9H 2LQKA 2DE0X 3CCET 1GCPA 2NOBA 4BE2A 3OYHA 2PUKB 3OMCA 4MMLA 3EFSA 4C92A 1M8VA 1VQ4T 1RAHB 3LH0A 3RMQA 1NLPC 1U06A 1VQOA 3TSWA 3KFVA 4QT7A 2EVRA 3WXMB 1EZZB 1PSFA 2WSFE 5GAMj 1UGVA 2EYWA 3M0TA 3QWXX 2NOLA 4JJNK 4TPSA 1B07A 2EKHA 2QQ9A 3HP9A 2KQWA 4KT0E 1JO8A 4VUBA 1TBAB 3I56A 1M1KR 2X51A 1FN7A 5KYWB 1R0CB 2AT1B 2ED1A 4RTYA 5EPCA 5DLQE 2DD4A 3QJ6A 1X6BA 3CCQQ 3X20B 1Q95G 4BB7A 1UHCA 1P92A 1MGQA 1YQLA 2WACA 5A0GA 5FU6B 1GRIA 1ZA1B 1N9SA 4M78C 1VQMA 2YLCA 3GBQA 3CCEQ 3LGLA 4FM4B 3HHTB 2KBTA 3R6NA 2CUBA 4X1VA 3QUIA 4E7LA 2LX9A 3ZEHA 2H5AX 3CXCP 2A36A 2OOXA 1S1NA 2DVJA 1KC8U 4M77F 4AG1C 3QZ9B 1K76A 4C0FA 1KD1C 2J06A 3I0WA 2DBMA 4C92C 3PT9A 1JXMA 2YUPA 3PIOA 5JN5A 5GAMe 4E7KA 4E47A 3OH9A 3NPFA 2LQNA 4D8KA 1BB9A 2QQBA 3CEYA 1W2BA 1H3HA 1CDWA 2CYZB 2JNGA 2EQIA 4J9FA 2EYYA 2GFUA 1M4ZA 1M3QA 1M2VB 2QLVA 4ME7A 9ATCB 3I56T 3CC2A 4FYYB 2QR1A 1GBQA 2CREA 2DTOA 1YNZA 1UDLA 4ORZA 1U5SA 4B9XA 2DFUA 2FZGB 4C8QA 3MHXA 1T3LA 3M53A 1U3OA 2P4RA 3HTRA 1QN7A 3MO8A 3PFSA 5I22A 1VQMT 3C94A 1YWPA 4LUDA 4EIKA 2QASA 5AT1B 3M0QA 5KYUA 4HVUA 1PD1A 3QG1A 3INZA 2X3XD 2R5AA 2SEMA 3DLMA 2D8HA 1N9RA 3M5AA 1VQOQ 1N39A 2GCXA 1QLYA 3UA7A 3CMAT 2AZVA 1UGQB 2GTOA 3O5ZA 4Q5WA 5HY6A 3JB9D 3CCVA 2P0PA 1C47A 4BI4A 1RABB 2CP3A 1OYXA 2D0BA 5KYNA 2R58A 4EMKB 3EG9B 2PVDB 1BKBA 1ZQ1A 1YITQ 3JCMW 2YT6A 3L1AA 2JW4A 3ZFJA 2QAZA 4JJDA 1PRLC 4HVWA 3EAYA 2RQWA 3I55T 3CC2T 1JJ2A 1KHIA 1HXDA 1G3WA 2PWWA 2V8QA 1VQLA 3MEUA 2HZMA 4LE9A 1WPYA 4C8QC 2DERA 4Q11A 2DXBA 2NUTA 1IZ6A 2Y4YA 1KQSS 4C5HA 1JQQA 2LJ3A 4F7UE 1GL5A 1FYNA 3V8LA 3EHRA 4RG8A 2KEAA 1N6AA 2NOEA 4R0KA 2ZCFB 3UATA 1XNIA 4L59A 1YCYA 3GPLA 1S72T 1YFNA 1LVKA 2YSQA 1VA7A 3N5BB 2VASA 4M78D 5J26A 1FXXA 2RB6A 1Q82U 2X4YA 3EGDB 1UL7A 3V7RA 2RJEA 3RUXA 5GANj 3I0XA 2K7AA 1M90R 4M78E 3CCLA 3VS1A 1OU9A 4C0GA 3VS0A 4BD3A 5CIUA 1QVFA 4XTYA 2RJCA 1U1TA 2QYZA 1D3BB 3MP6A 3F0ZA 2QGFB 3CBPA 1PZDA 2FRWA 2ROLA 4C92D 4LDYA 3RERA 2HL3A 2P84A 5GAOr 2HZSA 3H9NA 3M54A 3EG0A 2FRYA 1NYGA 4RTWA 1G3YA 1FMKA 1QWEA 2JTFA 3NHNA 4N4GA 3BDLA 2ED0A 1MMNA 1VQLT 2EHBD 2QQSA 2YH5A 5FRMA 5IYDP 3EFRA 4C92E 2KXCA 1N8RR 3DLLA 4OMLA 5LJ3g 4B0AA 5KE3A 1I5OB 1LPLA 1YP5A 1ZUUA 1BI1A 3JCMc 1AWJA 1N27A 2NOZA 3LLRA 1WIEA 5HK0A 2X9HA 1H92A 1IHWA 4JZ4A 2QEXT 3G71Q 5CK9A 2HSEB 1YJWT 4KH0B 2EGEA 3OYNA 3QPHA 1RLQC 3NGPA 2HBWA 4AFSC 1WQAA 3CCVQ 2NLVA 3EGXB 4OMNA 2O3OA 1BBZA 4E7ZA 4A54A 5GANe 4PFZA 4EDUA 1WQ7A 2LP5A 1BCMA 1YI2A 2QTXA 3F10A 1OU8A 4EAGA 3CCUA 3CCLT 1TXQA 1QCFA 4DULA 2LQ8A 2E6ZA 2V1QA 2WSCE 2D6FA 1EBMA 1Q7YU 2Y8LA 4RTVA 2H8HA 2EJFA 3SWNA 1WZOA 1KFIA 1VOLB 3A8OB 4M78B 5GAN6 4FYVB 1KK7A 2FZKB 5EG2A 2B8AA 4CFFA 1SF9A 3QKJA 3M4YA 1PHTA 1K9MU 4AFQC 2HCKA 3CC7Q 4FT2A 5C6SA 5LL6S 3E19A 2DYBA 2BZ8A 4ZTFA 1Q81U 2H4LX 2AZSA 2RD1A 3GNFB 5D6XA 3HRSA 1I4K1 2MIOA 1M90C 4M77D 1JXOA 5CAIA 3GIBA 1M3AA 1NH2A 1SHGA 3LX7A 3HSBA 4PJNA 4C92B 3FDRA 4JJBA 3JB9G 2QTVA 2DZ9A 4J9HA 2HSPA 2D0AA 1YJ9Q 1DIZA 2KSSA 4M77E 3PIPA 1K73R 1YQRA 2DJQA 1OV3A 2KROA 1ARKA 2DL5A 3DB4A 1KQ1A 3OYAA 1IXDA 4KRTA 2DXUA 3C95A 2ABLA 2O88A 1M30A 4BE0A 1N8RC 2D0CA 4OMPA 3CCUT 3OC3C 4DEXA 4KULA 5IXBA 2RI2A 1RI9A 3CPFA 3O8VA 3QIIA 2JVVA 2EQKA 4RTUA 1PVSA 1BI2A 1VQ7T 5BMPA 1QN9A 3VRYA 2FZCB 2CUDA 3SWNC 4GLKA 2OTLQ 3NTIA 4Z89A 2LX7A 2FKFA 2YDLA 3PGGA 2J6FA 5FW9A 4FSXA 4ELYC 2A37A 3NA5A 4I8OA 3GF5A 4RCBA 4PJOA 4XU3A 2E5QA 2RQVA 3BDUA 2O9SA 1VQ9A 2K3YA 3TCJA 4M78G 2RJFA 3CWSA 1YQKA 3MEVA 1YJNQ 4XK8E 4GLMA 1YHQA 1QMCA 4OB2B 1QN3A 1YI2Q 1UGRB 2DL4A 1PSEA 4B6MA 3J80E 3OYBA 4J7FA 2RNAA 3CCUQ 2PUOB 4DBFA 1WLPB 4CC7A 1T0JA 1V76A 3THKA 1ACMB 2NOHA 5HKCA 3JCMQ 4C92G 1AZEA 1OPKA 5LJ3f 4C7PA 1W2BP 2CZ6B 4XQ3A 4J9GA 1M8MA 4M77B 1BYMA 3A1PA 5F9CA 5IXFA 2QQRA 3CBMA 4C8QB 2W0ZA 1QCOA 3LYIA 1NLOC 3QO3A 3M56A 1OX9A 1HYOA 2SRCA 2HNIA 4K11A 4L5GA 1QP3A 2DBKA 2GFAA 2J7IA 2KVQG 1UE9A 2E3IA 1MPGA 2VKNA 5GMKh 4BY6C 1XOVA 1K73C 2C06A 1LXTA 1E42A 1IREB 4XTWA 5KYUB 3S3OA 2V8JA 3AT1B 1WGSA 1X27A 4C5IA 5CO7A 1KQ2A 3CD6T 1KSWA 3DKMA 4PJOC 1X01A 2D0QB 1VQ9T 1ZBXA 4XTUA 1PCMX 1UGPB 1Q82R 1YHQT 4M78F 1FWZA 2AIRB 4BE1A 1M3CA 4M75A 2RJDA 4J7IA 4DOWA 4Z8AA 2D8JA 3L2RA 4ATOA 1H641 1OOTA 5LJ3d 1YIJQ 3V7SA 2VUBA 1UT7A 4WCIA 3SFMA 3FJPA 2HQXA 1QQJA 3IH7A 2JHJA 1N5ZA 2IV8A 3CPWS 3WVDB 1RAFB 3OLPA 1YWOA 1YQMA 1JDYA 3QJYA 2P4TA 2I2LA 2JJ9A 3M59A 3CWTA 3D7QA 2Y90A 2ZPIB 1QKWA 4JRKA 1MNDA 2L0AA 1Y57A 1X6OA 3CWUA 3VN5A 2DETA 5JMVD 1OX8A 4CI0C 1JJ2P 2E70A 1ZHIA 4GY5A 3CCJQ 1K8AU 2KYBA 2LVMA 2NUTB 3TE5A 2LT4A 3CCQT 1RAGB 2PNIA 2RI5A 1IRXA 1EUVA 1WHKA 3EG3A 3MJXA 4HT9A 3LGFA 1YHQQ 1NJIR 4C8QG 3OYYA 2RH2A 3U23A 2L2PA 1LJOA 1UGSB 1ABQA 3UW2A 1D09B 1I8FA 2CP2A 2XK0A 4LD6A 4M75C 4JRPA 4O5VA 4KGVB 4IKFA 1RL2A 2CT4A 4C5GA 1Q86R 3M55A 4FIBA 3V8KA 2KT8A 1YITA 1MHNA 4RODB 1M1GA 2D1XA 1QVFP 1YTBA 1NPRA 4ZGEB 1KYDA 4NL2A 3RDVA 4J5YA 4DEYA 4FU6A 5GAOm 1IGQA 3Q1JA 2BKDN 1UG1A 1K9MR 1BI3A 3HRUA 1Q82C 5CKHA 1Y96A 4D6WA 3EH2A 3X26B 1A0NB 1TG0A 2L8DA 1NBEB 3VS2A 2JM9A 1BCOA 2KGTA 3P8BB 2DNUA 1C6VX 3OQ5A 2X4XA 2LNHB 1KY7A 3JAME 4EAKA 3JSCA 1QW1A 2V1RA 3RR6A 3G4SQ 2E5KA 2DTIA
chains in the Genus database with same CATH topology
3G4SA 2EKOA 3FLGA 5IN1A 3CPWA 5FU7C 2JZ2A 4JDSA 3RKYA 3CCMA 2BUDA 2YRVA 3FEOA 3OYLA 2VGMA 4C8QF 3L2ZA 3QHSA 4M78D 1OZ3A 5LJ5g 1K8AC 5J26A 2DIGA 1FXXA 4Y28E 1VQOT 2ZZDA 2RB6A 4A4GA 1Q82U 2X4YA 2CZ7B 2PVOB 1QVPA 4MMKA 3V7RA 4J6XA 4X9DA 2RJEA 3RUXA 1NE8A 3UPUA 5GANj 3L42A 2A3LA 3GLXA 3RKXA 1VQKA 2OTJA 3OYFA 2DEQA 4NS5A 4N0AC 5LJ3h 3OYGA 2XIDA 3G6EA 3S3NA 4M7AF 3OSSC 4E7JA 3QDRB 4F7UA 4M78E 2ZPEB 2QA4A 4PJOD 3CCLA 2EAYA 1JB0E 1Y07A 4J6WA 3V7CA 3VV0A 2O01E 3PNWC 3SB2A 3CBOA 4C0GA 5DM7R 2MAMA 4BD3A 4EMKA 5CIUA 1QVFA 4XTYA 2RJCA 1X75C 1U1TA 4LDWA 1XTDA 3CCRT 5GANf 1D3BB 3MP6A 3NTHA 3RESA 3CBPA 3SWNB 1YITT 1JBMA 4BDYA 4C92D 1KHCA 4LDYA 3RERA 4JRQA 3A8MB 1I5LA 2RHXA 4XTXA 4PJOE 1NJIC 1TH7A 1Y96B 2EQUA 3BW1A 5GAOr 4DQ2A 2NLUA 3M54A 4F7UG 2D9TA 2EQJA 1UB4A 4P5NA 3OYKA 1G3YA 2LNVA 2XHCA 4XU1A 5GMKj 1VQ8T 2JTFA 2DK3A 4N4GA 4PKCC 4OVAA 2FVUA 2RK1A 3BDLA 1VQLT 2L89A 2HD0A 2QQSA 5FRMA 3MP1A 3EFRA 4C92E 3OYMA 2KMTA 2MWPA 3JCMf 4XU2A 4M7AA 1GXIE 4N4IA 1LOJA 4IUPA 3CCSA 2M0OA 4PL6A 3DLLA 2E12A 5LJ3g 4M7DB 2JUFA 5KE3A 5A2QE 1M5Q1 1BI1A 2P0QA 3C4SA 5IT9E 4II1A 2F69A 2FL7A 3JCMc 2CGHA 3L2QA 3A8HB 1N27A 4O6JA 4RCCA 3TU4K 3LLRA 5HK0A 3L2VA 4CRIA 1EIFA 5GAMg 1N8RU 3URGA 1M1KC 2LDMA 2QEXT 3CC4A 3CD6A 1Q86C 2DXCA 5CK9A 3G71A 2K3XA 1YJWT 3OYNA 4M7AG 3QPHA 5CVIA 3SDZA 4J6YA 1VIFA 3G4ST 3SD4A 1W4SA 3E9FA 3CCMT 3VYGA 2YLBA 5C0MA 4A54A 5GANe 3HFOA 5HK3A 1WJQA 4EDUA 1WQ7A 1KG1A 5A0LA 3VUBA 5KH6A 2ZPHB 2DAQA 2X4WA 2G3RA 1YI2A 2QTXA 4J83A 3M9QA 4LDUA 1VQKT 5FRNA 3X24B 5GANd 3QXEB 3FC3A 1K9MC 3JB9F 1OZ2A 1YBYA 3G6ET 3M57A 2JN0A 3CCUA 3MCAB 5GAN5 2K5FA 4UC4A 3CCLT 2QDYB 2QA4T 3AHUA 5KCHA 2K2VA 1U8RA 5GANh 3OYJA 4M7DF 4OF1A 2F5KA 1KQSA 4EMKC 2LQ8A 2E6ZA 4BI8B 2WSCE 2XU8A 2D6FA 2PU9B 2K57A 3RMSA 3JB9J 1Q7YU 3OYDA 5LJ5e 1WJSA 4MZMA 2Y4XA 4RKUE 1BI0A 1D3BA 5J3BA 5CR2A 2EJFA 3OW2A 4YTLA 1R8OB 3SWNA 3JRZA 4HCZA 3ASKA 3A8OB 3JCMd 3QYHB 2DJZA 4M78B 5GAN6 5GMKe 3UT1A 5EG2A 3OYEA 2B8AA 4BY6B 1SSFA 2KDSA 4PLIA 4RG2A 2K4YA 1UEBA 3KBGA 4ZN1A 3QSUA 2XI9A 4JRIA 1VIEA 2CZ1B 3NFCA 2HBPA 4A4FA 3JCMh 2RHUA 2IVWA 3FRNA 3QKJA 2KAFA 4N4HA 4F7UF 3M4YA 4LDVA 3CCQA 1K9MU 2FYKA 4E7HA 1JRIA 2QI2A 1QVGA 4FT2A 3CC7A 2GQVA 5C6SA 5LL6S 2AHJB 4M7AC 5L8RE 4PJOB 1M1FA 3E19A 3CCST 1U1SA 1Q81U 4ZTFA 2DZCA 1VUBA 3UDCA 4M7DA 2RD1A 3GNFB 4OP0A 1NZ9A 5D6XA 3HRSA 1I4K1 3CCEA 1M90C 3J7AF 5CKFA 4M77D 5CAIA 3GIBA 5GAOq 3LX7A 5FROA 3PMTA 3HSBA 4C92B 2EFIA 3FDRA 5AYFA 2PVGB 3CMEA 4IUVA 4ELZC 3JB9G 1VQ4A 2DZ9A 3G71T 4QQGA 1Y7XA 2XICA 2MI6A 2QQAA 1G3SA 1YJ9A 2KSSA 4M77E 4B9WA 1XQHA 2FHDA 5CQYA 3PIPA 3CMAA 3CCVT 2L3RA 4M7DG 2M9UA 4LD9K 3A8LB 3MEWA 1Y71A 2E41A 4WF2A 2VYTA 4A4EA 2DTHA 4A53A 2M16A 5GAOl 3T9NA 3DB4A 3P8HA 1KQ1A 2MF2A 2VC8A 3OYAA 4EPCA 1B34B 1K73U 2E10A 2E6NA 2DXUA 3C95A 1O75A 3L2WA 4BDZA 1M90U 4JS5A 4BE0A 1M9SA 1HK9A 2VXFA 3M58A 4C0DB 1N8RC 5CKBA 4IUUA 5I2MA 3OSVA 5GAN8 3OS5A 3CCUT 2VXEA 4KULA 5LJ5j 2RI2A 2LCCA 3GOXA 4QQ6A 3JCMP 3M4GA 3A8GB 5IAYA 3CPFA 3O8VA 3QIIA 2JVVA 2E1HA 2EQKA 3OB9A 3F70A 3QBYA 5D6WA 1BI2A 1BIAA 4XTZA 1VQ7T 5I2SA 3OYCA 4MZPA 4KBMB 3I55A 2QXFA 3SWNC 2FB7A 4C92F 4M77A 2LRQA 2RM4A 3HPWA 4FT4A 4PLLA 1VQPA 1W2BS 3HKSA 3ME9A 2ZGWA 4M78A 2E64A 4GLKA 5KCOA 5LJ5f 4OB3B 4OB0B 1AHJB 5GAN4 4BACA 3NTIA 5I21A 4L6V5 2OTLA 2DIQA 4X34A 1BIBA 2JTMA 3V8JA 4C0ZA 1WQWA 2EQMA 2GF7A 4BUGA 3PGGA 4DA4A 3CC7T 4R56A 1FX7A 4FSXA 3WVEB 4ELYC 3VYHB 2ZPBB 3GF5A 4RCBA 4XU3A 4RMOA 4PJOA 2E5QA 4M77G 3QZ5B 3BDUA 3JB9H 1VQ9A 2K3YA 4M7DC 2LQKA 3TCJA 4M78G 1Q7YC 2RJFA 3QYGB 3CCET 4QQDA 3FIFA 3MEVA 2XG8D 4BE2A 4XK8E 3OYHA 5J39A 1S72A 2XDBA 2PUKB 3OMCA 1YJNA 4MMLA 3EFSA 1YHQA 1VQ6A 4DOVA 4M75B 5GAN7 4C92A 3CMET 4OB2B 1M8VA 4QVCA 3LH0A 1VQ4T 5LJ3j 5GAN3 3RMQA 2MMPA 1UGRB 3HFNA 1PSEA 3J80E 3OYBA 2VGNA 4PJOG 3CXCS 1VQOA 5CKEA 2OTJT 3WXMB 3X25B 4J7FA 1YJ9T 4PNOA 1PSFA 2WSFE 5A0DA 4A4HA 2PUOB 3LW5E 4OGEA 5GAMj 2P0KA 2BIVA 3LWIA 5GMKm 3JCMX 1Q81C 4JJNK 3UWNA 5HKCA 2EYQA 2QQ9A 3GNGA 3HP9A 2KQWA 3PMIA 4C92G 3JCMQ 3EAEA 4KT0E 5LJ3f 3VU3C 4VUBA 1B34A 2CZ6B 4XQ3A 4EMHA 4JS4A 3I56A 2LCLA 4M77B 3OS1A 4OGCA 1BYMA 4M75D 2F5TX 4QVZA 5GAMf 5D6YA 2DXTA 3JB9I 5LJ5d 2QQRA 3CBMA 4C8QB 5DLQE 1DJ7B 2DD4A 3QJ6A 4R55A 3VUZA 3LYIA 4JUVA 3QO3A 4IUQA 5M9OA 3M56A 3JCMb 3X20B 2RHIA 2VV5A 5FLXE 4ZGJB 1VQNA 2HNIA 4BB7A 4L5GA 1P92A 5LJ5h 1QP3A 2GFAA 1MGQA 2ZPFB 2KVQG 2WACA 4M75E 4M77C 5A0GA 5FU6B 1NPPA 3G7ZA 1N9SA 4M78C 1VQMA 2CZ0B 5GMKh 4BY6C 2YLCA 1XOVA 3OMGA 3GP8A 1K73C 2C06A 3LGLA 2OTLT 4FM4B 3HHTB 3S6WA 4JLGA 1IREB 3H6ZA 3E1SA 4XTWA 5GANg 1V29B 2XDPA 4E7IA 3S3OA 3QUIA 1JJ2S 2HQEA 2V8JA 2LX9A 5FU7B 3ZEHA 4E7LA 3RKWA 1WGSA 3CC4T 4C5IA 5CO7A 2LTOA 4HCCA 1KQ2A 3CD6T 4C8QD 3DKMA 2OAUA 3H8ZA 3OW2S 4PJOC 1G3TA 1X01A 2D0QB 1VQ9T 1ZBXA 2E65A 4XTUA 3MP8A 2QEXA 3A5ZB 2JOYA 1KC8U 4M77F 3TREA 1UGPB 1YJWA 4HCBA 4KUDK 3QZ9B 1YJNT 2DD5A 4C0FA 3META 5LJ3e 4M78F 1YHQT 1KD1C 3RIRA 1FWZA 4MDXA 5GMKl 4BE1A 1VQ6T 4IUTA 1H3ZA 4XAXB 3JCMg 4C92C 3ZBDA 4M7AD 4M75A 4C8QE 2RJDA 4J7IA 2X4JA 2RI3A 3PT9A 4DOWA 4TVRA 4ATOA 3PIOA 3L2RA 1YI2T 1H641 2DVEA 2EIFA 3BY7A 5GAMe 1QVGS 5LJ3d 2RO0A 4E7KA 2DO3A 3V7SA 4E47A 2VUBA 4NL3A 1YIJA 3SFMA 3FJPA 2HQXA 2QQBA 3CEYA 4XTVA 2CKKA 4PJOF 1W2BA 1WJRA 5GAMd 3OYIA 3CPWS 2CYZB 4M7AE 3WVDB 2JNGA 3C12A 2CS7A 3DB3A 2R57A 1WNLA 2GFUA 2P4TA 1M4ZA 2I2LA 3M59A 3QJYA 4M75G 4QVDA 1VQ5A 4ME7A 5DLOA 5GAMh 2Y90A 3I56T 2ZPIB 3CC2A 4JRKA 2XKOC 1KD1U 3X28B 4C0DC 1X6OA 4J8OA 2DTOA 3HRTA 5CQXA 2O4XB 5GAOn 4CI0C 4B9XA 2E70A 4EMGA 1ZHIA 2M1HA 4GY5A 1K8AU 1G5VA 4HA8A 3BFMA 4C8QA 2LVMA 3CCJA 4A4KA 3PTAA 2LT4A 3MHXA 3CCQT 1VQNT 4HKEA 1QVFS 4C5EA 3M53A 2RI5A 3MO8A 3PFSA 1VQMT 2A7YA 3C94A 2L5QA 1RI0A 2K5LA 1O9SA 4IURA 2RHYA 3CXCA 4HT9A 3LGFA 3OBYA 3ER0A 4Y91A 4ZGDB 4C8QG 4Z02A 3OS2A 5CKDA 4X9CA 3QG1A 3OYYA 2LT1A 3JCMJ 2V8KA 1I81A 2RH2A 3INZA 2R5AA 3DLMA 1N9RA 2YHTA 2RA2A 3M5AA 2XD0A 2GCXA 2K5IA 3E9GA 1NJIU 4QW2A 1LJOA 1UGSB 3TEEA 3CMAT 2KK4A 2WSEE 3FB9A 1I8FA 1OI1A 1UGQB 4Q5WA 5GMKi 2RHZA 3MEAA 5HY6A 2XK0A 3JB9D 4N0AA 4LD6A 3CCVA 2P0PA 2PQWA 4M75C 4F7UB 2EJGA 4JRPA 3VJPA 4O5VA 3VKIA 2ZPGB 4BI4A 2XDDA 4IKFA 1OYXA 4M7DD 2R58A 1RL2A 4EMKB 5GAN2 3J81E 4C5GA 2PVDB 1YIJT 1BKBA 5DY9A 4NOYA 3M55A 3CCRA 1ZQ1A 4FIBA 4V2SA 2RK2A 3V8KA 4FL6A 4ZTJA 5GAOp 1YITA 1MHNA 2H3JA 3JCMW 3OBWA 1M1GA 3R6OA 3L1AA 3ZFJA 3OY9A 2EJ9A 4MDWA 1M1KU 1VQ5T 1NPRA 1KC8C 4ZGEB 4M7DE 1Q86U 4NL2A 3I55T 4J5YA 3NTKA 3CC2T 1JJ2A 3JCMe 4HT8A 1KHIA 4FU6A 5GAOm 1VQ8A 4M75F 4MZTA 5KE2A 1HXDA 1G3WA 2LC4A 1VQPT 1VQ7A 3Q1JA 2IG0A 1VQLA 3MEUA 2BKDN 4ZN3A 3JCMV 1WPYA 2V8IA 4M7AB 2O4XA 1BI3A 3HRUA 4BI3A 2EWNA 4C8QC 1Q82C 3CCJT 2DKGA 5CKHA 2DXBA 3HL8A 1Y96A 4OB1B 1IZ6A 2Y4YA 2HAXA 4D6WA 1KQSS 1LNXA 2X35A 4C5HA 3X26B 5CCAA 3KUFA 2MWOA 2DPPB 2L8DA 4F7UE 3V8LA 2R5MA 5FU6C 4RG8A 3OS0A 3P8BB 4KUIA 1N6AA 3OA6A 3LWHA 2ZCFB 1XNIA 1QP2A 3OQ5A 4L59A 4OMFB 3S3MA 1YCYA 2X4XA 3L2UA 2KY9A 3JAME 3KXTA 3JSCA 1QW1A 3P8DA 3GPLA 1S72T 4LDXA 4XU0A 4JLIA 2DTIA 3N5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3B A;  2EJF A;  3EFS A;  4MML A;  3RKY A;  3SWN A;  2DTO A;  4C8Q F;  4M75 B;  3L2Z A;  3QHS A;  4M78 D;  4C92 A;  3JCM d;  2DJZ A;  4M78 B;  5GAN 6;  5GMK e;  5LJ5 g;  5GAO n;  1M8V A;  4QVC A;  5LJ3 j;  5GAN 3;  4EMG A;  2RB6 A;  4HA8 A;  3BFM A;  3HFN A;  4C8Q A;  3QSU A;  4MMK A;  3V7R A;  4J6X A;  4X9D A;  4PJO G;  4JRI A;  3RUX A;  5LJ5 e;  5GAN j;  3RKX A;  4PNO A;  3JCM h;  4F7U F;  2DEQ A;  4N0A C;  5LJ3 h;  5GAM j;  2FYK A;  1JRI A;  4M7A F;  4PJO D;  4F7U A;  4M78 E;  5GMK m;  4M7A C;  4PJO B;  3JCM X;  2EAY A;  4J6W A;  3V7C A;  1U1S A;  3JCM Q;  4HT9 A;  4C92 G;  2DZC A;  3SB2 A;  4M7D A;  5LJ3 f;  3VU3 C;  4EMK A;  2RD1 A;  4OP0 A;  4XTY A;  1B34 A;  1I4K 1;  1U1T A;  4XQ3 A;  4Y91 A;  4EMH A;  4C8Q G;  4M77 D;  4M77 B;  5GAN f;  1D3B B;  5CAI A;  4X9C A;  3RES A;  5GAO q;  4M75 D;  3SWN B;  3GIB A;  1JBM A;  3JCM J;  1I81 A;  4C92 D;  3INZ A;  3HSB A;  4C92 B;  3RER A;  5GAM f;  2DXT A;  4XTX A;  3JB9 I;  5LJ5 d;  1N9R A;  2YHT A;  2RA2 A;  1I5L A;  4PJO E;  1TH7 A;  1Y96 B;  3BW1 A;  4C8Q B;  5GAO r;  2DZ9 A;  4DQ2 A;  3JB9 G;  4F7U G;  4JUV A;  1LJO A;  3QO3 A;  3JCM b;  4XU1 A;  5GMK j;  3FB9 A;  1I8F A;  5GMK i;  2HNI A;  4M77 E;  5LJ5 h;  4M7D G;  1MGQ A;  4M75 E;  4M77 C;  4N0A A;  3JB9 D;  3EFR A;  4C92 E;  4M75 C;  2E41 A;  4F7U B;  1N9S A;  2EJG A;  4M78 C;  4WF2 A;  4XU2 A;  3JCM f;  4M7A A;  2DTH A;  4A53 A;  5GMK h;  1LOJ A;  5GAO l;  2YLC A;  4M7D D;  5LJ3 g;  5GAN 2;  1KQ1 A;  2VC8 A;  4EMK B;  4M7D B;  1B34 B;  1M5Q 1;  2E10 A;  2DXU A;  3JCM c;  4XTW A;  2CGH A;  5DY9 A;  5GAN g;  4NOY A;  4V2S A;  3QUI A;  1HK9 A;  4RCC A;  3V8K A;  2VXF A;  5GAO p;  3RKW A;  5GAN 8;  5GAM g;  3JCM W;  2VXE A;  5LJ5 j;  1KQ2 A;  3L1A A;  4C8Q D;  3M4G A;  3JCM P;  4PJO C;  1X01 A;  2EJ9 A;  2E65 A;  4M7D E;  2E1H A;  4XTU A;  4NL2 A;  4M7A G;  4J5Y A;  1BIA A;  4M77 F;  4XTZ A;  4J6Y A;  3JCM e;  4HT8 A;  5GAO m;  4M75 F;  5LJ3 e;  1HXD A;  4M78 F;  3SWN C;  3RIR A;  2FB7 A;  4C92 F;  5GMK l;  4M77 A;  2RM4 A;  2YLB A;  3JCM g;  4C92 C;  4A54 A;  5GAN e;  3HFO A;  1WPY A;  4M75 A;  4M7A B;  3JCM V;  2ZGW A;  4C8Q E;  4M78 A;  4M7A D;  2E64 A;  1WQ7 A;  5LJ5 f;  2EWN A;  4C8Q C;  1H64 1;  2DVE A;  2DKG A;  3BY7 A;  5GAM e;  5GAN 4;  5LJ3 d;  5I21 A;  1Y96 A;  2QTX A;  3V7S A;  4NL3 A;  1LNX A;  3FJP A;  5GAN d;  1BIB A;  3JB9 F;  4XTV A;  4PJO F;  3V8J A;  1WQW A;  4F7U E;  3PGG A;  2JN0 A;  3V8L A;  5GAM d;  5GAN 7;  5GAN 5;  4M7A E;  3AHU A;  4RCB A;  4PJO A;  4XU3 A;  4M77 G;  4M7D F;  5GAN h;  3BDU A;  3JB9 H;  1WNL A;  2I2L A;  4M75 G;  4EMK C;  1YCY A;  4QVD A;  4M7D C;  4M78 G;  2K57 A;  5GAM h;  2Y90 A;  3FIF A;  3JB9 J;  4XU0 A;  4JLI A;  2DTI A;  4JRK A; 
#chains in the Genus database with same CATH topology
 2EKO A;  2HZY A;  2GBQ A;  5FU7 C;  3RKY A;  3FEO A;  2VGM A;  4C8Q F;  3L2Z A;  1TWB A;  2MCN A;  1OZ3 A;  1R0B G;  2CP7 A;  2DIG A;  4Y28 E;  1VQO T;  2ZZD A;  4A4G A;  1SHF A;  2M51 A;  2CZ7 B;  4J6X A;  4X9D A;  2K3B A;  3L42 A;  1SEM A;  2OTJ A;  5IYB P;  5LJ3 h;  5BMN A;  4F04 B;  5IYC P;  3QDR B;  4PJO D;  2ZPE B;  2QA4 A;  1JEG A;  3VV0 A;  3V7C A;  2HKQ B;  2O01 E;  2CT3 A;  3PNW C;  2CP6 A;  2MAM A;  1X75 C;  4LDW A;  1XTD A;  2YXY A;  2DMO A;  4KGX B;  2FPE A;  3SWN B;  1YIT T;  1JBM A;  3C04 A;  3EH1 A;  1QNC A;  4PJO E;  1NJI C;  2JM8 A;  1VOK A;  2EQU A;  3OYK A;  2LNV A;  5GMK j;  2DK3 A;  2KT1 A;  4QKU A;  1V5S A;  4PJL A;  1LWV A;  3OYM A;  1PNJ A;  3CCS Q;  3M0P A;  2JMA A;  2BZX A;  4PL6 A;  2P0Q A;  3C4S A;  4CC4 B;  4II1 A;  2FL7 A;  3L2Q A;  3A8H B;  4O6J A;  1EIF A;  6AT1 B;  3URG A;  1M1K C;  3CC4 A;  1Q9U A;  2MOX A;  1Q86 C;  3HS9 A;  2DXC A;  2FPD A;  3G71 A;  3A98 A;  3VYG A;  2XHI A;  2YLB A;  5C0M A;  1G2B A;  3M9Q A;  3FC3 A;  3TQ7 P;  1K9M C;  1OZ2 A;  2HEQ A;  3M57 A;  4UC4 A;  2QA4 T;  2QDY B;  3AHU A;  1U8R A;  2A28 A;  3M0R A;  1PC0 A;  1T0H A;  1KQS A;  2G6F X;  3RMS A;  4RKU E;  1EFN A;  3OW2 A;  5J3B A;  4YTL A;  1R8O B;  1KYF A;  3ASK A;  3QYH B;  5GMK e;  3DPT A;  3OYE A;  4BY6 B;  2KDS A;  1D3U A;  2XI9 A;  2LAE A;  4JRI A;  2CZ1 B;  1ABO A;  3JCM h;  2RHU A;  2L3Q A;  4LDV A;  4RUG A;  2FYK A;  2HL8 A;  1JRI A;  1QVG A;  4ROE B;  3CC7 A;  2J6K A;  4PJO B;  3LH5 A;  1TU0 B;  2DZC A;  4WZS D;  4AFZ C;  1QNB A;  5CKF A;  3I35 A;  2JS0 A;  5GAO q;  2K9G A;  1SRM A;  1KYU A;  2PVG B;  2K6D A;  3DPU A;  3CME A;  2HL5 C;  4ELZ C;  2KYM A;  3G71 T;  3PVQ A;  4QQG A;  2OTJ Q;  1NM7 A;  5EC7 A;  1G3S A;  5ECA A;  2KR3 A;  2YUQ A;  1YJ9 A;  2FHD A;  5CQY A;  3CCV T;  2QRC A;  2QA4 Q;  2A08 A;  1W80 A;  4D7Q A;  2E41 A;  1SSH A;  2KRM A;  4A4E A;  2DTH A;  5GAO l;  3OSM A;  2MF2 A;  1O75 A;  1OPL A;  3L2W A;  1QN4 A;  4JS5 A;  2GNC A;  1M9S A;  2VXF A;  3M58 A;  4IUU A;  2VXE A;  2LCC A;  3GOX A;  3M4G A;  1XJW B;  4ESR A;  3A8G B;  5D6W A;  3OB9 A;  3QBY A;  4FCY A;  3F70 A;  2V92 A;  1BIA A;  4XTZ A;  4KBM B;  2DX1 A;  1KO9 A;  1WXU A;  1ZSZ A;  2LRQ A;  3BE3 A;  1VQP A;  3VRZ A;  1BU1 A;  3HKS A;  3ME9 A;  4EJZ A;  2BZY A;  5KYW A;  5KCO A;  2QRD A;  4L6V 5;  2OTL A;  2JPI A;  4X34 A;  4FSS A;  4DBH A;  1WQW A;  2EQM A;  4DA4 A;  3CC4 Q;  3CC7 T;  1MNE A;  1AWW A;  4RMO A;  5HSH A;  1H8K A;  3QYG B;  4QQD A;  1GBR A;  1NEB A;  3FIF A;  2XG8 D;  5J39 A;  1YJN A;  1VQ6 Q;  4M75 B;  3D7S B;  2OX7 A;  3CME T;  1NG2 A;  2DF6 A;  5LJ3 j;  5GAN 3;  3H41 A;  3CXC S;  2VGN A;  4PJO G;  4LN2 A;  4LUE A;  3X25 B;  1YJ9 T;  4PNO A;  5A0D A;  3LW5 E;  4OGE A;  3ENC A;  2BIV A;  1D1A A;  3JCM X;  1VYU A;  2ATC B;  3UWN A;  2EYQ A;  2COY A;  1M27 C;  3PMI A;  3EAE A;  2GGR A;  2A0F B;  2J05 A;  2DIL A;  3OS1 A;  2F5T X;  1QNE A;  2RPN A;  4QVZ A;  2COW A;  5D6Y A;  3M0U A;  1WFW A;  4R55 A;  3VUZ A;  4JUV A;  1ZUK A;  4IUQ A;  1K9A A;  1VQN Q;  3KTU A;  2CH4 W;  5LJ5 h;  1HSQ A;  2ZPF B;  1ZSZ C;  1AT1 B;  5IHK A;  3G7Z A;  2CZ0 B;  2LZ6 B;  4PJJ A;  2OTL T;  3S6W A;  4JLG A;  3E1S A;  2D0N A;  2XDP A;  4E7I A;  1KC8 R;  2HQE A;  5FU7 B;  2YUN A;  3CME Q;  2LTO A;  4C8Q D;  1I1J A;  3H8Z A;  1G3T A;  2O9V A;  2E65 A;  2DRM A;  2NOI A;  1HU0 A;  2O31 A;  3N89 A;  1C4G A;  3SNS A;  4HCB A;  2MPX C;  1YJN T;  2DD5 A;  5LJ3 e;  1D0Y A;  3RIR A;  5GMK l;  4IUT A;  4BJU A;  1H3Z A;  3JCM g;  2JXB A;  1J3M A;  1M3B A;  4C8Q E;  2X4J A;  4TVR A;  2NWV A;  1YI2 T;  3BY7 A;  2EIF A;  2RO0 A;  2DO3 A;  4NL3 A;  1YIJ A;  3I5R A;  2KNB B;  3G1J A;  1TOV A;  2YRD A;  4XTV A;  4PJO F;  2CKK A;  1AWX A;  2H3E B;  1WJR A;  1UJ0 A;  1UHF A;  2ROT A;  2CS7 A;  3DB3 A;  1WNL A;  2R57 A;  4M75 G;  1FMV A;  2LMJ A;  2Y8Q A;  1K0X A;  2EBP A;  2C0O A;  5DLO A;  5GAM h;  3EG9 A;  2E3H A;  1K2Y X;  1IO6 A;  2XKO C;  1VQP Q;  1NEG A;  4J8O A;  3EFO A;  1X2Q A;  5CQX A;  4FW1 A;  5GAO n;  1TUG B;  1J3T A;  1ZSG A;  2YWW A;  2M1H A;  1G5V A;  3CCJ A;  4A4K A;  4HKE A;  2FG0 A;  2COZ A;  4J9I A;  1Z9Z A;  2DKA A;  1CKA A;  3EHQ A;  2L5Q A;  1RI0 A;  1O9S A;  4IUR A;  2RHY A;  2Z8U A;  4J9C A;  5IH2 A;  2LJ1 A;  3OBY A;  4IL8 A;  1WA7 A;  1PRM C;  3FJ5 A;  1T6A A;  3OS2 A;  5CKD A;  4X9C A;  1V1C A;  2LT1 A;  3JCM J;  2V8K A;  4F16 A;  2C0T A;  2JOI A;  2YHT A;  2K5I A;  3E9G A;  3TEE A;  3FB9 A;  1OI1 A;  3MEA A;  1QCN A;  1AZG B;  4N0A A;  2EJG A;  3VJP A;  4IIO A;  2ZPG B;  1Y0M A;  2JTE A;  2ZAE A;  1KFQ A;  1RM1 A;  1YIJ T;  3EGD A;  1PWT A;  5DY9 A;  3CCR Q;  4V2S A;  4ZTJ A;  5GAO p;  1W6X A;  2H3J A;  3ULR B;  3OBW A;  3D4V A;  1KC8 C;  3NTK A;  2DL3 A;  1VQ8 Q;  3JCM e;  4HT8 A;  4M75 F;  4MZT A;  5KE2 A;  2ZFD B;  2LC4 A;  2JMC A;  2K79 A;  4J9B A;  2IG0 A;  5FWB A;  3QWY A;  4ZN3 A;  1UEC A;  3JCM V;  2V8I A;  2DEU A;  2O4X A;  4D8D A;  1UUE A;  2CH4 A;  4BI3 A;  1RLP C;  2EWN A;  2NOF A;  3CCJ T;  2DKG A;  2MJ7 A;  2OOY A;  1PCZ A;  3HL8 A;  2HAX A;  1PKS A;  2Z0F A;  4HJH A;  5CCA A;  2MWO A;  2DPP B;  2F2X A;  2QK0 A;  4CC3 A;  2RF0 A;  3REA B;  2NWM A;  4KUI A;  3OA6 A;  3LWH A;  3S3M A;  4OMF B;  3L2U A;  5FWC A;  3KXT A;  1HJD A;  3P8D A;  2ESW A;  3PDK A;  4XU0 A;  4JLI A;  3G4S A;  3CCM Q;  3FLG A;  3CPW A;  2YA3 A;  2JZ2 A;  3H0F A;  2YRV A;  3OYL A;  4PY5 A;  3QHS A;  2EYZ A;  3I5S A;  5LJ5 g;  1W70 A;  3ENO C;  1EX4 A;  4MMK A;  1VQK Q;  3EG1 A;  2A3L A;  3OYF A;  4FYW B;  3CW7 A;  4N0A C;  2XID A;  3G6E A;  3S3N A;  4M7A F;  1TSF A;  1GCQ A;  4F7U A;  1ZLM A;  1Y07 A;  3VS7 A;  4F14 A;  3SB2 A;  1IGU A;  4BDY A;  1KQS P;  3ASM A;  2RHX A;  4XTX A;  4WTO B;  4WX8 A;  1TH7 A;  2EW3 A;  3BW1 A;  4DQ2 A;  2D9T A;  2EQJ A;  1UB4 A;  3OW2 P;  2XHC A;  4XU1 A;  4Z88 A;  1WYX A;  1BK2 A;  1YN8 A;  1VYV A;  4PKC C;  4OVA A;  1OQK A;  3OCI A;  2HD0 A;  1ZUY A;  3MP1 A;  1YTF A;  1RAI B;  3JCM f;  4M7A A;  1GXI E;  4N4I A;  5GJV B;  3CCS A;  2M0O A;  2CP5 A;  5A2Q E;  2MK5 A;  1QVG P;  2CGH A;  3TU4 K;  3L2V A;  1D1C A;  1X2K A;  5GAM g;  1N8R U;  1WX6 A;  2YRC A;  2LDM A;  3IQL A;  2OI3 A;  1X6G A;  5CVI A;  1VIF A;  1OEB A;  3G4S T;  4Y92 A;  4FW2 A;  1W4S A;  3E9F A;  1I07 A;  3RBB B;  3SD4 A;  4RTT A;  1ZA2 B;  8ATC B;  5KH6 A;  1WHH A;  2DAQ A;  2X4W A;  4AFU C;  4J83 A;  4LDU A;  2HKN A;  3I9Q A;  2XMF A;  1YBY A;  3G6E T;  1Q7Y R;  2JN0 A;  4HXJ A;  1GCQ C;  3MCA B;  2K5F A;  2EPD A;  4DBQ A;  5GAN 5;  4QG5 A;  4PK4 A;  5KCH A;  4M7D F;  1WHG A;  5GAN h;  2RQR A;  3OYJ A;  4OF1 A;  2F5K A;  2FO0 A;  4BI8 B;  4KH1 B;  2M02 A;  2K57 A;  2KRN A;  3JB9 J;  3OYD A;  5LJ5 e;  1WJS A;  1R4X A;  1BI0 A;  5KYY A;  1ZSZ B;  2L3P A;  3TDH A;  3JRZ A;  3H0H A;  3JCM d;  4OMM A;  1SSF A;  4RG2 A;  4ZN1 A;  3KBG A;  1UEB A;  4WXA A;  1WXT A;  1PD0 A;  1VIE A;  1Q81 R;  3NFC A;  2HBP A;  2IVW A;  1PG5 B;  3FRN A;  2KAF A;  4N4H A;  1KY6 A;  4E7H A;  2RQT A;  2C0I A;  3E2U A;  4A63 B;  2ECZ A;  2AHJ B;  4M7A C;  1M1F A;  3CCS T;  3RNJ A;  1U1S A;  2DYI A;  1VUB A;  3UDC A;  4M7D A;  1I0C A;  3J7A F;  1WHL A;  3VS5 A;  3SEM A;  1K35 A;  1QN6 A;  2V26 A;  1PM3 A;  4JZ3 A;  3UA6 A;  5FRO A;  1NVP A;  2EFI A;  1NGM A;  5AYF A;  1VQ4 Q;  4IUV A;  3PMG A;  2VB6 A;  4CC2 A;  1Y7X A;  5AN4 A;  1E6G A;  2MI6 A;  2QQA A;  1X69 A;  3G6E Q;  1LCK A;  3CMA A;  4ROC B;  1CKB A;  2M0Y A;  2M9U A;  4LD9 K;  3A8L B;  1Y71 A;  2M16 A;  1SKU B;  2VC8 A;  4EPC A;  1K73 U;  1MMD A;  1AOJ A;  2E6N A;  1HK9 A;  1M2O A;  5CKB A;  5I2M A;  2HMA A;  3OSV A;  5GAN 8;  1QKX A;  1WHM A;  3JCM P;  1CSK A;  1TGH A;  1N3C A;  5IAY A;  4J9D A;  4RTZ A;  3OYC A;  4MZP A;  3I55 A;  1UFF A;  1LWY A;  2QXF A;  2KE9 A;  2FB7 A;  2AK5 A;  4M77 A;  4FT4 A;  1WJW A;  1W2B S;  2LCS A;  1UTI A;  5LJ5 f;  2YUO A;  4OMO A;  4E6R A;  1TS9 A;  5GAN 4;  1K0S A;  2VWF A;  5I21 A;  2DIQ A;  1BIB A;  2JTM A;  3V8J A;  1PCX A;  2GF7 A;  4BUG A;  3VYH B;  1MV3 A;  2ZPB B;  2DRK A;  4DBR A;  4M7D C;  1Q7Y C;  1GFC A;  3H0I A;  1VYT A;  1Z9Q A;  1S72 A;  2XDB A;  1RAC B;  2NUP A;  1VQ6 A;  4DOV A;  5GAN 7;  1VOM A;  4QVC A;  2MMP A;  1AEY A;  3HFN A;  4LNP A;  1G83 A;  2OTJ T;  1VTO A;  5CKE A;  2DL7 A;  4A4H A;  2P0K A;  3H1Z A;  3TSZ A;  1P5G X;  1AD5 A;  2RQU A;  1W1F A;  2QGG A;  3LWI A;  5GMK m;  1Q81 C;  4EAL A;  3GNG A;  2W10 A;  3VU3 C;  3EIK A;  2HDA A;  1B34 A;  3I56 Q;  4EMH A;  4JS4 A;  2LCL A;  3CVT A;  4OGC A;  2CSI A;  4M75 D;  5GJW B;  3EFO B;  5GAM f;  2DXT A;  3REB B;  3JB9 I;  5LJ5 d;  2HKP A;  1DJ7 B;  2KI7 A;  1OUL A;  5M9O A;  3JCM b;  2RHI A;  2VV5 A;  5FLX E;  4ZGJ B;  1VQN A;  4HVV A;  1K4U S;  5L23 A;  4M75 E;  4M77 C;  1VQM Q;  1NPP A;  1IB8 A;  2NUZ A;  2FUV A;  3RSM A;  1TTH B;  3OMG A;  3GP8 A;  1UT4 A;  3H6Z A;  2F2V A;  5KYX A;  1V29 B;  5GAN g;  1QN8 A;  1JJ2 S;  3RKW A;  3CC4 T;  4HCC A;  4M4Z A;  2NVM A;  2OAU A;  1UJY A;  3OW2 S;  4F17 A;  2QEX A;  3MP8 A;  3CMA Q;  2FEI A;  2JOY A;  3A5Z B;  2G30 A;  1PKT A;  3TRE A;  1YJW A;  4KUD K;  2DKC A;  3KRM A;  1IHV A;  3MET A;  4MDX A;  1VQ6 T;  1MV0 B;  1C0M A;  4XAX B;  3ZBD A;  4M7A D;  2RI3 A;  1D1B A;  1QVG S;  2DVE A;  2O2O A;  4MRQ A;  2RN8 A;  2J6O A;  5GAM d;  3OYI A;  4M7A E;  2CSQ A;  3C12 A;  4JJC A;  1VQ5 A;  2HQH A;  4QVD A;  3I55 Q;  1MMG A;  1QWF A;  2F2W A;  3CC2 Q;  1K8A R;  1HD3 A;  3JV3 A;  8AT1 B;  1KD1 U;  3X28 B;  4C0D C;  3HRT A;  4HCK A;  2GQI A;  2O4X B;  4EJY A;  4EMG A;  1C9B B;  4PFP A;  2AKK A;  3BFM A;  4HA8 A;  1VKL A;  2JHN A;  3PTA A;  4E7S A;  1VQN T;  2R5X A;  1QVF S;  4C5E A;  2LQW A;  2V9J A;  3EG2 A;  2QG9 B;  2A7Y A;  2K5L A;  3CXC A;  2VVK A;  3CVS A;  2HL9 A;  3ER0 A;  1S72 Q;  4Y91 A;  4ZGD B;  4Z02 A;  1JFI C;  4ZNX A;  1I81 A;  1XSZ A;  3VS6 A;  1X43 A;  2RA2 A;  2XD0 A;  1NJI U;  4QW2 A;  3VS3 A;  3CPW P;  2KK4 A;  2WSE E;  5GMK i;  2RHZ A;  2Z0W A;  3CQT A;  1TUD A;  2PQW A;  4F7U B;  3VKI A;  2XDD A;  1E7O A;  4M7D D;  2B86 A;  5GAN 2;  3J81 E;  2CP0 A;  1R77 A;  4NOY A;  3CCR A;  2RK2 A;  4FL6 A;  4PFO A;  2IIM A;  1P5D X;  1TBP A;  3R6O A;  3OY9 A;  2E4H A;  2EJ9 A;  4MDW A;  5I11 A;  1M1K U;  1VQ5 T;  4M7D E;  1AIS A;  1Q86 U;  2X3W D;  1M2V A;  2QDL A;  2IV9 A;  2GTJ A;  1VQ8 A;  1B9K A;  1RAD B;  1VQL Q;  1VQP T;  1KIK A;  2PZ1 A;  1VQ7 A;  5D7U A;  4M7A B;  2MZ8 A;  4KGZ B;  4OB1 B;  1LNX A;  1JU5 C;  2X35 A;  1D0Z A;  3KUF A;  1SRL A;  1RAA B;  2R5M A;  5FU6 C;  4RTX A;  2QEX Q;  3OS0 A;  1QP2 A;  1YJW Q;  4LDX A;  2KY9 A;  1QTP A;  1KJW A;  1TUO A;  2BE7 D;  1SG5 A;  1E6H A;  2AKL A;  5IN1 A;  4JDS A;  3CCM A;  2BUD A;  1K1Z A;  4AT1 B;  1C1A A;  4OMQ A;  1K8A C;  1AVZ C;  2PVO B;  1QVP A;  3UPU A;  1NE8 A;  1VQK A;  3RKX A;  3GLX A;  2BE9 B;  2ENM A;  2DEQ A;  4NS5 A;  3OYG A;  3OGD A;  2BTT A;  3OSS C;  4E7J A;  3CCL Q;  1VQ5 Q;  3SHW A;  1ZX6 A;  4AG2 C;  2DKD A;  1WI7 A;  2EAY A;  1JB0 E;  4J6W A;  3MKD A;  1QTS A;  3CBO A;  5DM7 R;  4EMK A;  1B7T A;  1AWO A;  3CCR T;  2VJ0 A;  2DLP A;  5GAN f;  5KYY B;  3NTH A;  3RES A;  1N3A A;  1TUC A;  1KHC A;  4JRQ A;  3A8M B;  1I5L A;  2KXD A;  2FKM X;  1Y96 B;  2NLU A;  2EGA A;  4F7U G;  1WHJ A;  4P5N A;  3TVT A;  1GFD A;  1VQ8 T;  2FPF A;  2I5W A;  4E2F B;  2FVU A;  2RK1 A;  2L89 A;  3ZL7 C;  2KMT A;  2PTK A;  2MWP A;  4XU2 A;  1PCJ X;  1LOJ A;  4IUP A;  4FYX B;  2E12 A;  4M7D B;  2JUF A;  1M3H A;  1M5Q 1;  2F1L A;  5IT9 E;  2F69 A;  4ANJ A;  7AT1 B;  2JS2 A;  4RCC A;  3EGU A;  4CRI A;  1WDX A;  1SPK A;  5KL0 A;  4GBQ A;  3CD6 A;  2IPO B;  2DL8 A;  2K3X A;  4M7A G;  4PJM A;  3SDZ A;  3M0S A;  4J6Y A;  3QDF A;  3OSE A;  3CCM T;  3PVL A;  2EGC A;  3ULX A;  3HFO A;  5HK3 A;  1WJQ A;  1KG1 A;  3T4N A;  1ZBJ A;  5IHN A;  5A0L A;  3VUB A;  2ZPH B;  2G3R A;  1VQK T;  1NYF A;  5FRN A;  3X24 B;  5GAN d;  3QXE B;  3MPU B;  3JB9 F;  4IIM A;  1B3Q A;  1WXB A;  2K2V A;  5IHI A;  4EMK C;  2XU8 A;  2PU9 B;  1VQ7 Q;  4MZM A;  2Y4X A;  1D3B A;  1D0X A;  5CR2 A;  4JPB W;  4HCZ A;  5HCK A;  3I3W A;  2DJZ A;  3UT1 A;  4PLI A;  3QSU A;  2K4Y A;  2K2M A;  1T3S A;  2FGT A;  1RAE B;  4A4F A;  4F7U F;  4AMC A;  3CCQ A;  1MP9 A;  2QI2 A;  3HS8 A;  3CWA A;  2GQV A;  2NYS A;  5L8R E;  3RPJ A;  2KRS A;  4OP0 A;  1NZ9 A;  2EYX A;  3CCE A;  3PE0 A;  4J9E A;  2NUP B;  3PMT A;  2DM1 A;  1VQ4 A;  1F1B B;  2RMO A;  2XIC A;  2I0N A;  4B9W A;  1XQH A;  4M7D G;  2F7L A;  2L3R A;  2L3S A;  3EGX A;  1KFZ A;  1QN5 A;  3MEW A;  2DA9 A;  4WF2 A;  2VYT A;  3VS4 A;  4A53 A;  3T9N A;  3P8H A;  1MUZ A;  3OH6 A;  1B34 B;  2E10 A;  1G8X A;  4BDZ A;  2CDT A;  1M90 U;  1VTL E;  4C0D B;  3BKQ X;  3OS5 A;  5LJ5 j;  4QQ6 A;  4LXC A;  1KD1 R;  4D7R A;  1LWW A;  2E1H A;  3UF4 A;  5I2S A;  2MYS A;  4EAI A;  2JT4 A;  1YCS B;  1RUW A;  4C92 F;  2RM4 A;  3HPW A;  4PLL A;  3NMZ C;  2ZGW A;  4M78 A;  2E64 A;  4OB3 B;  4OB0 B;  1AHJ B;  4BAC A;  4EAJ A;  2QRE A;  1QNA A;  5KYX B;  3C0C A;  2LJ0 A;  4C0Z A;  4R56 A;  1FX7 A;  3WVE B;  3CD6 Q;  1FMW A;  2OAW A;  1MMA A;  2OJ2 A;  3OST A;  1VQ9 Q;  4M77 G;  3QZ5 B;  3JB9 H;  2LQK A;  2DE0 X;  3CCE T;  1GCP A;  2NOB A;  4BE2 A;  3OYH A;  2PUK B;  3OMC A;  4MML A;  3EFS A;  4C92 A;  1M8V A;  1VQ4 T;  1RAH B;  3LH0 A;  3RMQ A;  1NLP C;  1U06 A;  1VQO A;  3TSW A;  3KFV A;  4QT7 A;  2EVR A;  3WXM B;  1EZZ B;  1PSF A;  2WSF E;  5GAM j;  1UGV A;  2EYW A;  3M0T A;  3QWX X;  2NOL A;  4JJN K;  4TPS A;  1B07 A;  2EKH A;  2QQ9 A;  3HP9 A;  2KQW A;  4KT0 E;  1JO8 A;  4VUB A;  1TBA B;  3I56 A;  1M1K R;  2X51 A;  1FN7 A;  5KYW B;  1R0C B;  2AT1 B;  2ED1 A;  4RTY A;  5EPC A;  5DLQ E;  2DD4 A;  3QJ6 A;  1X6B A;  3CCQ Q;  3X20 B;  1Q95 G;  4BB7 A;  1UHC A;  1P92 A;  1MGQ A;  1YQL A;  2WAC A;  5A0G A;  5FU6 B;  1GRI A;  1ZA1 B;  1N9S A;  4M78 C;  1VQM A;  2YLC A;  3GBQ A;  3CCE Q;  3LGL A;  4FM4 B;  3HHT B;  2KBT A;  3R6N A;  2CUB A;  4X1V A;  3QUI A;  4E7L A;  2LX9 A;  3ZEH A;  2H5A X;  3CXC P;  2A36 A;  2OOX A;  1S1N A;  2DVJ A;  1KC8 U;  4M77 F;  4AG1 C;  3QZ9 B;  1K76 A;  4C0F A;  1KD1 C;  2J06 A;  3I0W A;  2DBM A;  4C92 C;  3PT9 A;  1JXM A;  2YUP A;  3PIO A;  5JN5 A;  5GAM e;  4E7K A;  4E47 A;  3OH9 A;  3NPF A;  2LQN A;  4D8K A;  1BB9 A;  2QQB A;  3CEY A;  1W2B A;  1H3H A;  1CDW A;  2CYZ B;  2JNG A;  2EQI A;  4J9F A;  2EYY A;  2GFU A;  1M4Z A;  1M3Q A;  1M2V B;  2QLV A;  4ME7 A;  9ATC B;  3I56 T;  3CC2 A;  4FYY B;  2QR1 A;  1GBQ A;  2CRE A;  2DTO A;  1YNZ A;  1UDL A;  4ORZ A;  1U5S A;  4B9X A;  2DFU A;  2FZG B;  4C8Q A;  3MHX A;  1T3L A;  3M53 A;  1U3O A;  2P4R A;  3HTR A;  1QN7 A;  3MO8 A;  3PFS A;  5I22 A;  1VQM T;  3C94 A;  1YWP A;  4LUD A;  4EIK A;  2QAS A;  5AT1 B;  3M0Q A;  5KYU A;  4HVU A;  1PD1 A;  3QG1 A;  3INZ A;  2X3X D;  2R5A A;  2SEM A;  3DLM A;  2D8H A;  1N9R A;  3M5A A;  1VQO Q;  1N39 A;  2GCX A;  1QLY A;  3UA7 A;  3CMA T;  2AZV A;  1UGQ B;  2GTO A;  3O5Z A;  4Q5W A;  5HY6 A;  3JB9 D;  3CCV A;  2P0P A;  1C47 A;  4BI4 A;  1RAB B;  2CP3 A;  1OYX A;  2D0B A;  5KYN A;  2R58 A;  4EMK B;  3EG9 B;  2PVD B;  1BKB A;  1ZQ1 A;  1YIT Q;  3JCM W;  2YT6 A;  3L1A A;  2JW4 A;  3ZFJ A;  2QAZ A;  4JJD A;  1PRL C;  4HVW A;  3EAY A;  2RQW A;  3I55 T;  3CC2 T;  1JJ2 A;  1KHI A;  1HXD A;  1G3W A;  2PWW A;  2V8Q A;  1VQL A;  3MEU A;  2HZM A;  4LE9 A;  1WPY A;  4C8Q C;  2DER A;  4Q11 A;  2DXB A;  2NUT A;  1IZ6 A;  2Y4Y A;  1KQS S;  4C5H A;  1JQQ A;  2LJ3 A;  4F7U E;  1GL5 A;  1FYN A;  3V8L A;  3EHR A;  4RG8 A;  2KEA A;  1N6A A;  2NOE A;  4R0K A;  2ZCF B;  3UAT A;  1XNI A;  4L59 A;  1YCY A;  3GPL A;  1S72 T;  1YFN A;  1LVK A;  2YSQ A;  1VA7 A;  3N5B B;  2VAS A;  4M78 D;  5J26 A;  1FXX A;  2RB6 A;  1Q82 U;  2X4Y A;  3EGD B;  1UL7 A;  3V7R A;  2RJE A;  3RUX A;  5GAN j;  3I0X A;  2K7A A;  1M90 R;  4M78 E;  3CCL A;  3VS1 A;  1OU9 A;  4C0G A;  3VS0 A;  4BD3 A;  5CIU A;  1QVF A;  4XTY A;  2RJC A;  1U1T A;  2QYZ A;  1D3B B;  3MP6 A;  3F0Z A;  2QGF B;  3CBP A;  1PZD A;  2FRW A;  2ROL A;  4C92 D;  4LDY A;  3RER A;  2HL3 A;  2P84 A;  5GAO r;  2HZS A;  3H9N A;  3M54 A;  3EG0 A;  2FRY A;  1NYG A;  4RTW A;  1G3Y A;  1FMK A;  1QWE A;  2JTF A;  3NHN A;  4N4G A;  3BDL A;  2ED0 A;  1MMN A;  1VQL T;  2EHB D;  2QQS A;  2YH5 A;  5FRM A;  5IYD P;  3EFR A;  4C92 E;  2KXC A;  1N8R R;  3DLL A;  4OML A;  5LJ3 g;  4B0A A;  5KE3 A;  1I5O B;  1LPL A;  1YP5 A;  1ZUU A;  1BI1 A;  3JCM c;  1AWJ A;  1N27 A;  2NOZ A;  3LLR A;  1WIE A;  5HK0 A;  2X9H A;  1H92 A;  1IHW A;  4JZ4 A;  2QEX T;  3G71 Q;  5CK9 A;  2HSE B;  1YJW T;  4KH0 B;  2EGE A;  3OYN A;  3QPH A;  1RLQ C;  3NGP A;  2HBW A;  4AFS C;  1WQA A;  3CCV Q;  2NLV A;  3EGX B;  4OMN A;  2O3O A;  1BBZ A;  4E7Z A;  4A54 A;  5GAN e;  4PFZ A;  4EDU A;  1WQ7 A;  2LP5 A;  1BCM A;  1YI2 A;  2QTX A;  3F10 A;  1OU8 A;  4EAG A;  3CCU A;  3CCL T;  1TXQ A;  1QCF A;  4DUL A;  2LQ8 A;  2E6Z A;  2V1Q A;  2WSC E;  2D6F A;  1EBM A;  1Q7Y U;  2Y8L A;  4RTV A;  2H8H A;  2EJF A;  3SWN A;  1WZO A;  1KFI A;  1VOL B;  3A8O B;  4M78 B;  5GAN 6;  4FYV B;  1KK7 A;  2FZK B;  5EG2 A;  2B8A A;  4CFF A;  1SF9 A;  3QKJ A;  3M4Y A;  1PHT A;  1K9M U;  4AFQ C;  2HCK A;  3CC7 Q;  4FT2 A;  5C6S A;  5LL6 S;  3E19 A;  2DYB A;  2BZ8 A;  4ZTF A;  1Q81 U;  2H4L X;  2AZS A;  2RD1 A;  3GNF B;  5D6X A;  3HRS A;  1I4K 1;  2MIO A;  1M90 C;  4M77 D;  1JXO A;  5CAI A;  3GIB A;  1M3A A;  1NH2 A;  1SHG A;  3LX7 A;  3HSB A;  4PJN A;  4C92 B;  3FDR A;  4JJB A;  3JB9 G;  2QTV A;  2DZ9 A;  4J9H A;  2HSP A;  2D0A A;  1YJ9 Q;  1DIZ A;  2KSS A;  4M77 E;  3PIP A;  1K73 R;  1YQR A;  2DJQ A;  1OV3 A;  2KRO A;  1ARK A;  2DL5 A;  3DB4 A;  1KQ1 A;  3OYA A;  1IXD A;  4KRT A;  2DXU A;  3C95 A;  2ABL A;  2O88 A;  1M30 A;  4BE0 A;  1N8R C;  2D0C A;  4OMP A;  3CCU T;  3OC3 C;  4DEX A;  4KUL A;  5IXB A;  2RI2 A;  1RI9 A;  3CPF A;  3O8V A;  3QII A;  2JVV A;  2EQK A;  4RTU A;  1PVS A;  1BI2 A;  1VQ7 T;  5BMP A;  1QN9 A;  3VRY A;  2FZC B;  2CUD A;  3SWN C;  4GLK A;  2OTL Q;  3NTI A;  4Z89 A;  2LX7 A;  2FKF A;  2YDL A;  3PGG A;  2J6F A;  5FW9 A;  4FSX A;  4ELY C;  2A37 A;  3NA5 A;  4I8O A;  3GF5 A;  4RCB A;  4PJO A;  4XU3 A;  2E5Q A;  2RQV A;  3BDU A;  2O9S A;  1VQ9 A;  2K3Y A;  3TCJ A;  4M78 G;  2RJF A;  3CWS A;  1YQK A;  3MEV A;  1YJN Q;  4XK8 E;  4GLM A;  1YHQ A;  1QMC A;  4OB2 B;  1QN3 A;  1YI2 Q;  1UGR B;  2DL4 A;  1PSE A;  4B6M A;  3J80 E;  3OYB A;  4J7F A;  2RNA A;  3CCU Q;  2PUO B;  4DBF A;  1WLP B;  4CC7 A;  1T0J A;  1V76 A;  3THK A;  1ACM B;  2NOH A;  5HKC A;  3JCM Q;  4C92 G;  1AZE A;  1OPK A;  5LJ3 f;  4C7P A;  1W2B P;  2CZ6 B;  4XQ3 A;  4J9G A;  1M8M A;  4M77 B;  1BYM A;  3A1P A;  5F9C A;  5IXF A;  2QQR A;  3CBM A;  4C8Q B;  2W0Z A;  1QCO A;  3LYI A;  1NLO C;  3QO3 A;  3M56 A;  1OX9 A;  1HYO A;  2SRC A;  2HNI A;  4K11 A;  4L5G A;  1QP3 A;  2DBK A;  2GFA A;  2J7I A;  2KVQ G;  1UE9 A;  2E3I A;  1MPG A;  2VKN A;  5GMK h;  4BY6 C;  1XOV A;  1K73 C;  2C06 A;  1LXT A;  1E42 A;  1IRE B;  4XTW A;  5KYU B;  3S3O A;  2V8J A;  3AT1 B;  1WGS A;  1X27 A;  4C5I A;  5CO7 A;  1KQ2 A;  3CD6 T;  1KSW A;  3DKM A;  4PJO C;  1X01 A;  2D0Q B;  1VQ9 T;  1ZBX A;  4XTU A;  1PCM X;  1UGP B;  1Q82 R;  1YHQ T;  4M78 F;  1FWZ A;  2AIR B;  4BE1 A;  1M3C A;  4M75 A;  2RJD A;  4J7I A;  4DOW A;  4Z8A A;  2D8J A;  3L2R A;  4ATO A;  1H64 1;  1OOT A;  5LJ3 d;  1YIJ Q;  3V7S A;  2VUB A;  1UT7 A;  4WCI A;  3SFM A;  3FJP A;  2HQX A;  1QQJ A;  3IH7 A;  2JHJ A;  1N5Z A;  2IV8 A;  3CPW S;  3WVD B;  1RAF B;  3OLP A;  1YWO A;  1YQM A;  1JDY A;  3QJY A;  2P4T A;  2I2L A;  2JJ9 A;  3M59 A;  3CWT A;  3D7Q A;  2Y90 A;  2ZPI B;  1QKW A;  4JRK A;  1MND A;  2L0A A;  1Y57 A;  1X6O A;  3CWU A;  3VN5 A;  2DET A;  5JMV D;  1OX8 A;  4CI0 C;  1JJ2 P;  2E70 A;  1ZHI A;  4GY5 A;  3CCJ Q;  1K8A U;  2KYB A;  2LVM A;  2NUT B;  3TE5 A;  2LT4 A;  3CCQ T;  1RAG B;  2PNI A;  2RI5 A;  1IRX A;  1EUV A;  1WHK A;  3EG3 A;  3MJX A;  4HT9 A;  3LGF A;  1YHQ Q;  1NJI R;  4C8Q G;  3OYY A;  2RH2 A;  3U23 A;  2L2P A;  1LJO A;  1UGS B;  1ABQ A;  3UW2 A;  1D09 B;  1I8F A;  2CP2 A;  2XK0 A;  4LD6 A;  4M75 C;  4JRP A;  4O5V A;  4KGV B;  4IKF A;  1RL2 A;  2CT4 A;  4C5G A;  1Q86 R;  3M55 A;  4FIB A;  3V8K A;  2KT8 A;  1YIT A;  1MHN A;  4ROD B;  1M1G A;  2D1X A;  1QVF P;  1YTB A;  1NPR A;  4ZGE B;  1KYD A;  4NL2 A;  3RDV A;  4J5Y A;  4DEY A;  4FU6 A;  5GAO m;  1IGQ A;  3Q1J A;  2BKD N;  1UG1 A;  1K9M R;  1BI3 A;  3HRU A;  1Q82 C;  5CKH A;  1Y96 A;  4D6W A;  3EH2 A;  3X26 B;  1A0N B;  1TG0 A;  2L8D A;  1NBE B;  3VS2 A;  2JM9 A;  1BCO A;  2KGT A;  3P8B B;  2DNU A;  1C6V X;  3OQ5 A;  2X4X A;  2LNH B;  1KY7 A;  3JAM E;  4EAK A;  3JSC A;  1QW1 A;  2V1R A;  3RR6 A;  3G4S Q;  2E5K A;  2DTI A; 
#chains in the Genus database with same CATH homology
 3G4S A;  2EKO A;  3FLG A;  5IN1 A;  3CPW A;  5FU7 C;  2JZ2 A;  4JDS A;  3RKY A;  3CCM A;  2BUD A;  2YRV A;  3FEO A;  3OYL A;  2VGM A;  4C8Q F;  3L2Z A;  3QHS A;  4M78 D;  1OZ3 A;  5LJ5 g;  1K8A C;  5J26 A;  2DIG A;  1FXX A;  4Y28 E;  1VQO T;  2ZZD A;  2RB6 A;  4A4G A;  1Q82 U;  2X4Y A;  2CZ7 B;  2PVO B;  1QVP A;  4MMK A;  3V7R A;  4J6X A;  4X9D A;  2RJE A;  3RUX A;  1NE8 A;  3UPU A;  5GAN j;  3L42 A;  2A3L A;  3GLX A;  3RKX A;  1VQK A;  2OTJ A;  3OYF A;  2DEQ A;  4NS5 A;  4N0A C;  5LJ3 h;  3OYG A;  2XID A;  3G6E A;  3S3N A;  4M7A F;  3OSS C;  4E7J A;  3QDR B;  4F7U A;  4M78 E;  2ZPE B;  2QA4 A;  4PJO D;  3CCL A;  2EAY A;  1JB0 E;  1Y07 A;  4J6W A;  3V7C A;  3VV0 A;  2O01 E;  3PNW C;  3SB2 A;  3CBO A;  4C0G A;  5DM7 R;  2MAM A;  4BD3 A;  4EMK A;  5CIU A;  1QVF A;  4XTY A;  2RJC A;  1X75 C;  1U1T A;  4LDW A;  1XTD A;  3CCR T;  5GAN f;  1D3B B;  3MP6 A;  3NTH A;  3RES A;  3CBP A;  3SWN B;  1YIT T;  1JBM A;  4BDY A;  4C92 D;  1KHC A;  4LDY A;  3RER A;  4JRQ A;  3A8M B;  1I5L A;  2RHX A;  4XTX A;  4PJO E;  1NJI C;  1TH7 A;  1Y96 B;  2EQU A;  3BW1 A;  5GAO r;  4DQ2 A;  2NLU A;  3M54 A;  4F7U G;  2D9T A;  2EQJ A;  1UB4 A;  4P5N A;  3OYK A;  1G3Y A;  2LNV A;  2XHC A;  4XU1 A;  5GMK j;  1VQ8 T;  2JTF A;  2DK3 A;  4N4G A;  4PKC C;  4OVA A;  2FVU A;  2RK1 A;  3BDL A;  1VQL T;  2L89 A;  2HD0 A;  2QQS A;  5FRM A;  3MP1 A;  3EFR A;  4C92 E;  3OYM A;  2KMT A;  2MWP A;  3JCM f;  4XU2 A;  4M7A A;  1GXI E;  4N4I A;  1LOJ A;  4IUP A;  3CCS A;  2M0O A;  4PL6 A;  3DLL A;  2E12 A;  5LJ3 g;  4M7D B;  2JUF A;  5KE3 A;  5A2Q E;  1M5Q 1;  1BI1 A;  2P0Q A;  3C4S A;  5IT9 E;  4II1 A;  2F69 A;  2FL7 A;  3JCM c;  2CGH A;  3L2Q A;  3A8H B;  1N27 A;  4O6J A;  4RCC A;  3TU4 K;  3LLR A;  5HK0 A;  3L2V A;  4CRI A;  1EIF A;  5GAM g;  1N8R U;  3URG A;  1M1K C;  2LDM A;  2QEX T;  3CC4 A;  3CD6 A;  1Q86 C;  2DXC A;  5CK9 A;  3G71 A;  2K3X A;  1YJW T;  3OYN A;  4M7A G;  3QPH A;  5CVI A;  3SDZ A;  4J6Y A;  1VIF A;  3G4S T;  3SD4 A;  1W4S A;  3E9F A;  3CCM T;  3VYG A;  2YLB A;  5C0M A;  4A54 A;  5GAN e;  3HFO A;  5HK3 A;  1WJQ A;  4EDU A;  1WQ7 A;  1KG1 A;  5A0L A;  3VUB A;  5KH6 A;  2ZPH B;  2DAQ A;  2X4W A;  2G3R A;  1YI2 A;  2QTX A;  4J83 A;  3M9Q A;  4LDU A;  1VQK T;  5FRN A;  3X24 B;  5GAN d;  3QXE B;  3FC3 A;  1K9M C;  3JB9 F;  1OZ2 A;  1YBY A;  3G6E T;  3M57 A;  2JN0 A;  3CCU A;  3MCA B;  5GAN 5;  2K5F A;  4UC4 A;  3CCL T;  2QDY B;  2QA4 T;  3AHU A;  5KCH A;  2K2V A;  1U8R A;  5GAN h;  3OYJ A;  4M7D F;  4OF1 A;  2F5K A;  1KQS A;  4EMK C;  2LQ8 A;  2E6Z A;  4BI8 B;  2WSC E;  2XU8 A;  2D6F A;  2PU9 B;  2K57 A;  3RMS A;  3JB9 J;  1Q7Y U;  3OYD A;  5LJ5 e;  1WJS A;  4MZM A;  2Y4X A;  4RKU E;  1BI0 A;  1D3B A;  5J3B A;  5CR2 A;  2EJF A;  3OW2 A;  4YTL A;  1R8O B;  3SWN A;  3JRZ A;  4HCZ A;  3ASK A;  3A8O B;  3JCM d;  3QYH B;  2DJZ A;  4M78 B;  5GAN 6;  5GMK e;  3UT1 A;  5EG2 A;  3OYE A;  2B8A A;  4BY6 B;  1SSF A;  2KDS A;  4PLI A;  4RG2 A;  2K4Y A;  1UEB A;  3KBG A;  4ZN1 A;  3QSU A;  2XI9 A;  4JRI A;  1VIE A;  2CZ1 B;  3NFC A;  2HBP A;  4A4F A;  3JCM h;  2RHU A;  2IVW A;  3FRN A;  3QKJ A;  2KAF A;  4N4H A;  4F7U F;  3M4Y A;  4LDV A;  3CCQ A;  1K9M U;  2FYK A;  4E7H A;  1JRI A;  2QI2 A;  1QVG A;  4FT2 A;  3CC7 A;  2GQV A;  5C6S A;  5LL6 S;  2AHJ B;  4M7A C;  5L8R E;  4PJO B;  1M1F A;  3E19 A;  3CCS T;  1U1S A;  1Q81 U;  4ZTF A;  2DZC A;  1VUB A;  3UDC A;  4M7D A;  2RD1 A;  3GNF B;  4OP0 A;  1NZ9 A;  5D6X A;  3HRS A;  1I4K 1;  3CCE A;  1M90 C;  3J7A F;  5CKF A;  4M77 D;  5CAI A;  3GIB A;  5GAO q;  3LX7 A;  5FRO A;  3PMT A;  3HSB A;  4C92 B;  2EFI A;  3FDR A;  5AYF A;  2PVG B;  3CME A;  4IUV A;  4ELZ C;  3JB9 G;  1VQ4 A;  2DZ9 A;  3G71 T;  4QQG A;  1Y7X A;  2XIC A;  2MI6 A;  2QQA A;  1G3S A;  1YJ9 A;  2KSS A;  4M77 E;  4B9W A;  1XQH A;  2FHD A;  5CQY A;  3PIP A;  3CMA A;  3CCV T;  2L3R A;  4M7D G;  2M9U A;  4LD9 K;  3A8L B;  3MEW A;  1Y71 A;  2E41 A;  4WF2 A;  2VYT A;  4A4E A;  2DTH A;  4A53 A;  2M16 A;  5GAO l;  3T9N A;  3DB4 A;  3P8H A;  1KQ1 A;  2MF2 A;  2VC8 A;  3OYA A;  4EPC A;  1B34 B;  1K73 U;  2E10 A;  2E6N A;  2DXU A;  3C95 A;  1O75 A;  3L2W A;  4BDZ A;  1M90 U;  4JS5 A;  4BE0 A;  1M9S A;  1HK9 A;  2VXF A;  3M58 A;  4C0D B;  1N8R C;  5CKB A;  4IUU A;  5I2M A;  3OSV A;  5GAN 8;  3OS5 A;  3CCU T;  2VXE A;  4KUL A;  5LJ5 j;  2RI2 A;  2LCC A;  3GOX A;  4QQ6 A;  3JCM P;  3M4G A;  3A8G B;  5IAY A;  3CPF A;  3O8V A;  3QII A;  2JVV A;  2E1H A;  2EQK A;  3OB9 A;  3F70 A;  3QBY A;  5D6W A;  1BI2 A;  1BIA A;  4XTZ A;  1VQ7 T;  5I2S A;  3OYC A;  4MZP A;  4KBM B;  3I55 A;  2QXF A;  3SWN C;  2FB7 A;  4C92 F;  4M77 A;  2LRQ A;  2RM4 A;  3HPW A;  4FT4 A;  4PLL A;  1VQP A;  1W2B S;  3HKS A;  3ME9 A;  2ZGW A;  4M78 A;  2E64 A;  4GLK A;  5KCO A;  5LJ5 f;  4OB3 B;  4OB0 B;  1AHJ B;  5GAN 4;  4BAC A;  3NTI A;  5I21 A;  4L6V 5;  2OTL A;  2DIQ A;  4X34 A;  1BIB A;  2JTM A;  3V8J A;  4C0Z A;  1WQW A;  2EQM A;  2GF7 A;  4BUG A;  3PGG A;  4DA4 A;  3CC7 T;  4R56 A;  1FX7 A;  4FSX A;  3WVE B;  4ELY C;  3VYH B;  2ZPB B;  3GF5 A;  4RCB A;  4XU3 A;  4RMO A;  4PJO A;  2E5Q A;  4M77 G;  3QZ5 B;  3BDU A;  3JB9 H;  1VQ9 A;  2K3Y A;  4M7D C;  2LQK A;  3TCJ A;  4M78 G;  1Q7Y C;  2RJF A;  3QYG B;  3CCE T;  4QQD A;  3FIF A;  3MEV A;  2XG8 D;  4BE2 A;  4XK8 E;  3OYH A;  5J39 A;  1S72 A;  2XDB A;  2PUK B;  3OMC A;  1YJN A;  4MML A;  3EFS A;  1YHQ A;  1VQ6 A;  4DOV A;  4M75 B;  5GAN 7;  4C92 A;  3CME T;  4OB2 B;  1M8V A;  4QVC A;  3LH0 A;  1VQ4 T;  5LJ3 j;  5GAN 3;  3RMQ A;  2MMP A;  1UGR B;  3HFN A;  1PSE A;  3J80 E;  3OYB A;  2VGN A;  4PJO G;  3CXC S;  1VQO A;  5CKE A;  2OTJ T;  3WXM B;  3X25 B;  4J7F A;  1YJ9 T;  4PNO A;  1PSF A;  2WSF E;  5A0D A;  4A4H A;  2PUO B;  3LW5 E;  4OGE A;  5GAM j;  2P0K A;  2BIV A;  3LWI A;  5GMK m;  3JCM X;  1Q81 C;  4JJN K;  3UWN A;  5HKC A;  2EYQ A;  2QQ9 A;  3GNG A;  3HP9 A;  2KQW A;  3PMI A;  4C92 G;  3JCM Q;  3EAE A;  4KT0 E;  5LJ3 f;  3VU3 C;  4VUB A;  1B34 A;  2CZ6 B;  4XQ3 A;  4EMH A;  4JS4 A;  3I56 A;  2LCL A;  4M77 B;  3OS1 A;  4OGC A;  1BYM A;  4M75 D;  2F5T X;  4QVZ A;  5GAM f;  5D6Y A;  2DXT A;  3JB9 I;  5LJ5 d;  2QQR A;  3CBM A;  4C8Q B;  5DLQ E;  1DJ7 B;  2DD4 A;  3QJ6 A;  4R55 A;  3VUZ A;  3LYI A;  4JUV A;  3QO3 A;  4IUQ A;  5M9O A;  3M56 A;  3JCM b;  3X20 B;  2RHI A;  2VV5 A;  5FLX E;  4ZGJ B;  1VQN A;  2HNI A;  4BB7 A;  4L5G A;  1P92 A;  5LJ5 h;  1QP3 A;  2GFA A;  1MGQ A;  2ZPF B;  2KVQ G;  2WAC A;  4M75 E;  4M77 C;  5A0G A;  5FU6 B;  1NPP A;  3G7Z A;  1N9S A;  4M78 C;  1VQM A;  2CZ0 B;  5GMK h;  4BY6 C;  2YLC A;  1XOV A;  3OMG A;  3GP8 A;  1K73 C;  2C06 A;  3LGL A;  2OTL T;  4FM4 B;  3HHT B;  3S6W A;  4JLG A;  1IRE B;  3H6Z A;  3E1S A;  4XTW A;  5GAN g;  1V29 B;  2XDP A;  4E7I A;  3S3O A;  3QUI A;  1JJ2 S;  2HQE A;  2V8J A;  2LX9 A;  5FU7 B;  3ZEH A;  4E7L A;  3RKW A;  1WGS A;  3CC4 T;  4C5I A;  5CO7 A;  2LTO A;  4HCC A;  1KQ2 A;  3CD6 T;  4C8Q D;  3DKM A;  2OAU A;  3H8Z A;  3OW2 S;  4PJO C;  1G3T A;  1X01 A;  2D0Q B;  1VQ9 T;  1ZBX A;  2E65 A;  4XTU A;  3MP8 A;  2QEX A;  3A5Z B;  2JOY A;  1KC8 U;  4M77 F;  3TRE A;  1UGP B;  1YJW A;  4HCB A;  4KUD K;  3QZ9 B;  1YJN T;  2DD5 A;  4C0F A;  3MET A;  5LJ3 e;  4M78 F;  1YHQ T;  1KD1 C;  3RIR A;  1FWZ A;  4MDX A;  5GMK l;  4BE1 A;  1VQ6 T;  4IUT A;  1H3Z A;  4XAX B;  3JCM g;  4C92 C;  3ZBD A;  4M7A D;  4M75 A;  4C8Q E;  2RJD A;  4J7I A;  2X4J A;  2RI3 A;  3PT9 A;  4DOW A;  4TVR A;  4ATO A;  3PIO A;  3L2R A;  1YI2 T;  1H64 1;  2DVE A;  2EIF A;  3BY7 A;  5GAM e;  1QVG S;  5LJ3 d;  2RO0 A;  4E7K A;  2DO3 A;  3V7S A;  4E47 A;  2VUB A;  4NL3 A;  1YIJ A;  3SFM A;  3FJP A;  2HQX A;  2QQB A;  3CEY A;  4XTV A;  2CKK A;  4PJO F;  1W2B A;  1WJR A;  5GAM d;  3OYI A;  3CPW S;  2CYZ B;  4M7A E;  3WVD B;  2JNG A;  3C12 A;  2CS7 A;  3DB3 A;  2R57 A;  1WNL A;  2GFU A;  2P4T A;  1M4Z A;  2I2L A;  3M59 A;  3QJY A;  4M75 G;  4QVD A;  1VQ5 A;  4ME7 A;  5DLO A;  5GAM h;  2Y90 A;  3I56 T;  2ZPI B;  3CC2 A;  4JRK A;  2XKO C;  1KD1 U;  3X28 B;  4C0D C;  1X6O A;  4J8O A;  2DTO A;  3HRT A;  5CQX A;  2O4X B;  5GAO n;  4CI0 C;  4B9X A;  2E70 A;  4EMG A;  1ZHI A;  2M1H A;  4GY5 A;  1K8A U;  1G5V A;  4HA8 A;  3BFM A;  4C8Q A;  2LVM A;  3CCJ A;  4A4K A;  3PTA A;  2LT4 A;  3MHX A;  3CCQ T;  1VQN T;  4HKE A;  1QVF S;  4C5E A;  3M53 A;  2RI5 A;  3MO8 A;  3PFS A;  1VQM T;  2A7Y A;  3C94 A;  2L5Q A;  1RI0 A;  2K5L A;  1O9S A;  4IUR A;  2RHY A;  3CXC A;  4HT9 A;  3LGF A;  3OBY A;  3ER0 A;  4Y91 A;  4ZGD B;  4C8Q G;  4Z02 A;  3OS2 A;  5CKD A;  4X9C A;  3QG1 A;  3OYY A;  2LT1 A;  3JCM J;  2V8K A;  1I81 A;  2RH2 A;  3INZ A;  2R5A A;  3DLM A;  1N9R A;  2YHT A;  2RA2 A;  3M5A A;  2XD0 A;  2GCX A;  2K5I A;  3E9G A;  1NJI U;  4QW2 A;  1LJO A;  1UGS B;  3TEE A;  3CMA T;  2KK4 A;  2WSE E;  3FB9 A;  1I8F A;  1OI1 A;  1UGQ B;  4Q5W A;  5GMK i;  2RHZ A;  3MEA A;  5HY6 A;  2XK0 A;  3JB9 D;  4N0A A;  4LD6 A;  3CCV A;  2P0P A;  2PQW A;  4M75 C;  4F7U B;  2EJG A;  4JRP A;  3VJP A;  4O5V A;  3VKI A;  2ZPG B;  4BI4 A;  2XDD A;  4IKF A;  1OYX A;  4M7D D;  2R58 A;  1RL2 A;  4EMK B;  5GAN 2;  3J81 E;  4C5G A;  2PVD B;  1YIJ T;  1BKB A;  5DY9 A;  4NOY A;  3M55 A;  3CCR A;  1ZQ1 A;  4FIB A;  4V2S A;  2RK2 A;  3V8K A;  4FL6 A;  4ZTJ A;  5GAO p;  1YIT A;  1MHN A;  2H3J A;  3JCM W;  3OBW A;  1M1G A;  3R6O A;  3L1A A;  3ZFJ A;  3OY9 A;  2EJ9 A;  4MDW A;  1M1K U;  1VQ5 T;  1NPR A;  1KC8 C;  4ZGE B;  4M7D E;  1Q86 U;  4NL2 A;  3I55 T;  4J5Y A;  3NTK A;  3CC2 T;  1JJ2 A;  3JCM e;  4HT8 A;  1KHI A;  4FU6 A;  5GAO m;  1VQ8 A;  4M75 F;  4MZT A;  5KE2 A;  1HXD A;  1G3W A;  2LC4 A;  1VQP T;  1VQ7 A;  3Q1J A;  2IG0 A;  1VQL A;  3MEU A;  2BKD N;  4ZN3 A;  3JCM V;  1WPY A;  2V8I A;  4M7A B;  2O4X A;  1BI3 A;  3HRU A;  4BI3 A;  2EWN A;  4C8Q C;  1Q82 C;  3CCJ T;  2DKG A;  5CKH A;  2DXB A;  3HL8 A;  1Y96 A;  4OB1 B;  1IZ6 A;  2Y4Y A;  2HAX A;  4D6W A;  1KQS S;  1LNX A;  2X35 A;  4C5H A;  3X26 B;  5CCA A;  3KUF A;  2MWO A;  2DPP B;  2L8D A;  4F7U E;  3V8L A;  2R5M A;  5FU6 C;  4RG8 A;  3OS0 A;  3P8B B;  4KUI A;  1N6A A;  3OA6 A;  3LWH A;  2ZCF B;  1XNI A;  1QP2 A;  3OQ5 A;  4L59 A;  4OMF B;  3S3M A;  1YCY A;  2X4X A;  3L2U A;  2KY9 A;  3JAM E;  3KXT A;  3JSC A;  1QW1 A;  3P8D A;  3GPL A;  1S72 T;  4LDX A;  4XU0 A;  4JLI A;  2DTI A;  3N5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...